F333737

General Info

Members Datasets Scaffolds Average Seq Length
221 143 221 95

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0377804|Ga0495647_0377804_306_620
Length 104
Sequence MSEKVSTMDVRARIGDLLNRVALRHDEFVIERKGKALAALVPVERIEQMRRFARQHGRAFLAEQKRGSGDRLSDPQAMDIALEAQRTARQHIRNSDGPKRPRNK

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 0
Rhizoplane 0
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100000721 3300005354 Bacteria 23013
2 Ga0070675_100991378 3300005354 Unclassified 771
3 Ga0070674_101277625 3300005356 Unclassified 654
4 Ga0070673_100949454 3300005364 Unclassified 799
5 Ga0070713_100040362 3300005436 Unclassified 3794
6 Ga0070694_101458878 3300005444 Unclassified 578
7 Ga0070708_100001157 3300005445 Bacteria 20298
8 Ga0070708_100004123 3300005445 Bacteria 11408
9 Ga0070708_100025833 3300005445 Bacteria 5022
10 Ga0070708_100688365 3300005445 Bacteria 963
11 Ga0070708_100750328 3300005445 Unclassified 918
12 Ga0070708_102194793 3300005445 Unclassified 510
13 Ga0068867_102388146 3300005459 Unclassified 503
14 Ga0070706_100030730 3300005467 Bacteria 4950
15 Ga0070706_100063664 3300005467 Bacteria 3408
16 Ga0070706_100158877 3300005467 Unclassified 2110
17 Ga0070706_100203016 3300005467 Bacteria 1851
18 Ga0070706_100326164 3300005467 Bacteria 1432
19 Ga0070707_100089870 3300005468 Bacteria 2972
20 Ga0070698_100042128 3300005471 Bacteria 4684
21 Ga0070698_100063728 3300005471 Bacteria 3717
22 Ga0070698_100100743 3300005471 Unclassified 2861
23 Ga0070698_100164579 3300005471 Unclassified 2161
24 Ga0070698_100406634 3300005471 Unclassified 1295
25 Ga0070698_100614874 3300005471 Unclassified 1027
26 Ga0070698_101026175 3300005471 Bacteria 772
27 Ga0070699_100972772 3300005518 Bacteria 778
28 Ga0070699_101355036 3300005518 Bacteria 652
29 Ga0070697_100006118 3300005536 Bacteria 9311
30 Ga0070697_100020023 3300005536 Bacteria 5288
31 Ga0070697_100697192 3300005536 Bacteria 896
32 Ga0070697_100773217 3300005536 Unclassified 849
33 Ga0070672_101323718 3300005543 Unclassified 643
34 Ga0070665_100690378 3300005548 Bacteria 1034
35 Ga0068855_101468883 3300005563 Unclassified 701
36 Ga0068859_100650073 3300005617 Unclassified 1146
37 Ga0068863_100594149 3300005841 Bacteria 1095
38 Ga0068858_100108738 3300005842 Unclassified 2588
39 Ga0068858_100354716 3300005842 Bacteria 1405
40 Ga0068860_100150748 3300005843 Unclassified 2239
41 Ga0068860_100288564 3300005843 Bacteria 1605
42 Ga0081455_10013018 3300005937 Bacteria 8246
43 Ga0081539_10263223 3300005985 Bacteria 759
44 Ga0070717_10194605 3300006028 Unclassified 1773
45 Ga0070717_10712213 3300006028 Bacteria 912
46 Ga0075364_10036367 3300006051 Unclassified 3183
47 Ga0075367_10121192 3300006178 Bacteria 1611
48 Ga0075367_10128133 3300006178 Bacteria 1567
49 Ga0075366_10055988 3300006195 Bacteria 2342
50 Ga0075431_101472043 3300006847 Unclassified 640
51 Ga0075434_101790597 3300006871 Bacteria 621
