F333873

General Info

Members Datasets Scaffolds Average Seq Length
221 160 442 268

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_92123_c1|nmdc:mga06r32_92123_c1_396_1268
Length 281
Sequence VNHLLRELAPISDKGWALIDEEARDRLTPGLAVRKLTDFAGPKGWTYSSTNLGRTEGAGAGPVDEVSAIQRRVLPLIELRADFSISRAELRDGDRGALDVDFASLDAAAQRMAVAENVAVFHGFTRAGMVGICDACAHDTITLADEFDQYPRHVAKAVELLLEAGIAGPYGLALGSEGYTGVVETTEHGGYPVFEHLRHILNGPIVWAPGVRGAVVVSLRGGDFLYESGQDLAIGYDRHDGDTVQLYIEESFSFRVATPEAAVALDGTGTARPSRRPAGTQ

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
158 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
159 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
160 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0.45
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 14.48
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_92123_c1 3300050510 Bacteria 2963
2 rootL2_10122345 3300003322 Bacteria 7111
3 Ga0070658_10031285 3300005327 Bacteria 4273
4 Ga0068868_100037579 3300005338 Bacteria 3754
5 Ga0070660_100509052 3300005339 Bacteria 1002
6 Ga0070689_100204308 3300005340 Bacteria 1614
7 Ga0070661_100460476 3300005344 Bacteria 1013
8 Ga0070692_10065652 3300005345 Bacteria 1922
9 Ga0070671_100198605 3300005355 Bacteria 1701
10 Ga0070673_100253900 3300005364 Bacteria 1534
11 Ga0070659_100252624 3300005366 Bacteria 1461
12 Ga0070703_10085721 3300005406 Bacteria 1082
13 Ga0070710_10206834 3300005437 Bacteria 1242
14 Ga0070701_10123189 3300005438 Bacteria 1464
15 Ga0070663_100120814 3300005455 Bacteria 1979
16 Ga0070678_100016645 3300005456 Bacteria 4709
17 Ga0070681_10021715 3300005458 Bacteria 6437
18 Ga0068867_100059677 3300005459 Bacteria 2828
19 Ga0070684_100495828 3300005535 Bacteria 1131
20 Ga0070672_100188408 3300005543 Bacteria 1721
21 Ga0070693_100188117 3300005547 Bacteria 1334
22 Ga0070665_100346854 3300005548 Bacteria 1490
23 Ga0070704_100032000 3300005549 Bacteria 3543
24 Ga0068854_100170860 3300005578 Bacteria 1691
25 Ga0070702_100059791 3300005615 Bacteria 2213
26 Ga0070702_100125635 3300005615 Bacteria 1612
27 Ga0068859_100075647 3300005617 Bacteria 3407
28 Ga0068864_100111499 3300005618 Bacteria 2437
29 Ga0068858_100083841 3300005842 Bacteria 2964
30 Ga0081455_10006089 3300005937 Bacteria 13046
31 Ga0081455_10026189 3300005937 Bacteria 5371
32 Ga0081540_1001305 3300005983 Bacteria 21757
33 Ga0075365_10000319 3300006038 Bacteria 16990
34 Ga0075365_10009698 3300006038 Bacteria 5557
35 Ga0075365_10066219 3300006038 Bacteria 2423
36 Ga0075365_10164062 3300006038 Bacteria 1549
37 Ga0075364_10032686 3300006051 Bacteria 3346
38 Ga0075364_10129026 3300006051 Bacteria 1696
39 Ga0075364_10148900 3300006051 Bacteria 1577
40 Ga0070712_100014072 3300006175 Bacteria 5130
41 Ga0075367_10274524 3300006178 Bacteria 1059
42 Ga0075433_10173607 3300006852 Bacteria 1918
43 Ga0075433_10224905 3300006852 Bacteria 1667
44 Ga0075434_100051312 3300006871 Bacteria 4099
45 Ga0075434_100501998 3300006871 Bacteria 1234
