F334261

General Info

Members Datasets Scaffolds Average Seq Length
222 120 444 282

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100004273|Ga0070665_10000427312
Length 315
Sequence VVVRFMMPSSADVYSLMVRMLTTIGMRRLNLRCVALAVLVACGTAAPLHAQTDAELRPDRPSPVVLSGTPGSDPAALASPFDLDQGLQPAGPPPTPRHTGIKAMVKGLFVDFKYLPSKENAMWAGVGGSLALALHPLDDNVNSALVGNSAAEAFFKPGAILGALPTLLGSASIVYAVGRMKDEPKVSHVGMDLIQAIAMSEIITESLKYATGRERPDGSGATSFPSGHAADTFAFATALERHLGWKYAVPAYLLASYVATSRLPANRHWLSDVVFGSAVGIIAGRTVTSHEAQPFPVVVSVLPGGLAVTYVRRGQ

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 5.41
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 19.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100004273 3300005548 Bacteria 15017
2 MRS1b_contig_9288101 2162886011 Unclassified 1578
3 Ga0065715_10089828 3300005293 Bacteria 8392
4 Ga0065715_10200909 3300005293 Bacteria 1349
5 Ga0070683_100001835 3300005329 Bacteria 16565
6 Ga0070670_100003113 3300005331 Bacteria 13725
7 Ga0070670_100050116 3300005331 Unclassified 3588
8 Ga0070670_100199517 3300005331 Bacteria 1738
9 Ga0068869_100003501 3300005334 Bacteria 9621
10 Ga0068869_100132951 3300005334 Bacteria 1914
11 Ga0068869_100189445 3300005334 Bacteria 1617
12 Ga0070689_100055576 3300005340 Bacteria 3068
13 Ga0070687_100160360 3300005343 Bacteria 1329
14 Ga0070661_100027226 3300005344 Unclassified 4115
15 Ga0070668_100039696 3300005347 Bacteria 3599
16 Ga0070675_100007005 3300005354 Bacteria 8664
17 Ga0070671_100139269 3300005355 Unclassified 2047
18 Ga0070671_100146519 3300005355 Unclassified 1993
19 Ga0070674_100003725 3300005356 Bacteria 8593
20 Ga0070673_100330246 3300005364 Bacteria 1349
21 Ga0070688_100184511 3300005365 Bacteria 1449
22 Ga0070688_100420690 3300005365 Unclassified 993
23 Ga0070659_100134179 3300005366 Bacteria 2013
24 Ga0070701_10029230 3300005438 Bacteria 2716
25 Ga0070694_100086787 3300005444 Unclassified 2187
26 Ga0070678_100164934 3300005456 Unclassified 1799
27 Ga0070662_100008869 3300005457 Bacteria 6555
28 Ga0070662_100067203 3300005457 Bacteria 2632
29 Ga0070681_10271183 3300005458 Unclassified 1608
30 Ga0068867_100081181 3300005459 Bacteria 2444
31 Ga0070685_10011759 3300005466 Bacteria 4588
32 Ga0070699_100001162 3300005518 Bacteria 24434
33 Ga0070699_100067026 3300005518 Bacteria 3117
34 Ga0070679_100547995 3300005530 Bacteria 1100
35 Ga0070684_100014429 3300005535 Bacteria 6401
36 Ga0070697_100268190 3300005536 Bacteria 1463
37 Ga0070672_100052048 3300005543 Bacteria 3195
38 Ga0070672_100075299 3300005543 Bacteria 2694
39 Ga0070672_100206306 3300005543 Bacteria 1645
40 Ga0070672_100232732 3300005543 Bacteria 1548
41 Ga0070686_100080102 3300005544 Bacteria 2160
42 Ga0070695_100429269 3300005545 Unclassified 1008
43 Ga0070665_100033256 3300005548 Bacteria 5189
44 Ga0070664_100000632 3300005564 Bacteria 27005
45 Ga0070664_100013773 3300005564 Bacteria 6592
46 Ga0070664_100033878 3300005564 Bacteria 4281
47 Ga0068859_100409636 3300005617 Bacteria 1452
48 Ga0068859_100633431 3300005617 Bacteria 1162
49 Ga0068861_100267659 3300005719 Unclassified 1466