52 Ga0075429_100512756 3300006880 Bacteria 1051
53 Ga0075436_100247042 3300006914 Bacteria 1270
54 Ga0075436_100317992 3300006914 Unclassified 1118
55 Ga0097620_100650073 3300006931 Unclassified 1146
56 Ga0075435_100596196 3300007076 Bacteria 958
57 Ga0111539_13547829 3300009094 Unclassified 500
58 Ga0105247_10074017 3300009101 Bacteria 2135
59 Ga0105247_10375221 3300009101 Bacteria 1007
60 Ga0114129_10024360 3300009147 Bacteria 8576
61 Ga0114129_10117748 3300009147 Bacteria 3659
62 Ga0114129_10121731 3300009147 Bacteria 3590
63 Ga0114129_10246961 3300009147 Bacteria 2397
64 Ga0114129_10425720 3300009147 Unclassified 1745
65 Ga0114129_10448875 3300009147 Bacteria 1691
66 Ga0114129_12348152 3300009147 Unclassified 639
67 Ga0105243_10968276 3300009148 Unclassified 851
68 Ga0105243_11908847 3300009148 Unclassified 627
69 Ga0105241_10119887 3300009174 Bacteria 2117
70 Ga0105242_12577647 3300009176 Unclassified 557
71 Ga0105248_10081888 3300009177 Unclassified 3629
72 Ga0105248_12474454 3300009177 Bacteria 592
73 Ga0105237_10294125 3300009545 Bacteria 1627
74 Ga0105237_10872462 3300009545 Bacteria 907
75 Ga0105249_10734854 3300009553 Unclassified 1049
76 Ga0105239_13654901 3300010375 Bacteria 500
77 Ga0163162_10005065 3300013306 Bacteria 12695
78 Ga0163163_10045100 3300014325 Bacteria 4327
79 Ga0157380_10521611 3300014326 Bacteria 1159
80 Ga0157380_11127097 3300014326 Unclassified 825
81 Ga0157377_10361947 3300014745 Unclassified 977
82 Ga0157379_10050412 3300014968 Unclassified 3716
83 Ga0157379_12016751 3300014968 Unclassified 570
84 Ga0157376_10290904 3300014969 Bacteria 1542
85 Ga0213871_10056950 3300021441 Bacteria 1082
86 Ga0207710_10036654 3300025900 Bacteria 2163
87 Ga0207710_10214319 3300025900 Bacteria 954
88 Ga0207684_10107538 3300025910 Bacteria 2386
89 Ga0207684_10133841 3300025910 Unclassified 2128
90 Ga0207684_10321682 3300025910 Bacteria 1333
91 Ga0207684_10432662 3300025910 Bacteria 1130
92 Ga0207684_10766114 3300025910 Unclassified 817
93 Ga0207671_10041933 3300025914 Bacteria 3387
94 Ga0207671_10887154 3300025914 Bacteria 705
95 Ga0207646_10068743 3300025922 Bacteria 3164
96 Ga0207646_10527277 3300025922 Bacteria 1063
97 Ga0207659_10000641 3300025926 Bacteria 20755
98 Ga0207659_10944634 3300025926 Bacteria 742
99 Ga0207709_10183587 3300025935 Bacteria 1479
100 Ga0207665_11442023 3300025939 Unclassified 548
101 Ga0207691_10583677 3300025940 Bacteria 946
102 Ga0207711_10065834 3300025941 Unclassified 3133
103 Ga0207667_12094285 3300025949 Unclassified 524
104 Ga0207651_11153087 3300025960 Unclassified 695
105 Ga0207712_10497513 3300025961 Unclassified 1041
106 Ga0207703_10078673 3300026035 Unclassified 2740
107 Ga0207678_10640459 3300026067 Bacteria 933
108 Ga0207648_10438258 3300026089 Bacteria 1188
109 Ga0207674_10852196 3300026116 Unclassified 879
110 Ga0268264_10004041 3300028381 Bacteria 12559
111 Ga0265316_10132807 3300031344 Bacteria 1874