46 Ga0068865_100034228 3300006881 Bacteria 3407
47 Ga0097620_100075648 3300006931 Bacteria 3407
48 Ga0075435_100093575 3300007076 Bacteria 2483
49 Ga0111539_10044131 3300009094 Bacteria 5342
50 Ga0105245_10019226 3300009098 Bacteria 5981
51 Ga0105245_10028102 3300009098 Bacteria 4958
52 Ga0105245_10624378 3300009098 Bacteria 1106
53 Ga0105247_10038444 3300009101 Bacteria 2922
54 Ga0114129_10178047 3300009147 Bacteria 2895
55 Ga0105243_10017869 3300009148 Bacteria 5365
56 Ga0105243_10069580 3300009148 Bacteria 2840
57 Ga0105243_10090726 3300009148 Bacteria 2515
58 Ga0105241_10196585 3300009174 Bacteria 1682
59 Ga0105237_10291572 3300009545 Bacteria 1634
60 Ga0105246_10483330 3300011119 Bacteria 1048
61 Ga0157369_10199602 3300013105 Bacteria 2100
62 Ga0157372_10356094 3300013307 Bacteria 1705
63 Ga0157372_10363340 3300013307 Bacteria 1687
64 Ga0157375_10246609 3300013308 Bacteria 1946
65 Ga0163163_10180498 3300014325 Bacteria 2158
66 Ga0157379_10403348 3300014968 Bacteria 1257
67 Ga0224712_10137753 3300022467 Bacteria 1072
68 Ga0207426_1051009 3300025302 Bacteria 1231
69 Ga0207647_10123024 3300025904 Bacteria 1529
70 Ga0207705_10084044 3300025909 Bacteria 2323
71 Ga0207707_10181487 3300025912 Bacteria 1838
72 Ga0207671_10455754 3300025914 Bacteria 1019
73 Ga0207693_10004813 3300025915 Bacteria 11356
74 Ga0207693_10118797 3300025915 Bacteria 2076
75 Ga0207662_10044899 3300025918 Bacteria 2611
76 Ga0207694_10080530 3300025924 Bacteria 2556
77 Ga0207687_10012429 3300025927 Bacteria 5563
78 Ga0207687_10117640 3300025927 Bacteria 1983
79 Ga0207687_10352307 3300025927 Bacteria 1200
80 Ga0207700_10452689 3300025928 Bacteria 1132
81 Ga0207644_10052832 3300025931 Bacteria 2922
82 Ga0207690_10088734 3300025932 Bacteria 2179
83 Ga0207690_10241676 3300025932 Bacteria 1391
84 Ga0207709_10018364 3300025935 Bacteria 3916
85 Ga0207709_10084284 3300025935 Bacteria 2057
86 Ga0207709_10127165 3300025935 Bacteria 1730
87 Ga0207670_10121808 3300025936 Bacteria 1897
88 Ga0207704_10154013 3300025938 Bacteria 1626
89 Ga0207665_10377347 3300025939 Bacteria 1075
90 Ga0207651_10361027 3300025960 Bacteria 1226
91 Ga0207712_10085435 3300025961 Bacteria 2309
92 Ga0207703_10130834 3300026035 Bacteria 2167
93 Ga0207678_10083813 3300026067 Bacteria 2727
94 Ga0207708_10008583 3300026075 Bacteria 7561
95 Ga0207708_10270142 3300026075 Bacteria 1375
96 Ga0207708_10285001 3300026075 Bacteria 1340
97 Ga0207702_10146180 3300026078 Bacteria 2145
98 Ga0207702_10270109 3300026078 Bacteria 1604
99 Ga0207648_10051837 3300026089 Bacteria 3587
100 Ga0207676_10162205 3300026095 Bacteria 1938
101 Ga0207676_10421555 3300026095 Bacteria 1252
102 Ga0207674_10063466 3300026116 Bacteria 3729
103 Ga0207675_100122228 3300026118 Bacteria 2464
104 Ga0207683_10029313 3300026121 Bacteria 4764
105 Ga0207428_10076041 3300027907 Bacteria 2630
106 Ga0268266_10159806 3300028379 Unclassified 2038
107 Ga0268266_10160452 3300028379 Bacteria 2034