50 Ga0068861_100308985 3300005719 Bacteria 1372
51 Ga0068861_100311306 3300005719 Unclassified 1368
52 Ga0068870_10012785 3300005840 Bacteria 3931
53 Ga0068870_10100260 3300005840 Bacteria 1635
54 Ga0068863_100013792 3300005841 Bacteria 7788
55 Ga0068863_100077707 3300005841 Bacteria 3142
56 Ga0068858_100355169 3300005842 Bacteria 1404
57 Ga0068862_100055900 3300005844 Unclassified 3381
58 Ga0068862_100066607 3300005844 Bacteria 3104
59 Ga0081539_10035924 3300005985 Unclassified 2971
60 Ga0075367_10005116 3300006178 Bacteria 6473
61 Ga0097621_100344385 3300006237 Unclassified 1324
62 Ga0075428_100376278 3300006844 Bacteria 1522
63 Ga0075431_100006699 3300006847 Bacteria 11439
64 Ga0075431_100040924 3300006847 Bacteria 4777
65 Ga0075431_100199747 3300006847 Bacteria 2046
66 Ga0075433_10002375 3300006852 Bacteria 14303
67 Ga0075433_10003969 3300006852 Bacteria 11460
68 Ga0075433_10014820 3300006852 Bacteria 6380
69 Ga0075433_10021969 3300006852 Bacteria 5354
70 Ga0075433_10158617 3300006852 Unclassified 2013
71 Ga0075433_10445428 3300006852 Bacteria 1142
72 Ga0075434_100002139 3300006871 Bacteria 17192
73 Ga0075434_100015734 3300006871 Bacteria 7259
74 Ga0075434_100023580 3300006871 Bacteria 6000
75 Ga0075434_100029815 3300006871 Bacteria 5370
76 Ga0075434_100110816 3300006871 Unclassified 2755
77 Ga0075434_100117900 3300006871 Unclassified 2668
78 Ga0075434_100263658 3300006871 Unclassified 1742
79 Ga0075434_100501500 3300006871 Bacteria 1235
80 Ga0075429_100002929 3300006880 Bacteria 14474
81 Ga0097620_100145137 3300006931 Bacteria 2448
82 Ga0097620_100409642 3300006931 Bacteria 1452
83 Ga0097620_100633451 3300006931 Bacteria 1162
84 Ga0075435_100004973 3300007076 Bacteria 9226
85 Ga0075435_100014723 3300007076 Bacteria 5861
86 Ga0075435_100157921 3300007076 Bacteria 1909
87 Ga0111539_10008292 3300009094 Bacteria 13229
88 Ga0111539_10069644 3300009094 Bacteria 4154
89 Ga0111539_10279111 3300009094 Bacteria 1944
90 Ga0111539_10341530 3300009094 Unclassified 1743
91 Ga0105245_10369926 3300009098 Bacteria 1425
92 Ga0114129_10000374 3300009147 Bacteria 52129
93 Ga0114129_10013493 3300009147 Bacteria 11644
94 Ga0114129_10016163 3300009147 Bacteria 10620
95 Ga0114129_10021309 3300009147 Bacteria 9202
96 Ga0114129_10038671 3300009147 Bacteria 6728
97 Ga0114129_10107814 3300009147 Unclassified 3846
98 Ga0114129_10145699 3300009147 Bacteria 3244
99 Ga0114129_10241178 3300009147 Bacteria 2430
100 Ga0114129_10269569 3300009147 Unclassified 2278
101 Ga0114129_10316164 3300009147 Bacteria 2077
102 Ga0105242_10141341 3300009176 Unclassified 2089
103 Ga0105248_10011179 3300009177 Bacteria 9901
104 Ga0105248_10135560 3300009177 Bacteria 2777
105 Ga0105248_10267813 3300009177 Bacteria 1923
106 Ga0105238_10002861 3300009551 Bacteria 17245
107 Ga0105249_10347871 3300009553 Unclassified 1501
108 Ga0105239_10144403 3300010375 Unclassified 2653
109 Ga0157374_10016478 3300013296 Bacteria 6498
110 Ga0157374_10187146 3300013296 Unclassified 2024
111 Ga0157374_10258822 3300013296 Unclassified 1713
112 Ga0163162_10055362 3300013306 Bacteria 3993