112 Ga0265316_11239239 3300031344 Unclassified 516
113 Ga0307409_101799051 3300031995 Unclassified 642
114 Ga0307416_100174964 3300032002 Bacteria 2004
115 Ga0307411_11967170 3300032005 Unclassified 545
116 Ga0307415_100846115 3300032126 Unclassified 839
117 Ga0373948_0030367 3300034817 Bacteria 1086
118 Ga0373944_0143949 3300035089 Bacteria 836
119 Ga0373936_0279398 3300035113 Bacteria 750
120 Ga0373945_0442984 3300035116 Bacteria 573
121 Ga0373956_0188773 3300035119 Bacteria 975
122 Ga0373943_0162478 3300035170 Unclassified 1217
123 Ga0373943_0260994 3300035170 Bacteria 975
124 Ga0373946_0093344 3300035171 Unclassified 1337
125 Ga0373955_0331796 3300035172 Bacteria 920
126 Ga0373935_0227726 3300035692 Bacteria 1297
127 Ga0373935_0690365 3300035692 Unclassified 750
128 Ga0373927_0616480 3300035695 Bacteria 717
129 Ga0373933_0082622 3300035724 Bacteria 1972
130 Ga0373947_0489229 3300035725 Unclassified 835
131 Ga0373937_0026859 3300036401 Bacteria 5204
132 Ga0373937_0631888 3300036401 Bacteria 1016
133 Ga0373937_1175252 3300036401 Unclassified 716
134 Ga0373925_0011914 3300037068 Bacteria 6293
135 Ga0373925_0211367 3300037068 Bacteria 1545
136 Ga0373925_0430481 3300037068 Bacteria 1079
137 Ga0373925_1130429 3300037068 Unclassified 644
138 Ga0436360_1187677 3300039438 Bacteria 987
139 Ga0436363_0011295 3300039450 Unclassified 706
140 Ga0450896_072900 3300042133 Bacteria 571
141 Ga0453683_0612375 3300044673 Unclassified 711
142 Ga0495592_0212377 3300046454 Unclassified 1299
143 Ga0495638_0090958 3300046460 Bacteria 1839
144 Ga0495653_0399718 3300046463 Unclassified 874
145 Ga0495580_0221529 3300046472 Unclassified 1300
146 Ga0495580_0891543 3300046472 Unclassified 572
147 Ga0495582_0357540 3300046473 Unclassified 841
148 Ga0495662_0065254 3300046476 Unclassified 1760
149 Ga0495594_0344313 3300046499 Bacteria 849
150 Ga0495608_0810042 3300046511 Unclassified 552
151 Ga0495640_0689622 3300046533 Unclassified 613
152 Ga0495621_0401744 3300046539 Unclassified 581
153 Ga0495667_0060622 3300046559 Bacteria 2481
154 Ga0495634_0428085 3300046642 Bacteria 783
155 Ga0495635_0335619 3300046663 Bacteria 1010
156 Ga0495599_0314166 3300046678 Unclassified 944
157 Ga0495647_0023900 3300046681 Unclassified 2220
158 Ga0495647_0044211 3300046681 Bacteria 1708
159 Ga0495647_0146317 3300046681 Bacteria 1010
160 Ga0495647_0377804 3300046681 Unclassified 648
161 Ga0495658_0346867 3300046683 Unclassified 943
162 Ga0495613_0266395 3300046689 Unclassified 1192
163 Ga0495613_0423338 3300046689 Unclassified 906
164 Ga0495600_0372275 3300046809 Bacteria 892
165 Ga0495674_0081387 3300047319 Bacteria 2778
166 Ga0495674_0268672 3300047319 Bacteria 1400
167 Ga0495680_0365521 3300047322 Bacteria 1002
168 Ga0495684_0204059 3300047471 Bacteria 1456
169 Ga0501032_0922446 3300049569 Bacteria 550
170 Ga0501036_1407177 3300049572 Unclassified 565
171 Ga0501039_0393950 3300049575 Bacteria 1088