108 Ga0268264_10218919 3300028381 Bacteria 1752
109 Ga0268264_10480713 3300028381 Bacteria 1208
110 Ga0265338_10052850 3300028800 Bacteria 3641
111 Ga0265313_10055900 3300031595 Bacteria 1868
112 Ga0307410_10085675 3300031852 Bacteria 2224
113 Ga0307406_10203987 3300031901 Bacteria 1458
114 Ga0307407_10221813 3300031903 Bacteria 1279
115 Ga0307409_100219109 3300031995 Bacteria 1717
116 Ga0307409_100242463 3300031995 Bacteria 1642
117 Ga0307416_100182656 3300032002 Bacteria 1968
118 Ga0307415_100024691 3300032126 Bacteria 3759
119 Ga0373925_0301041 3300037068 Bacteria 1295
120 Ga0395900_0065710 3300037418 Bacteria 3726
121 Ga0395898_0012790 3300037466 Bacteria 8664
122 Ga0395898_0220492 3300037466 Bacteria 1809
123 Ga0395905_0006615 3300037471 Bacteria 11625
124 Ga0395901_0015898 3300038443 Bacteria 7668
125 Ga0395901_0358163 3300038443 Bacteria 1505
126 Ga0395901_0471163 3300038443 Bacteria 1282
127 Ga0451791_0718944 3300041451 Bacteria 1740
128 Ga0451793_0201589 3300041452 Bacteria 1381
129 Ga0451807_1014604 3300041486 Bacteria 1134
130 Ga0466966_0057284 3300044684 Bacteria 2464
131 Ga0466963_0032661 3300044694 Bacteria 3373
132 Ga0466960_0015247 3300044901 Bacteria 3309
133 Ga0466960_0066055 3300044901 Bacteria 1788
134 Ga0466958_0097459 3300045836 Bacteria 1825
135 Ga0466967_0032037 3300045976 Bacteria 4434
136 Ga0466967_0035110 3300045976 Bacteria 4264
137 Ga0466967_0162385 3300045976 Bacteria 2098
138 Ga0466967_0333099 3300045976 Bacteria 1466
139 Ga0466967_0450232 3300045976 Bacteria 1258
140 Ga0466967_0710710 3300045976 Bacteria 996
141 Ga0495641_0027595 3300046461 Bacteria 2759
142 Ga0495641_0047840 3300046461 Bacteria 1962
143 Ga0495594_0259361 3300046499 Bacteria 990
144 Ga0495624_0255872 3300046690 Bacteria 1059
145 Ga0495581_0037716 3300047315 Bacteria 2798
146 Ga0495674_0244400 3300047319 Bacteria 1478
147 Ga0495676_0000612 3300047321 Bacteria 29546
148 Ga0495676_0118351 3300047321 Bacteria 1932
149 Ga0495680_0210490 3300047322 Unclassified 1392
150 Ga0495614_0088088 3300048089 Bacteria 1349
151 Ga0495614_0109323 3300048089 Bacteria 1213
152 Ga0496100_0085377 3300048903 Bacteria 2142
153 Ga0496100_0251300 3300048903 Bacteria 1308
154 Ga0496101_0120583 3300048904 Bacteria 1982
155 Ga0496102_0065248 3300048905 Bacteria 3336
156 Ga0496102_0117194 3300048905 Bacteria 2485
157 Ga0496102_0305104 3300048905 Bacteria 1500
158 Ga0496103_0017287 3300048906 Bacteria 4315
159 Ga0496103_0048240 3300048906 Bacteria 2631
160 Ga0496104_0033485 3300048907 Bacteria 4787
161 Ga0496104_0140881 3300048907 Bacteria 2316
162 Ga0496105_0100061 3300048908 Bacteria 2394
163 Ga0496105_0204552 3300048908 Bacteria 1611
164 Ga0496106_0000200 3300048909 Bacteria 42008
165 Ga0496106_0160379 3300048909 Bacteria 1778
166 Ga0496107_0020900 3300048910 Bacteria 4627
167 Ga0496107_0218527 3300048910 Bacteria 1417
168 Ga0496108_0087665 3300048911 Bacteria 2643
169 Ga0496108_0407170 3300048911 Bacteria 1188
170 Ga0496109_0022454 3300048912 Bacteria 5589