113 Ga0157375_10090029 3300013308 Unclassified 3126
114 Ga0163163_10041796 3300014325 Bacteria 4486
115 Ga0163163_10653711 3300014325 Unclassified 1115
116 Ga0157380_10018210 3300014326 Bacteria 5212
117 Ga0157377_10101559 3300014745 Bacteria 1714
118 Ga0157376_10014848 3300014969 Bacteria 5862
119 Ga0163161_10312744 3300017792 Unclassified 1240
120 Ga0207682_10183049 3300025893 Bacteria 958
121 Ga0207688_10003828 3300025901 Bacteria 8210
122 Ga0207643_10046816 3300025908 Bacteria 2445
123 Ga0207649_10063841 3300025920 Bacteria 2326
124 Ga0207681_10034570 3300025923 Unclassified 3325
125 Ga0207681_10357562 3300025923 Bacteria 1170
126 Ga0207694_10023790 3300025924 Bacteria 4651
127 Ga0207650_10034802 3300025925 Bacteria 3654
128 Ga0207650_10131292 3300025925 Bacteria 1960
129 Ga0207650_10146639 3300025925 Unclassified 1859
130 Ga0207659_10000857 3300025926 Bacteria 18059
131 Ga0207659_10218066 3300025926 Unclassified 1532
132 Ga0207644_10025101 3300025931 Bacteria 4096
133 Ga0207644_10039354 3300025931 Unclassified 3337
134 Ga0207644_10329990 3300025931 Bacteria 1235
135 Ga0207690_10161040 3300025932 Bacteria 1673
136 Ga0207706_10045501 3300025933 Bacteria 3888
137 Ga0207706_10107102 3300025933 Bacteria 2460
138 Ga0207669_10003436 3300025937 Bacteria 6845
139 Ga0207691_10099297 3300025940 Unclassified 2599
140 Ga0207691_10103591 3300025940 Bacteria 2537
141 Ga0207691_10181804 3300025940 Bacteria 1837
142 Ga0207711_10024076 3300025941 Bacteria 5096
143 Ga0207711_10189380 3300025941 Unclassified 1874
144 Ga0207689_10045738 3300025942 Bacteria 3619
145 Ga0207689_10267775 3300025942 Bacteria 1414
146 Ga0207679_10026771 3300025945 Bacteria 3980
147 Ga0207679_10187966 3300025945 Bacteria 1714
148 Ga0207651_10026314 3300025960 Bacteria 3631
149 Ga0207651_10248062 3300025960 Bacteria 1455
150 Ga0207668_10044945 3300025972 Bacteria 3009
151 Ga0207677_10027694 3300026023 Bacteria 3574
152 Ga0207678_10141281 3300026067 Bacteria 2055
153 Ga0207641_10014953 3300026088 Bacteria 6362
154 Ga0207641_10018869 3300026088 Bacteria 5658
155 Ga0207648_10070286 3300026089 Bacteria 3052
156 Ga0207676_10019462 3300026095 Bacteria 4954
157 Ga0207675_100037971 3300026118 Bacteria 4494
158 Ga0207675_100104200 3300026118 Bacteria 2674
159 Ga0207683_10072236 3300026121 Bacteria 3051
160 Ga0207683_10076469 3300026121 Bacteria 2964
161 Ga0207428_10002595 3300027907 Bacteria 18048
162 Ga0207428_10196861 3300027907 Bacteria 1517
163 Ga0268266_10016294 3300028379 Bacteria 6354
164 Ga0268266_10047532 3300028379 Bacteria 3677
165 Ga0268265_10008029 3300028380 Bacteria 7126
166 Ga0268265_10091891 3300028380 Bacteria 2428
167 Ga0373931_0012831 3300035691 Bacteria 4068
168 Ga0439450_004631 3300042008 Bacteria 2363
169 Ga0495653_0077872 3300046463 Bacteria 2461
170 Ga0495582_0227069 3300046473 Unclassified 1069
171 Ga0495645_0013358 3300046543 Bacteria 5804
172 Ga0495659_0110986 3300046664 Bacteria 1071
173 Ga0495647_0054506 3300046681 Unclassified 1563
174 Ga0495684_0146869 3300047471 Bacteria 1766
175 Ga0496101_0310093 3300048904 Bacteria 1237