172 Ga0501040_0052612 3300049576 Bacteria 2788
173 Ga0501040_1216297 3300049576 Unclassified 547
174 Ga0501041_0093525 3300049577 Bacteria 1857
175 Ga0501041_0508644 3300049577 Unclassified 766
176 Ga0501042_0047785 3300049578 Bacteria 3051
177 Ga0501046_0054166 3300049580 Bacteria 3157
178 Ga0501048_0125735 3300049582 Bacteria 1813
179 Ga0501070_0442165 3300049586 Bacteria 1049
180 Ga0501071_0820116 3300049587 Unclassified 717
181 Ga0501072_0053207 3300049588 Unclassified 3188
182 Ga0501072_1027916 3300049588 Unclassified 642
183 Ga0501074_0419506 3300049590 Bacteria 949
184 Ga0501075_0101669 3300049591 Bacteria 2183
185 Ga0501075_1250455 3300049591 Unclassified 563
186 Ga0501075_1293544 3300049591 Bacteria 553
187 Ga0501076_0466172 3300049592 Unclassified 1040
188 Ga0501076_1494279 3300049592 Unclassified 555
189 Ga0501077_0100449 3300049593 Bacteria 1833
190 Ga0501077_0991695 3300049593 Bacteria 540
191 Ga0501079_0219665 3300049741 Bacteria 1485
192 Ga0501080_0505218 3300049742 Bacteria 1080
193 Ga0501081_0223901 3300049743 Bacteria 1368
194 Ga0501045_0042487 3300049824 Unclassified 3308
195 nmdc:mga06z11_191064_c1 3300050494 Bacteria 1185
196 nmdc:mga06z11_974239_c1 3300050494 Unclassified 517
197 nmdc:mga05p37_231600_c1 3300050507 Bacteria 2225
198 nmdc:mga05p37_319612_c1 3300050507 Bacteria 1838
199 nmdc:mga05p37_369658_c1 3300050507 Unclassified 1683
200 nmdc:mga05p37_524570_c1 3300050507 Unclassified 1354
201 nmdc:mga05p37_84320_c1 3300050507 Unclassified 3915
202 nmdc:mga09592_492727_c1 3300050508 Unclassified 1055
203 nmdc:mga0qj67_1220277_c1 3300050509 Unclassified 585
204 nmdc:mga06r32_1403705_c1 3300050510 Unclassified 640
205 nmdc:mga08y16_424943_c1 3300050511 Bacteria 1358
206 nmdc:mga0n895_282391_c1 3300050512 Bacteria 1683
207 nmdc:mga0n895_65314_c1 3300050512 Bacteria 3602
208 nmdc:mga0rr50_25489_c1 3300050513 Bacteria 4112
209 nmdc:mga0rr50_307145_c1 3300050513 Bacteria 1328
210 nmdc:mga0rr50_702421_c1 3300050513 Unclassified 863
211 nmdc:mga0rr50_852726_c1 3300050513 Unclassified 777
212 nmdc:mga08x19_179165_c1 3300050514 Bacteria 1446
213 nmdc:mga08x19_88934_c1 3300050514 Unclassified 2036
214 nmdc:mga0a205_180113_c1 3300050515 Bacteria 2008
215 Ga0495601_0239777 3300053077 Unclassified 1184
216 Ga0500568_0007881 3300053139 Bacteria 5187
217 Ga0500589_162375 3300053147 Unclassified 897
218 Ga0500616_0000202 3300053153 Bacteria 97657
219 Ga0530510_0195667 3300061734 Bacteria 1501
220 Ga0530510_0228118 3300061734 Bacteria 1385
221 Ga0530510_0610175 3300061734 Unclassified 830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10734854 Ga0105249_107348542 82
2 3300025961 Ga0207712_10497513 Ga0207712_104975131 82
3 3300005445 Ga0070708_100004123 Ga0070708_10000412310 83
4 3300025922 Ga0207646_10068743 Ga0207646_100687433 83
5 3300005937 Ga0081455_10013018 Ga0081455_100130184 84
6 3300021441 Ga0213871_10056950 Ga0213871_100569502 86