171 Ga0496109_0119852 3300048912 Bacteria 2450
172 Ga0496109_0398323 3300048912 Bacteria 1300
173 Ga0496110_0051687 3300048913 Bacteria 3611
174 Ga0496110_0135229 3300048913 Bacteria 2227
175 Ga0496110_0150604 3300048913 Bacteria 2106
176 Ga0496111_0146541 3300048914 Bacteria 1750
177 Ga0496111_0180392 3300048914 Bacteria 1569
178 Ga0496112_0001091 3300048915 Bacteria 20075
179 Ga0496113_0030716 3300048916 Bacteria 3891
180 Ga0496115_0018143 3300048918 Bacteria 5395
181 Ga0496117_0002583 3300048920 Bacteria 22534
182 Ga0496121_0011473 3300048924 Bacteria 9832
183 Ga0501031_0003658 3300049568 Bacteria 9898
184 Ga0501032_0005553 3300049569 Bacteria 9354
185 Ga0501033_0036787 3300049570 Bacteria 3666
186 Ga0501034_0005262 3300049571 Bacteria 14201
187 Ga0501034_0008139 3300049571 Bacteria 11117
188 Ga0501034_0336298 3300049571 Bacteria 1441
189 Ga0501036_0004325 3300049572 Bacteria 11470
190 Ga0501036_0314441 3300049572 Bacteria 1309
191 Ga0501037_0000534 3300049573 Bacteria 30335
192 Ga0501038_0008406 3300049574 Bacteria 9493
193 Ga0501039_0003939 3300049575 Bacteria 11158
194 Ga0501043_0007661 3300049579 Bacteria 8556
195 Ga0501046_0007536 3300049580 Bacteria 9547
196 Ga0501047_0011895 3300049581 Bacteria 8234
197 Ga0501048_0003561 3300049582 Bacteria 11850
198 Ga0501070_0011842 3300049586 Bacteria 7364
199 Ga0501076_0648458 3300049592 Bacteria 871
200 Ga0501079_0099311 3300049741 Bacteria 2256
201 Ga0501035_0012643 3300049822 Bacteria 7799
202 Ga0501044_0015510 3300049823 Bacteria 8206
203 Ga0501044_0562620 3300049823 Unclassified 1036
204 Ga0501045_0006886 3300049824 Bacteria 7879
205 Ga0501045_0178742 3300049824 Bacteria 1581
206 nmdc:mga00v17_29339_c1 3300050491 Bacteria 3228
207 nmdc:mga00v17_81897_c1 3300050491 Bacteria 2016
208 nmdc:mga0yw44_111826_c1 3300050492 Bacteria 1751
209 nmdc:mga0yw44_165636_c1 3300050492 Bacteria 1449
210 nmdc:mga0yw44_36938_c1 3300050492 Bacteria 2882
211 nmdc:mga06z11_347598_c1 3300050494 Bacteria 887
212 nmdc:mga0n895_71530_c1 3300050512 Bacteria 3440
213 nmdc:mga0rr50_79282_c1 3300050513 Bacteria 2529
214 nmdc:mga08x19_17679_c1 3300050514 Bacteria 4366
215 Ga0495612_0000130 3300053078 Bacteria 31802
216 Ga0500588_0028983 3300053146 Bacteria 1575
217 Ga0501082_0072377 3300060353 Bacteria 2969
218 2537899497 2537561592 Bacteria 4348607
219 2844844304 2844841374 Bacteria 3917147
220 2946026600 2946024296 Bacteria 3508095
221 8016256275 8016254467 Bacteria 3797036
222 nmdc:mga06r32_92123_c1
223 rootL2_10122345
224 Ga0070658_10031285
225 Ga0068868_100037579
226 Ga0070660_100509052
227 Ga0070689_100204308
228 Ga0070661_100460476
229 Ga0070692_10065652
230 Ga0070671_100198605
231 Ga0070673_100253900
232 Ga0070659_100252624
233 Ga0070703_10085721
234 Ga0070710_10206834
235 Ga0070701_10123189
236 Ga0070663_100120814
237 Ga0070678_100016645
238 Ga0070681_10021715
239 Ga0068867_100059677
240 Ga0070684_100495828
241 Ga0070672_100188408
