F333882

General Info

Members Datasets Scaffolds Average Seq Length
221 200 442 402

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_80296_c1|nmdc:mga0rr50_80296_c1_17_1159
Length 380
Sequence MSEIANHLAAEHPVLVLSGAPGSQPIDSGPWQPVVIQINNRIPGKAALTRRAIAELCFSVRASVMLLRRAKRGDVVLTVTAPFMLPYAVVAAAKLKGARSALIMHDLYPDVLVMTRLLKPLSLIARAIRGANALMFRILDVVITVGRDTEPLLLHYGGLSRDKIRFIPNWATLVPAVRVIKVDNPYRPRGARFVVGLSGNLGFTHDPAIVFEAARLLRNEDAVHFLLSGWGVGFERLKQLQSETNLRNVTLIERVADDKLEQLLSAANVWIIPYRRKVVGVSVPSRFYNLLAVGRPVILISEPDSEAALTITEKKIGWVVTPDRADELVDKIRVALLSSLRPMAERAVDAARDFSLGRAMADYAHLIGELLHGSKPERAH

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
22 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
25 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
38 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
39 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
40 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
50 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
51 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
52 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
53 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
54 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
55 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
56 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
57 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
58 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
59 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
60 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
61 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
62 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
63 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
64 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
65 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
66 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
67 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
68 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
69 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
70 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
71 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
72 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
73 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
74 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
75 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
76 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
77 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
78 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
79 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
80 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
81 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
82 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
83 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
84 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
85 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
86 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
87 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
88 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
89 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
90 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
91 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
92 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
93 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
94 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
95 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
96 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
97 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
98 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
99 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
100 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
101 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
102 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
103 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
104 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
105 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
106 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
107 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
108 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
109 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
110 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
111 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
112 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
113 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
114 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
115 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
116 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
117 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
118 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
119 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
120 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
121 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
122 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