7 3300039438 Ga0436360_1187677 Ga0436360_1187677_22_315 86
8 3300009147 Ga0114129_10024360 Ga0114129_100243609 87
9 3300046454 Ga0495592_0212377 Ga0495592_0212377_84_377 87
10 3300046460 Ga0495638_0090958 Ga0495638_0090958_1357_1665 87
11 3300046689 Ga0495613_0266395 Ga0495613_0266395_220_513 87
12 3300050507 nmdc:mga05p37_231600_c1 nmdc:mga05p37_231600_c1_1108_1371 87
13 3300005354 Ga0070675_100991378 Ga0070675_1009913782 89
14 3300005445 Ga0070708_102194793 Ga0070708_1021947931 89
15 3300005467 Ga0070706_100203016 Ga0070706_1002030163 89
16 3300005471 Ga0070698_101026175 Ga0070698_1010261752 89
17 3300005543 Ga0070672_101323718 Ga0070672_1013237181 89
18 3300006178 Ga0075367_10128133 Ga0075367_101281332 89
19 3300006195 Ga0075366_10055988 Ga0075366_100559883 89
20 3300025940 Ga0207691_10583677 Ga0207691_105836772 89
21 3300035119 Ga0373956_0188773 Ga0373956_0188773_84_380 89
22 3300046681 Ga0495647_0146317 Ga0495647_0146317_356_625 89
23 3300050494 nmdc:mga06z11_191064_c1 nmdc:mga06z11_191064_c1_297_569 89
24 3300005445 Ga0070708_100025833 Ga0070708_1000258335 90
25 3300005445 Ga0070708_100688365 Ga0070708_1006883651 90
26 3300005467 Ga0070706_100030730 Ga0070706_1000307306 90
27 3300005467 Ga0070706_100063664 Ga0070706_1000636642 90
28 3300005467 Ga0070706_100158877 Ga0070706_1001588773 90
29 3300005468 Ga0070707_100089870 Ga0070707_1000898704 90
30 3300005471 Ga0070698_100100743 Ga0070698_1001007433 90
31 3300005518 Ga0070699_100972772 Ga0070699_1009727722 90
32 3300005536 Ga0070697_100773217 Ga0070697_1007732172 90
33 3300005617 Ga0068859_100650073 Ga0068859_1006500732 90
34 3300005842 Ga0068858_100354716 Ga0068858_1003547162 90
35 3300006871 Ga0075434_101790597 Ga0075434_1017905971 90
36 3300006931 Ga0097620_100650073 Ga0097620_1006500732 90
37 3300009147 Ga0114129_10121731 Ga0114129_101217311 90
38 3300025910 Ga0207684_10107538 Ga0207684_101075384 90
39 3300025910 Ga0207684_10133841 Ga0207684_101338411 90
40 3300025910 Ga0207684_10432662 Ga0207684_104326623 90
41 3300046681 Ga0495647_0044211 Ga0495647_0044211_980_1255 90
42 3300049575 Ga0501039_0393950 Ga0501039_0393950_310_582 90
43 3300049576 Ga0501040_1216297 Ga0501040_1216297_202_474 90
44 3300049587 Ga0501071_0820116 Ga0501071_0820116_193_465 90
45 3300049591 Ga0501075_1250455 Ga0501075_1250455_44_316 90
46 3300050511 nmdc:mga08y16_424943_c1 nmdc:mga08y16_424943_c1_1065_1337 90
47 3300050513 nmdc:mga0rr50_702421_c1 nmdc:mga0rr50_702421_c1_72_344 90
48 3300061734 Ga0530510_0228118 Ga0530510_0228118_120_392 90
49 3300006914 Ga0075436_100317992 Ga0075436_1003179923 91
50 3300035113 Ga0373936_0279398 Ga0373936_0279398_28_303 91
51 3300035116 Ga0373945_0442984 Ga0373945_0442984_148_423 91
52 3300035172 Ga0373955_0331796 Ga0373955_0331796_165_440 91
53 3300035692 Ga0373935_0227726 Ga0373935_0227726_67_342 91
54 3300035695 Ga0373927_0616480 Ga0373927_0616480_39_314 91
55 3300037068 Ga0373925_0211367 Ga0373925_0211367_1155_1430 91