242 Ga0070693_100188117
243 Ga0070665_100346854
244 Ga0070704_100032000
245 Ga0068854_100170860
246 Ga0070702_100059791
247 Ga0070702_100125635
248 Ga0068859_100075647
249 Ga0068864_100111499
250 Ga0068858_100083841
251 Ga0081455_10006089
252 Ga0081455_10026189
253 Ga0081540_1001305
254 Ga0075365_10000319
255 Ga0075365_10009698
256 Ga0075365_10066219
257 Ga0075365_10164062
258 Ga0075364_10032686
259 Ga0075364_10129026
260 Ga0075364_10148900
261 Ga0070712_100014072
262 Ga0075367_10274524
263 Ga0075433_10173607
264 Ga0075433_10224905
265 Ga0075434_100051312
266 Ga0075434_100501998
267 Ga0068865_100034228
268 Ga0097620_100075648
269 Ga0075435_100093575
270 Ga0111539_10044131
271 Ga0105245_10019226
272 Ga0105245_10028102
273 Ga0105245_10624378
274 Ga0105247_10038444
275 Ga0114129_10178047
276 Ga0105243_10017869
277 Ga0105243_10069580
278 Ga0105243_10090726
279 Ga0105241_10196585
280 Ga0105237_10291572
281 Ga0105246_10483330
282 Ga0157369_10199602
283 Ga0157372_10356094
284 Ga0157372_10363340
285 Ga0157375_10246609
286 Ga0163163_10180498
287 Ga0157379_10403348
288 Ga0224712_10137753
289 Ga0207426_1051009
290 Ga0207647_10123024
291 Ga0207705_10084044
292 Ga0207707_10181487
293 Ga0207671_10455754
294 Ga0207693_10004813
295 Ga0207693_10118797
296 Ga0207662_10044899
297 Ga0207694_10080530
298 Ga0207687_10012429
299 Ga0207687_10117640
300 Ga0207687_10352307
301 Ga0207700_10452689
302 Ga0207644_10052832
303 Ga0207690_10088734
304 Ga0207690_10241676
305 Ga0207709_10018364
306 Ga0207709_10084284
307 Ga0207709_10127165
308 Ga0207670_10121808
309 Ga0207704_10154013
310 Ga0207665_10377347
311 Ga0207651_10361027
312 Ga0207712_10085435
313 Ga0207703_10130834
314 Ga0207678_10083813
315 Ga0207708_10008583
316 Ga0207708_10270142
317 Ga0207708_10285001
318 Ga0207702_10146180
319 Ga0207702_10270109
320 Ga0207648_10051837
321 Ga0207676_10162205
322 Ga0207676_10421555
323 Ga0207674_10063466
324 Ga0207675_100122228
325 Ga0207683_10029313
326 Ga0207428_10076041
327 Ga0268266_10159806
328 Ga0268266_10160452
329 Ga0268264_10218919
330 Ga0268264_10480713
331 Ga0265338_10052850
332 Ga0265313_10055900
333 Ga0307410_10085675
334 Ga0307406_10203987
335 Ga0307407_10221813
336 Ga0307409_100219109
337 Ga0307409_100242463
338 Ga0307416_100182656
339 Ga0307415_100024691
340 Ga0373925_0301041
341 Ga0395900_0065710
342 Ga0395898_0012790
343 Ga0395898_0220492
344 Ga0395905_0006615
345 Ga0395901_0015898
346 Ga0395901_0358163
347 Ga0395901_0471163
348 Ga0451791_0718944
349 Ga0451793_0201589
350 Ga0451807_1014604
351 Ga0466966_0057284
352 Ga0466963_0032661
353 Ga0466960_0015247
354 Ga0466960_0066055
355 Ga0466958_0097459
356 Ga0466967_0032037
357 Ga0466967_0035110
358 Ga0466967_0162385
359 Ga0466967_0333099
360 Ga0466967_0450232
361 Ga0466967_0710710
362 Ga0495641_0027595
363 Ga0495641_0047840
364 Ga0495594_0259361
365 Ga0495624_0255872
366 Ga0495581_0037716
367 Ga0495674_0244400
368 Ga0495676_0000612
369 Ga0495676_0118351
370 Ga0495680_0210490