123 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
124 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
125 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
126 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
127 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
128 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
129 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
130 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
131 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
132 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
133 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
134 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
135 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
136 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
137 2922368715
138 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
139 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
140 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
141 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
142 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
143 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
144 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
145 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
146 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
147 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
148 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
149 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
150 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
151 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
152 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
153 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
154 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
155 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
156 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
157 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
158 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
159 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
160 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
161 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
162 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
163 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
164 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
165 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
166 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
167 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
168 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
169 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
170 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
171 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
172 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
173 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
174 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
175 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
176 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
177 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
178 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
179 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
180 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
181 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
182 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
183 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
184 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
185 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
186 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
187 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
188 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
189 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
190 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
191 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
192 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
193 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
194 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
195 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
196 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
197 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
198 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
199 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
200 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.27
Metatranscriptomes 0
Isolates 52.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.62
Nodule 38.91
Rhizoplane 0.9
Rhizosphere 19.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_80296_c1 3300050513 Bacteria 2514
2 JGI25153J46596_10000247 3300003215 Bacteria 44807
3 JGI25153J46596_10000967 3300003215 Bacteria 17415
4 JGI25153J46596_10002494 3300003215 Bacteria 10569
5 JGI25153J46596_10003009 3300003215 Bacteria 9536
6 JGI25160J50197_1000725 3300003354 Bacteria 18100
7 JGI25160J50197_1002915 3300003354 Bacteria 7825
8 Ga0055543_1001472 3300004625 Bacteria 9299