56 3300046472 Ga0495580_0221529 Ga0495580_0221529_475_750 91
57 3300046476 Ga0495662_0065254 Ga0495662_0065254_642_917 91
58 3300046499 Ga0495594_0344313 Ga0495594_0344313_164_439 91
59 3300046681 Ga0495647_0023900 Ga0495647_0023900_1456_1731 91
60 3300009147 Ga0114129_10425720 Ga0114129_104257203 92
61 3300009177 Ga0105248_10081888 Ga0105248_100818882 92
62 3300013306 Ga0163162_10005065 Ga0163162_100050657 92
63 3300050507 nmdc:mga05p37_369658_c1 nmdc:mga05p37_369658_c1_708_1001 92
64 3300044673 Ga0453683_0612375 Ga0453683_0612375_249_542 93
65 3300005436 Ga0070713_100040362 Ga0070713_1000403624 94
66 3300006028 Ga0070717_10194605 Ga0070717_101946054 94
67 3300006028 Ga0070717_10712213 Ga0070717_107122131 94
68 3300006051 Ga0075364_10036367 Ga0075364_100363677 94
69 3300035089 Ga0373944_0143949 Ga0373944_0143949_434_718 94
70 3300035170 Ga0373943_0162478 Ga0373943_0162478_124_408 94
71 3300035170 Ga0373943_0260994 Ga0373943_0260994_69_353 94
72 3300035171 Ga0373946_0093344 Ga0373946_0093344_281_565 94
73 3300035692 Ga0373935_0690365 Ga0373935_0690365_309_593 94
74 3300035725 Ga0373947_0489229 Ga0373947_0489229_493_777 94
75 3300037068 Ga0373925_0011914 Ga0373925_0011914_5724_6008 94
76 3300037068 Ga0373925_0430481 Ga0373925_0430481_540_824 94
77 3300046678 Ga0495599_0314166 Ga0495599_0314166_483_767 94
78 3300061734 Ga0530510_0195667 Ga0530510_0195667_1041_1355 94
79 3300005471 Ga0070698_100063728 Ga0070698_1000637282 95
80 3300005518 Ga0070699_101355036 Ga0070699_1013550362 95
81 3300005536 Ga0070697_100697192 Ga0070697_1006971922 95
82 3300006914 Ga0075436_100247042 Ga0075436_1002470423 95
83 3300036401 Ga0373937_0631888 Ga0373937_0631888_660_959 95
84 3300046463 Ga0495653_0399718 Ga0495653_0399718_345_644 95
85 3300046473 Ga0495582_0357540 Ga0495582_0357540_276_575 95
86 3300046533 Ga0495640_0689622 Ga0495640_0689622_125_424 95
87 3300046663 Ga0495635_0335619 Ga0495635_0335619_117_416 95
88 3300046683 Ga0495658_0346867 Ga0495658_0346867_233_532 95
89 3300046689 Ga0495613_0423338 Ga0495613_0423338_49_348 95
90 3300046809 Ga0495600_0372275 Ga0495600_0372275_528_827 95
91 3300047319 Ga0495674_0268672 Ga0495674_0268672_783_1082 95
92 3300047322 Ga0495680_0365521 Ga0495680_0365521_544_843 95
93 3300047471 Ga0495684_0204059 Ga0495684_0204059_803_1102 95
94 3300050514 nmdc:mga08x19_179165_c1 nmdc:mga08x19_179165_c1_1037_1324 95
95 3300005354 Ga0070675_100000721 Ga0070675_10000072119 96
96 3300005356 Ga0070674_101277625 Ga0070674_1012776252 96
97 3300005364 Ga0070673_100949454 Ga0070673_1009494542 96
98 3300005444 Ga0070694_101458878 Ga0070694_1014588781 96
99 3300005445 Ga0070708_100001157 Ga0070708_10000115716 96
100 3300005445 Ga0070708_100750328 Ga0070708_1007503281 96
101 3300005459 Ga0068867_102388146 Ga0068867_1023881461 96
102 3300005467 Ga0070706_100326164 Ga0070706_1003261642 96
103 3300005471 Ga0070698_100042128 Ga0070698_1000421283 96