176 Ga0496102_0013165 3300048905 Bacteria 7157
177 Ga0496102_0093540 3300048905 Bacteria 2785
178 Ga0496103_0130934 3300048906 Bacteria 1602
179 Ga0496104_0019463 3300048907 Bacteria 6212
180 Ga0496107_0053771 3300048910 Bacteria 2905
181 Ga0496108_0036335 3300048911 Bacteria 4099
182 Ga0496109_0017166 3300048912 Bacteria 6338
183 Ga0496110_0010860 3300048913 Bacteria 7426
184 Ga0496110_0368973 3300048913 Bacteria 1308
185 Ga0496112_0086546 3300048915 Unclassified 3100
186 Ga0496113_0329301 3300048916 Bacteria 1225
187 nmdc:mga06z11_44465_c1 3300050494 Bacteria 2240
188 nmdc:mga05p37_145082_c1 3300050507 Bacteria 2907
189 nmdc:mga05p37_148753_c1 3300050507 Bacteria 2866
190 nmdc:mga05p37_20444_c1 3300050507 Bacteria 8007
191 nmdc:mga05p37_21225_c1 3300050507 Bacteria 7861
192 nmdc:mga05p37_241784_c1 3300050507 Bacteria 2170
193 nmdc:mga05p37_34_c1 3300050507 Bacteria 111954
194 nmdc:mga05p37_37822_c1 3300050507 Bacteria 5919
195 nmdc:mga05p37_60229_c1 3300050507 Bacteria 4675
196 nmdc:mga05p37_634527_c1 3300050507 Bacteria 1199
197 nmdc:mga05p37_74886_c1 3300050507 Bacteria 4167
198 nmdc:mga05p37_83876_c1 3300050507 Unclassified 3926
199 nmdc:mga09592_5161_c1 3300050508 Bacteria 10610
200 nmdc:mga0qj67_1428_c1 3300050509 Bacteria 16719
201 nmdc:mga06r32_1108_c1 3300050510 Bacteria 24156
202 nmdc:mga06r32_329748_c1 3300050510 Bacteria 1511
203 nmdc:mga08y16_159073_c1 3300050511 Bacteria 2347
204 nmdc:mga08y16_234717_c1 3300050511 Bacteria 1897
205 nmdc:mga08y16_40500_c1 3300050511 Bacteria 4884
206 nmdc:mga0n895_110366_c1 3300050512 Bacteria 2767
207 nmdc:mga0n895_125822_c1 3300050512 Bacteria 2587
208 nmdc:mga0n895_3224_c1 3300050512 Bacteria 13069
209 nmdc:mga0n895_32282_c1 3300050512 Bacteria 5025
210 nmdc:mga0n895_37155_c1 3300050512 Bacteria 4710
211 nmdc:mga0n895_481116_c1 3300050512 Bacteria 1252
212 nmdc:mga0n895_66398_c1 3300050512 Unclassified 3572
213 nmdc:mga0rr50_168799_c1 3300050513 Unclassified 1781
214 nmdc:mga0rr50_1973_c1 3300050513 Bacteria 11392
215 nmdc:mga0rr50_202319_c1 3300050513 Bacteria 1632
216 nmdc:mga0rr50_4582_c1 3300050513 Bacteria 8138
217 nmdc:mga08x19_226249_c1 3300050514 Unclassified 1287
218 nmdc:mga0a205_17183_c1 3300050515 Archaea 6777
219 nmdc:mga0a205_254812_c1 3300050515 Bacteria 1634
220 nmdc:mga0a205_26574_c1 3300050515 Bacteria 5522
221 nmdc:mga0a205_73097_c1 3300050515 Unclassified 3314
222 Ga0495601_0098891 3300053077 Bacteria 1883
223 Ga0070665_100004273
224 MRS1b_contig_9288101
225 Ga0065715_10089828
226 Ga0065715_10200909
227 Ga0070683_100001835
228 Ga0070670_100003113
229 Ga0070670_100050116
230 Ga0070670_100199517
231 Ga0068869_100003501
232 Ga0068869_100132951
233 Ga0068869_100189445
234 Ga0070689_100055576
235 Ga0070687_100160360
236 Ga0070661_100027226
237 Ga0070668_100039696
238 Ga0070675_100007005
239 Ga0070671_100139269
240 Ga0070671_100146519
241 Ga0070674_100003725
242 Ga0070673_100330246
243 Ga0070688_100184511
244 Ga0070688_100420690
245 Ga0070659_100134179
246 Ga0070701_10029230
247 Ga0070694_100086787
248 Ga0070678_100164934