9 Ga0065165_1001022 3300005262 Bacteria 33988
10 Ga0070663_100110655 3300005455 Bacteria 2063
11 Ga0070665_100034431 3300005548 Bacteria 5093
12 Ga0068852_100003841 3300005616 Bacteria 10553
13 Ga0081455_10002315 3300005937 Bacteria 22718
14 Ga0081455_10003763 3300005937 Bacteria 17325
15 Ga0081540_1003175 3300005983 Bacteria 13113
16 Ga0075368_10009055 3300006042 Bacteria 3573
17 Ga0075367_10013789 3300006178 Bacteria 4358
18 Ga0075369_10010631 3300006186 Bacteria 3604
19 Ga0099822_1023333 3300006943 Bacteria 5708
20 Ga0105241_10141523 3300009174 Bacteria 1959
21 Ga0105241_10243525 3300009174 Bacteria 1521
22 Ga0105237_10006263 3300009545 Bacteria 13240
23 Ga0105239_10090979 3300010375 Bacteria 3367
24 Ga0105246_10229736 3300011119 Bacteria 1460
25 Ga0209563_101738 3300025230 Bacteria 5495
26 Ga0209148_1000572 3300025254 Bacteria 34315
27 Ga0209233_1000855 3300025261 Bacteria 13478
28 Ga0209233_1004890 3300025261 Bacteria 4507
29 Ga0209455_1007384 3300025272 Bacteria 3108
30 Ga0209564_1011076 3300025295 Bacteria 4078
31 Ga0209564_1015421 3300025295 Bacteria 3108
32 Ga0209758_1000075 3300025297 Bacteria 271585
33 Ga0209758_1000187 3300025297 Bacteria 138759
34 Ga0209758_1001569 3300025297 Bacteria 26204
35 Ga0209758_1001698 3300025297 Bacteria 24781
36 Ga0209758_1004277 3300025297 Bacteria 12060
37 Ga0209256_1001417 3300025299 Bacteria 24921
38 Ga0207426_1000422 3300025302 Bacteria 69436
39 Ga0207426_1014554 3300025302 Bacteria 2878
40 Ga0209051_1038616 3300025303 Bacteria 1735
41 Ga0207695_10000029 3300025913 Bacteria 548364
42 Ga0207671_10012119 3300025914 Bacteria 6962
43 Ga0207689_10272905 3300025942 Bacteria 1400
44 Ga0207667_10275514 3300025949 Bacteria 1720
45 Ga0207678_10010258 3300026067 Bacteria 8224
46 Ga0207678_10053135 3300026067 Bacteria 3492
47 Ga0207678_10131476 3300026067 Bacteria 2135
48 Ga0207678_10200104 3300026067 Bacteria 1708
49 Ga0207698_10016441 3300026142 Bacteria 4987
50 Ga0209589_1001229 3300027357 Bacteria 41464
51 Ga0268266_10011483 3300028379 Bacteria 7693
52 Ga0268266_10146259 3300028379 Bacteria 2125
53 Ga0307517_10000154 3300028786 Bacteria 109811
54 Ga0307510_10036452 3300033180 Bacteria 5472
55 Ga0395899_0133296 3300037312 Bacteria 1773
56 Ga0466969_0044180 3300044656 Bacteria 2218
57 Ga0466972_0000444 3300044658 Bacteria 21383
58 Ga0466965_0009344 3300044683 Bacteria 4556
59 Ga0466966_0000734 3300044684 Bacteria 20851
60 Ga0466961_0000084 3300044693 Bacteria 58908
61 Ga0466963_0046196 3300044694 Bacteria 2870
62 Ga0466968_0014262 3300044735 Bacteria 3139
63 Ga0466957_0036032 3300044842 Bacteria 2972
64 Ga0466960_0020879 3300044901 Bacteria 2909
65 Ga0466959_0001276 3300045049 Bacteria 15229
66 Ga0495643_0009447 3300046522 Bacteria 6062
67 Ga0495648_0104359 3300046524 Bacteria 1557
68 Ga0495672_0018402 3300047320 Bacteria 4638
69 Ga0495687_007015 3300047443 Bacteria 6757
70 Ga0495673_0032789 3300047469 Bacteria 2417
71 Ga0496102_0114577 3300048905 Bacteria 2515
72 Ga0496110_0122253 3300048913 Bacteria 2346
73 Ga0496118_0022039 3300048921 Bacteria 5585
74 Ga0496119_0089851 3300048922 Bacteria 1748
75 Ga0496121_0027938 3300048924 Bacteria 5268
76 Ga0496121_0060350 3300048924 Bacteria 3119
77 Ga0496126_0024668 3300048929 Bacteria 5803
78 Ga0496126_0060856 3300048929 Bacteria 3394
79 Ga0495682_0020518 3300049460 Bacteria 2481
80 nmdc:mga06z11_16453_c1 3300050494 Bacteria 3332
81 nmdc:mga07m45_98458_c1 3300050496 Bacteria 1679
82 nmdc:mga05p37_125912_c1 3300050507 Bacteria 3146
83 nmdc:mga0sz30_16691_c1 3300050516 Bacteria 2920
84 nmdc:mga0sz30_40359_c1 3300050516 Bacteria 1962
85 Ga0495601_0078611 3300053077 Bacteria 2114
86 Ga0500643_000060 3300053087 Bacteria 128090
87 Ga0500646_0014616 3300053090 Bacteria 2039
88 Ga0500566_0000339 3300053094 Bacteria 25453
89 Ga0500650_0051190 3300053098 Bacteria 1918
90 Ga0500557_000007 3300053105 Bacteria 136781
91 Ga0500607_029915 3300053121 Bacteria 3005
92 Ga0500642_0000121 3300053130 Bacteria 35928
93 Ga0500658_0038722 3300053134 Bacteria 1902
94 Ga0500568_0007475 3300053139 Bacteria 5356
95 Ga0500622_0006310 3300053156 Bacteria 6919
96 Ga0500627_0085387 3300053158 Bacteria 1410
97 Ga0500633_0029239 3300053160 Bacteria 1761
98 Ga0500638_022511 3300053162 Bacteria 2986
99 Ga0500636_0000449 3300053177 Bacteria 22554
100 Ga0500637_0060033 3300053178 Bacteria 2177
101 Ga0500625_002429 3300053729 Bacteria 6984
102 Ga0500609_001921 3300053731 Bacteria 3005
103 Ga0500599_001463 3300053736 Bacteria 2719
104 Ga0500601_000172 3300053737 Bacteria 13464
105 2507510264 2507262055 Bacteria 8048963
106 2508544274 2508501009 Bacteria 7784016
107 2511400728 2511231028 Bacteria 8046582
108 2513628689 2513237092 Bacteria 8341956
109 2513716015 2513237104 Bacteria 10034502
110 2513878596 2513237139 Bacteria 8737671
111 2514013466 2513237161 Bacteria 8871253
112 2517105334 2517093001 Bacteria 9002274
113 2617349845 2617270735 Bacteria 9163226
114 2793065066 2791355196 Bacteria 7323613
115 2793071480 2791355197 Bacteria 8420563
116 2805917274 2802429603 Bacteria 8777136
117 2824607373 2824600985 Bacteria 8488197