104 3300005471 Ga0070698_100164579 Ga0070698_1001645795 96
105 3300005471 Ga0070698_100406634 Ga0070698_1004066342 96
106 3300005471 Ga0070698_100614874 Ga0070698_1006148742 96
107 3300005536 Ga0070697_100006118 Ga0070697_1000061184 96
108 3300005536 Ga0070697_100020023 Ga0070697_1000200232 96
109 3300005548 Ga0070665_100690378 Ga0070665_1006903782 96
110 3300005563 Ga0068855_101468883 Ga0068855_1014688832 96
111 3300005841 Ga0068863_100594149 Ga0068863_1005941492 96
112 3300005842 Ga0068858_100108738 Ga0068858_1001087382 96
113 3300005843 Ga0068860_100150748 Ga0068860_1001507482 96
114 3300005843 Ga0068860_100288564 Ga0068860_1002885643 96
115 3300005985 Ga0081539_10263223 Ga0081539_102632232 96
116 3300006178 Ga0075367_10121192 Ga0075367_101211923 96
117 3300006847 Ga0075431_101472043 Ga0075431_1014720432 96
118 3300006880 Ga0075429_100512756 Ga0075429_1005127562 96
119 3300007076 Ga0075435_100596196 Ga0075435_1005961962 96
120 3300009094 Ga0111539_13547829 Ga0111539_135478292 96
121 3300009101 Ga0105247_10074017 Ga0105247_100740172 96
122 3300009101 Ga0105247_10375221 Ga0105247_103752213 96
123 3300009147 Ga0114129_10117748 Ga0114129_101177483 96
124 3300009147 Ga0114129_10246961 Ga0114129_102469613 96
125 3300009147 Ga0114129_10448875 Ga0114129_104488754 96
126 3300009147 Ga0114129_12348152 Ga0114129_123481522 96
127 3300009148 Ga0105243_10968276 Ga0105243_109682762 96
128 3300009148 Ga0105243_11908847 Ga0105243_119088471 96
129 3300009174 Ga0105241_10119887 Ga0105241_101198873 96
130 3300009176 Ga0105242_12577647 Ga0105242_125776472 96
131 3300009177 Ga0105248_12474454 Ga0105248_124744542 96
132 3300009545 Ga0105237_10294125 Ga0105237_102941252 96
133 3300009545 Ga0105237_10872462 Ga0105237_108724622 96
134 3300010375 Ga0105239_13654901 Ga0105239_136549011 96
135 3300014325 Ga0163163_10045100 Ga0163163_100451006 96
136 3300014326 Ga0157380_10521611 Ga0157380_105216112 96
137 3300014326 Ga0157380_11127097 Ga0157380_111270972 96
138 3300014745 Ga0157377_10361947 Ga0157377_103619472 96
139 3300014968 Ga0157379_10050412 Ga0157379_100504123 96
140 3300014968 Ga0157379_12016751 Ga0157379_120167511 96
141 3300014969 Ga0157376_10290904 Ga0157376_102909042 96
142 3300025900 Ga0207710_10036654 Ga0207710_100366542 96
143 3300025900 Ga0207710_10214319 Ga0207710_102143193 96
144 3300025910 Ga0207684_10321682 Ga0207684_103216821 96
145 3300025910 Ga0207684_10766114 Ga0207684_107661142 96
146 3300025914 Ga0207671_10041933 Ga0207671_100419333 96
147 3300025914 Ga0207671_10887154 Ga0207671_108871542 96
148 3300025922 Ga0207646_10527277 Ga0207646_105272772 96
149 3300025926 Ga0207659_10000641 Ga0207659_1000064123 96
150 3300025926 Ga0207659_10944634 Ga0207659_109446341 96
151 3300025935 Ga0207709_10183587 Ga0207709_101835872 96
152 3300025939 Ga0207665_11442023 Ga0207665_114420232 96
153 3300025941 Ga0207711_10065834 Ga0207711_100658344 96
154 3300025949 Ga0207667_12094285 Ga0207667_120942851 96