249 Ga0070662_100008869
250 Ga0070662_100067203
251 Ga0070681_10271183
252 Ga0068867_100081181
253 Ga0070685_10011759
254 Ga0070699_100001162
255 Ga0070699_100067026
256 Ga0070679_100547995
257 Ga0070684_100014429
258 Ga0070697_100268190
259 Ga0070672_100052048
260 Ga0070672_100075299
261 Ga0070672_100206306
262 Ga0070672_100232732
263 Ga0070686_100080102
264 Ga0070695_100429269
265 Ga0070665_100033256
266 Ga0070664_100000632
267 Ga0070664_100013773
268 Ga0070664_100033878
269 Ga0068859_100409636
270 Ga0068859_100633431
271 Ga0068861_100267659
272 Ga0068861_100308985
273 Ga0068861_100311306
274 Ga0068870_10012785
275 Ga0068870_10100260
276 Ga0068863_100013792
277 Ga0068863_100077707
278 Ga0068858_100355169
279 Ga0068862_100055900
280 Ga0068862_100066607
281 Ga0081539_10035924
282 Ga0075367_10005116
283 Ga0097621_100344385
284 Ga0075428_100376278
285 Ga0075431_100006699
286 Ga0075431_100040924
287 Ga0075431_100199747
288 Ga0075433_10002375
289 Ga0075433_10003969
290 Ga0075433_10014820
291 Ga0075433_10021969
292 Ga0075433_10158617
293 Ga0075433_10445428
294 Ga0075434_100002139
295 Ga0075434_100015734
296 Ga0075434_100023580
297 Ga0075434_100029815
298 Ga0075434_100110816
299 Ga0075434_100117900
300 Ga0075434_100263658
301 Ga0075434_100501500
302 Ga0075429_100002929
303 Ga0097620_100145137
304 Ga0097620_100409642
305 Ga0097620_100633451
306 Ga0075435_100004973
307 Ga0075435_100014723
308 Ga0075435_100157921
309 Ga0111539_10008292
310 Ga0111539_10069644
311 Ga0111539_10279111
312 Ga0111539_10341530
313 Ga0105245_10369926
314 Ga0114129_10000374
315 Ga0114129_10013493
316 Ga0114129_10016163
317 Ga0114129_10021309
318 Ga0114129_10038671
319 Ga0114129_10107814
320 Ga0114129_10145699
321 Ga0114129_10241178
322 Ga0114129_10269569
323 Ga0114129_10316164
324 Ga0105242_10141341
325 Ga0105248_10011179
326 Ga0105248_10135560
327 Ga0105248_10267813
328 Ga0105238_10002861
329 Ga0105249_10347871
330 Ga0105239_10144403
331 Ga0157374_10016478
332 Ga0157374_10187146
333 Ga0157374_10258822
334 Ga0163162_10055362
335 Ga0157375_10090029
336 Ga0163163_10041796
337 Ga0163163_10653711
338 Ga0157380_10018210
339 Ga0157377_10101559
340 Ga0157376_10014848
341 Ga0163161_10312744
342 Ga0207682_10183049
343 Ga0207688_10003828
344 Ga0207643_10046816
345 Ga0207649_10063841
346 Ga0207681_10034570
347 Ga0207681_10357562
348 Ga0207694_10023790
349 Ga0207650_10034802
350 Ga0207650_10131292
351 Ga0207650_10146639
352 Ga0207659_10000857
353 Ga0207659_10218066
354 Ga0207644_10025101
355 Ga0207644_10039354
356 Ga0207644_10329990
357 Ga0207690_10161040
358 Ga0207706_10045501
359 Ga0207706_10107102
360 Ga0207669_10003436
361 Ga0207691_10099297
362 Ga0207691_10103591
363 Ga0207691_10181804
364 Ga0207711_10024076
365 Ga0207711_10189380
366 Ga0207689_10045738
367 Ga0207689_10267775
368 Ga0207679_10026771
369 Ga0207679_10187966
370 Ga0207651_10026314
371 Ga0207651_10248062
372 Ga0207668_10044945
373 Ga0207677_10027694
374 Ga0207678_10141281
375 Ga0207641_10014953
376 Ga0207641_10018869
377 Ga0207648_10070286
378 Ga0207676_10019462
379 Ga0207675_100037971