118 2824612419 2824609381 Bacteria 8672835
119 2824621223 2824617872 Bacteria 8814715
120 2824629664 2824626560 Bacteria 8813858
121 2824636973 2824635225 Bacteria 8785348
122 2824649238 2824644064 Bacteria 8743947
123 2824661082 2824653114 Bacteria 8493680
124 2824664684 2824661429 Bacteria 9877870
125 2824676008 2824671348 Bacteria 8369588
126 2824684549 2824679649 Bacteria 8248951
127 2824692213 2824687955 Bacteria 8360029
128 2824700296 2824696289 Bacteria 8335049
129 2824713409 2824704595 Bacteria 9667483
130 2824716948 2824714736 Bacteria 8717648
131 2824725404 2824723954 Bacteria 8758240
132 2824778383 2824773399 Bacteria 8360218
133 2838125552 2838122688 Bacteria 8803140
134 2841951216 2841949485 Bacteria 8680857
135 2841968793 2841966195 Bacteria 8673214
136 2841976011 2841974524 Bacteria 8931498
137 2841989135 2841983080 Bacteria 8395090
138 2842045257 2842038055 Bacteria 8002051
139 2842049081 2842045827 Bacteria 8006841
140 2844317479 2844315083 Bacteria 8138177
141 2847934268 2847930680 Bacteria 9342022
142 2847944850 2847939898 Bacteria 8606328
143 2849080942 2849076700 Bacteria 7039503
144 2857509704 2857509624 Bacteria 7472071
145 2874614136 2874612657 Bacteria 8252029
146 2874632788 2874628541 Bacteria 8630250
147 2874646671 2874645413 Bacteria 8214782
148 2876769547 2876761206 Bacteria 10111113
149 2879109917 2879099564 Bacteria 10442239
150 2885412822 2885409591 Bacteria 9235467
151 2888382175 2888378607 Bacteria 9652610
152 2888388498 2888388044 Bacteria 7304136
153 2888422781 2888419890 Bacteria 7857137
154 2903733132 2903727486 Bacteria 8281579
155 2906603985 2906602504 Bacteria 8295279
156 2906626484 2906626472 Bacteria 8826946
157 2906631638 2906626472 Bacteria 8826946
158 2922372253
159 2922399149 2922393267 Bacteria 8285685
160 2929616541 2929615660 Bacteria 9193770
161 2929625285 2929624759 Bacteria 9339455
162 2932786782 2932784394 Bacteria 9704911
163 2932818043 2932809354 Bacteria 9135765
164 2932828107 2932818245 Bacteria 9955613
165 2932832627 2932828146 Bacteria 9745859
166 2933578176 2933577622 Bacteria 9116884
167 2935610821 2935608549 Bacteria 8203142
168 2935619328 2935616580 Bacteria 9032984
169 2935683746 2935675223 Bacteria 9928132
170 2935691955 2935684952 Bacteria 9590419
171 2935695098 2935694250 Bacteria 9291695
172 2935708021 2935703347 Bacteria 10242284
173 2935721794 2935713505 Bacteria 9608509
174 2935731208 2935722832 Bacteria 9608746
175 2935738930 2935732158 Bacteria 9706831
176 2935747885 2935741537 Bacteria 9707219
177 2935756469 2935750917 Bacteria 9590372
178 2935761549 2935760218 Bacteria 9817913
179 2935774457 2935769743 Bacteria 7878163
180 2935783423 2935777560 Bacteria 8077691
181 2935790524 2935785616 Bacteria 7962367
182 2935799068 2935793552 Bacteria 8012592
183 2935820305 2935819856 Bacteria 8261050
184 2935838916 2935837841 Bacteria 9454360
185 2935849685 2935847175 Bacteria 8228321
186 2935857693 2935855204 Bacteria 9035059
187 2935873325 2935864058 Bacteria 9784707
188 2935882916 2935873716 Bacteria 9632195
189 2935889302 2935883170 Bacteria 7964738
190 2935919175 2935916978 Bacteria 9113783
191 2935966085 2935959822 Bacteria 7869783
192 2935979853 2935975950 Bacteria 8347125
193 2935987612 2935984226 Bacteria 8302647
194 2935997461 2935992306 Bacteria 9802711
195 2936005241 2936002035 Bacteria 9362176
196 2940562383 2940556831 Bacteria 9590747
197 2941539604 2941538514 Bacteria 9402094
198 3005512298 3005506211 Bacteria 6943378
199 3005597202 3005594810 Bacteria 8716512
200 3005713233 3005710791 Bacteria 7622528
201 3005720596 3005718088 Bacteria 8283608
202 8016515454 8016511872 Bacteria 9921665
203 8016523148 8016522445 Bacteria 8156687
204 8016536622 8016530956 Bacteria 8155261
205 8016540903 8016539877 Bacteria 8155419
206 8016552344 8016548790 Bacteria 8155074
207 8016560730 8016557553 Bacteria 8154380
208 8016566294 8016566248 Bacteria 8158151
209 8016579050 8016575299 Bacteria 8154085
210 8016598609 8016595262 Bacteria 8149947
211 8016612492 8016603502 Bacteria 8731218
212 8016621317 8016613128 Bacteria 8794220
213 8016628703 8016622563 Bacteria 7999408
214 8017061025 8017057580 Bacteria 10023680
215 8019536331 8019530166 Bacteria 8155624
216 8019543132 8019538911 Bacteria 7872763
217 8019636244 8019629233 Bacteria 8687553
218 8019656222 8019648815 Bacteria 10014479
219 8019673640 8019668869 Bacteria 8791617
220 8055748187 8055742211 Bacteria 9226248
221 8056968996 8056967851 Bacteria 9038162
222 nmdc:mga0rr50_80296_c1
223 JGI25153J46596_10000247
224 JGI25153J46596_10000967
225 JGI25153J46596_10002494
226 JGI25153J46596_10003009
227 JGI25160J50197_1000725
228 JGI25160J50197_1002915
229 Ga0055543_1001472
230 Ga0065165_1001022
231 Ga0070663_100110655
232 Ga0070665_100034431
233 Ga0068852_100003841
234 Ga0081455_10002315
235 Ga0081455_10003763
236 Ga0081540_1003175
237 Ga0075368_10009055
238 Ga0075367_10013789
239 Ga0075369_10010631
240 Ga0099822_1023333
241 Ga0105241_10141523
242 Ga0105241_10243525
243 Ga0105237_10006263
244 Ga0105239_10090979
245 Ga0105246_10229736
246 Ga0209563_101738
247 Ga0209148_1000572
248 Ga0209233_1000855