371 Ga0495614_0088088
372 Ga0495614_0109323
373 Ga0496100_0085377
374 Ga0496100_0251300
375 Ga0496101_0120583
376 Ga0496102_0065248
377 Ga0496102_0117194
378 Ga0496102_0305104
379 Ga0496103_0017287
380 Ga0496103_0048240
381 Ga0496104_0033485
382 Ga0496104_0140881
383 Ga0496105_0100061
384 Ga0496105_0204552
385 Ga0496106_0000200
386 Ga0496106_0160379
387 Ga0496107_0020900
388 Ga0496107_0218527
389 Ga0496108_0087665
390 Ga0496108_0407170
391 Ga0496109_0022454
392 Ga0496109_0119852
393 Ga0496109_0398323
394 Ga0496110_0051687
395 Ga0496110_0135229
396 Ga0496110_0150604
397 Ga0496111_0146541
398 Ga0496111_0180392
399 Ga0496112_0001091
400 Ga0496113_0030716
401 Ga0496115_0018143
402 Ga0496117_0002583
403 Ga0496121_0011473
404 Ga0501031_0003658
405 Ga0501032_0005553
406 Ga0501033_0036787
407 Ga0501034_0005262
408 Ga0501034_0008139
409 Ga0501034_0336298
410 Ga0501036_0004325
411 Ga0501036_0314441
412 Ga0501037_0000534
413 Ga0501038_0008406
414 Ga0501039_0003939
415 Ga0501043_0007661
416 Ga0501046_0007536
417 Ga0501047_0011895
418 Ga0501048_0003561
419 Ga0501070_0011842
420 Ga0501076_0648458
421 Ga0501079_0099311
422 Ga0501035_0012643
423 Ga0501044_0015510
424 Ga0501044_0562620
425 Ga0501045_0006886
426 Ga0501045_0178742
427 nmdc:mga00v17_29339_c1
428 nmdc:mga00v17_81897_c1
429 nmdc:mga0yw44_111826_c1
430 nmdc:mga0yw44_165636_c1
431 nmdc:mga0yw44_36938_c1
432 nmdc:mga06z11_347598_c1
433 nmdc:mga0n895_71530_c1
434 nmdc:mga0rr50_79282_c1
435 nmdc:mga08x19_17679_c1
436 Ga0495612_0000130
437 Ga0500588_0028983
438 Ga0501082_0072377
439 2537899497
440 2844844304
441 2946026600
442 8016256275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04454

Linocin_M18

Encapsulating protein for peroxidase

1

253

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8378 1 260
7bcv-assembly1.cif.gz_A brevibacterium linens encapsulin structure 0.8352 1 260
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8348 1 260
7bcv-assembly1.cif.gz_A brevibacterium linens encapsulin structure 0.8322 1 260
6i9g-assembly1.cif.gz_A crystal structure of encapsulin from mycolicibacterium hassiacum 0.8288 1 260
ID Description Score Start End Superfamily
3dktA02 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;hypothetical protein PF0899 domain 0.8089 134 214 3.30.2320.10
2e0zC01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7766 220 249 3.30.2400.20
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7309 1 250 3.30.2400.30
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.727 1 250 3.30.2400.30
3dktA02 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;hypothetical protein PF0899 domain 0.6954 134 214 3.30.2320.10
ID Description Score Start End GO Terms
AF-A0A2K4P227-F1-model_v4 deleted 0.8841 99 259
AF-A0A6P4G5J1-F1-model_v4 deleted 0.8769 123 260
AF-A0A6P4G5J1-F1-model_v4 deleted 0.871 123 260
AF-A0A7X6QHY7-F1-model_v4 deleted 0.8669 112 260
AF-A0A3C1CD34-F1-model_v4 Bacteriocin 0.8648 85 260 GO:0140737

Map