380 Ga0207675_100104200
381 Ga0207683_10072236
382 Ga0207683_10076469
383 Ga0207428_10002595
384 Ga0207428_10196861
385 Ga0268266_10016294
386 Ga0268266_10047532
387 Ga0268265_10008029
388 Ga0268265_10091891
389 Ga0373931_0012831
390 Ga0439450_004631
391 Ga0495653_0077872
392 Ga0495582_0227069
393 Ga0495645_0013358
394 Ga0495659_0110986
395 Ga0495647_0054506
396 Ga0495684_0146869
397 Ga0496101_0310093
398 Ga0496102_0013165
399 Ga0496102_0093540
400 Ga0496103_0130934
401 Ga0496104_0019463
402 Ga0496107_0053771
403 Ga0496108_0036335
404 Ga0496109_0017166
405 Ga0496110_0010860
406 Ga0496110_0368973
407 Ga0496112_0086546
408 Ga0496113_0329301
409 nmdc:mga06z11_44465_c1
410 nmdc:mga05p37_145082_c1
411 nmdc:mga05p37_148753_c1
412 nmdc:mga05p37_20444_c1
413 nmdc:mga05p37_21225_c1
414 nmdc:mga05p37_241784_c1
415 nmdc:mga05p37_34_c1
416 nmdc:mga05p37_37822_c1
417 nmdc:mga05p37_60229_c1
418 nmdc:mga05p37_634527_c1
419 nmdc:mga05p37_74886_c1
420 nmdc:mga05p37_83876_c1
421 nmdc:mga09592_5161_c1
422 nmdc:mga0qj67_1428_c1
423 nmdc:mga06r32_1108_c1
424 nmdc:mga06r32_329748_c1
425 nmdc:mga08y16_159073_c1
426 nmdc:mga08y16_234717_c1
427 nmdc:mga08y16_40500_c1
428 nmdc:mga0n895_110366_c1
429 nmdc:mga0n895_125822_c1
430 nmdc:mga0n895_3224_c1
431 nmdc:mga0n895_32282_c1
432 nmdc:mga0n895_37155_c1
433 nmdc:mga0n895_481116_c1
434 nmdc:mga0n895_66398_c1
435 nmdc:mga0rr50_168799_c1
436 nmdc:mga0rr50_1973_c1
437 nmdc:mga0rr50_202319_c1
438 nmdc:mga0rr50_4582_c1
439 nmdc:mga08x19_226249_c1
440 nmdc:mga0a205_17183_c1
441 nmdc:mga0a205_254812_c1
442 nmdc:mga0a205_26574_c1
443 nmdc:mga0a205_73097_c1
444 Ga0495601_0098891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

189

293

0.88

PF14378

PAP2_3

PAP2 superfamily

163

285

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.8127 85 255
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7226 100 258
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.7 85 255
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.6846 100 258
1eoi-assembly1.cif.gz_C-2 crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate 0.6109 99 254
ID Description Score Start End Superfamily
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.786 97 255 1.20.144.10
af_P43428_13_210_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.702 110 259 1.20.144.10
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6673 97 255 1.20.144.10
af_Q4D544_53_235_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6439 100 251 1.20.144.10
1iw8B00 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.5934 119 254 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A538TQT2-F1-model_v4 Phosphatase PAP2 family protein 0.9288 123 260 GO:0016020
AF-A0A538TQT2-F1-model_v4 Phosphatase PAP2 family protein 0.9162 123 260 GO:0016020
AF-A0A0U3E3N9-F1-model_v4 PAP2 family protein 0.8747 104 258 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A496UJR8-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.8718 70 255
AF-A0A2V8HS41-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.8646 63 275

Map