249 Ga0209233_1004890
250 Ga0209455_1007384
251 Ga0209564_1011076
252 Ga0209564_1015421
253 Ga0209758_1000075
254 Ga0209758_1000187
255 Ga0209758_1001569
256 Ga0209758_1001698
257 Ga0209758_1004277
258 Ga0209256_1001417
259 Ga0207426_1000422
260 Ga0207426_1014554
261 Ga0209051_1038616
262 Ga0207695_10000029
263 Ga0207671_10012119
264 Ga0207689_10272905
265 Ga0207667_10275514
266 Ga0207678_10010258
267 Ga0207678_10053135
268 Ga0207678_10131476
269 Ga0207678_10200104
270 Ga0207698_10016441
271 Ga0209589_1001229
272 Ga0268266_10011483
273 Ga0268266_10146259
274 Ga0307517_10000154
275 Ga0307510_10036452
276 Ga0395899_0133296
277 Ga0466969_0044180
278 Ga0466972_0000444
279 Ga0466965_0009344
280 Ga0466966_0000734
281 Ga0466961_0000084
282 Ga0466963_0046196
283 Ga0466968_0014262
284 Ga0466957_0036032
285 Ga0466960_0020879
286 Ga0466959_0001276
287 Ga0495643_0009447
288 Ga0495648_0104359
289 Ga0495672_0018402
290 Ga0495687_007015
291 Ga0495673_0032789
292 Ga0496102_0114577
293 Ga0496110_0122253
294 Ga0496118_0022039
295 Ga0496119_0089851
296 Ga0496121_0027938
297 Ga0496121_0060350
298 Ga0496126_0024668
299 Ga0496126_0060856
300 Ga0495682_0020518
301 nmdc:mga06z11_16453_c1
302 nmdc:mga07m45_98458_c1
303 nmdc:mga05p37_125912_c1
304 nmdc:mga0sz30_16691_c1
305 nmdc:mga0sz30_40359_c1
306 Ga0495601_0078611
307 Ga0500643_000060
308 Ga0500646_0014616
309 Ga0500566_0000339
310 Ga0500650_0051190
311 Ga0500557_000007
312 Ga0500607_029915
313 Ga0500642_0000121
314 Ga0500658_0038722
315 Ga0500568_0007475
316 Ga0500622_0006310
317 Ga0500627_0085387
318 Ga0500633_0029239
319 Ga0500638_022511
320 Ga0500636_0000449
321 Ga0500637_0060033
322 Ga0500625_002429
323 Ga0500609_001921
324 Ga0500599_001463
325 Ga0500601_000172
326 2507510264
327 2508544274
328 2511400728
329 2513628689
330 2513716015
331 2513878596
332 2514013466
333 2517105334
334 2617349845
335 2793065066
336 2793071480
337 2805917274
338 2824607373
339 2824612419
340 2824621223
341 2824629664
342 2824636973
343 2824649238
344 2824661082
345 2824664684
346 2824676008
347 2824684549
348 2824692213
349 2824700296
350 2824713409
351 2824716948
352 2824725404
353 2824778383
354 2838125552
355 2841951216
356 2841968793
357 2841976011
358 2841989135
359 2842045257
360 2842049081
361 2844317479
362 2847934268
363 2847944850
364 2849080942
365 2857509704
366 2874614136
367 2874632788
368 2874646671
369 2876769547
370 2879109917
371 2885412822
372 2888382175
373 2888388498
374 2888422781
375 2903733132
376 2906603985
377 2906626484
378 2906631638
379 2922372253
380 2922399149
381 2929616541
382 2929625285
383 2932786782
384 2932818043
385 2932828107
386 2932832627
387 2933578176
388 2935610821
389 2935619328
390 2935683746
391 2935691955
392 2935695098
393 2935708021
394 2935721794
395 2935731208
396 2935738930
397 2935747885
398 2935756469
399 2935761549
400 2935774457
401 2935783423
402 2935790524
403 2935799068
404 2935820305
405 2935838916
406 2935849685
407 2935857693
408 2935873325
409 2935882916
410 2935889302
411 2935919175
412 2935966085
413 2935979853
414 2935987612
415 2935997461
416 2936005241
417 2940562383
418 2941539604
419 3005512298
420 3005597202
421 3005713233
422 3005720596
423 8016515454
424 8016523148
425 8016536622
426 8016540903
427 8016552344
428 8016560730
429 8016566294
430 8016579050
431 8016598609
432 8016612492
433 8016621317
434 8016628703
435 8017061025
436 8019536331
437 8019543132
438 8019636244
439 8019656222
440 8019673640
441 8055748187
442 8056968996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

181

354

0.88

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

192

338

0.81

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

1

173

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8397 217 380
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8302 217 380
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8079 219 380
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.7982 219 380
3mbo-assembly1.cif.gz_A crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7906 5 399
ID Description Score Start End Superfamily
af_Q2G1J7_226_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8959 221 383 3.40.50.2000
af_P32057_215_394_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8833 212 379 3.40.50.2000
af_Q2G1J7_226_391_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8757 221 383 3.40.50.2000
4x6lA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8416 218 379 3.40.50.2000
af_Q2G1K0_190_352_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8332 216 379 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1M7BDA0-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.9161 5 400 GO:0016757
AF-A0A350BMM1-F1-model_v4 Glycosyltransferase WbuB 0.8989 4 393 GO:0009103
GO:0016020
GO:0016757
GO:0045226
AF-A0A3N5K2A5-F1-model_v4 Glycosyltransferase WbuB 0.8941 4 399 GO:0009103
GO:0016020
GO:0016757
GO:0045226
AF-A0A1M7BDA0-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.8926 5 400 GO:0016757
AF-A0A5C6FVR0-F1-model_v4 Putative glycosyl transferase 0.8895 5 395 GO:0009103
GO:0016757
GO:0045226

Map