155 3300025960 Ga0207651_11153087 Ga0207651_111530872 96
156 3300026035 Ga0207703_10078673 Ga0207703_100786732 96
157 3300026067 Ga0207678_10640459 Ga0207678_106404592 96
158 3300026089 Ga0207648_10438258 Ga0207648_104382582 96
159 3300026116 Ga0207674_10852196 Ga0207674_108521962 96
160 3300028381 Ga0268264_10004041 Ga0268264_100040412 96
161 3300031344 Ga0265316_10132807 Ga0265316_101328072 96
162 3300031344 Ga0265316_11239239 Ga0265316_112392391 96
163 3300031995 Ga0307409_101799051 Ga0307409_1017990512 96
164 3300032002 Ga0307416_100174964 Ga0307416_1001749643 96
165 3300032005 Ga0307411_11967170 Ga0307411_119671701 96
166 3300032126 Ga0307415_100846115 Ga0307415_1008461152 96
167 3300034817 Ga0373948_0030367 Ga0373948_0030367_715_1005 96
168 3300035724 Ga0373933_0082622 Ga0373933_0082622_1071_1373 96
169 3300036401 Ga0373937_0026859 Ga0373937_0026859_4697_4999 96
170 3300036401 Ga0373937_1175252 Ga0373937_1175252_81_371 96
171 3300037068 Ga0373925_1130429 Ga0373925_1130429_77_367 96
172 3300039450 Ga0436363_0011295 Ga0436363_0011295_237_530 96
173 3300042133 Ga0450896_072900 Ga0450896_072900_60_353 96
174 3300046472 Ga0495580_0891543 Ga0495580_0891543_209_499 96
175 3300046511 Ga0495608_0810042 Ga0495608_0810042_22_324 96
176 3300046539 Ga0495621_0401744 Ga0495621_0401744_29_322 96
177 3300046559 Ga0495667_0060622 Ga0495667_0060622_696_986 96
178 3300046642 Ga0495634_0428085 Ga0495634_0428085_156_446 96
179 3300046681 Ga0495647_0377804 Ga0495647_0377804_306_620 96
180 3300047319 Ga0495674_0081387 Ga0495674_0081387_814_1116 96
181 3300049569 Ga0501032_0922446 Ga0501032_0922446_203_499 96
182 3300049572 Ga0501036_1407177 Ga0501036_1407177_29_331 96
183 3300049576 Ga0501040_0052612 Ga0501040_0052612_1691_1987 96
184 3300049577 Ga0501041_0093525 Ga0501041_0093525_837_1133 96
185 3300049577 Ga0501041_0508644 Ga0501041_0508644_438_740 96
186 3300049578 Ga0501042_0047785 Ga0501042_0047785_851_1147 96
187 3300049580 Ga0501046_0054166 Ga0501046_0054166_653_949 96
188 3300049582 Ga0501048_0125735 Ga0501048_0125735_1206_1502 96
189 3300049586 Ga0501070_0442165 Ga0501070_0442165_164_460 96
190 3300049588 Ga0501072_0053207 Ga0501072_0053207_497_793 96
191 3300049588 Ga0501072_1027916 Ga0501072_1027916_219_515 96
192 3300049590 Ga0501074_0419506 Ga0501074_0419506_383_679 96
193 3300049591 Ga0501075_0101669 Ga0501075_0101669_373_669 96
194 3300049591 Ga0501075_1293544 Ga0501075_1293544_143_442 96
195 3300049592 Ga0501076_0466172 Ga0501076_0466172_77_373 96
196 3300049592 Ga0501076_1494279 Ga0501076_1494279_232_540 96
197 3300049593 Ga0501077_0100449 Ga0501077_0100449_41_337 96
198 3300049593 Ga0501077_0991695 Ga0501077_0991695_158_460 96
199 3300049741 Ga0501079_0219665 Ga0501079_0219665_730_1026 96
200 3300049742 Ga0501080_0505218 Ga0501080_0505218_610_906 96
201 3300049743 Ga0501081_0223901 Ga0501081_0223901_422_718 96
202 3300049824 Ga0501045_0042487 Ga0501045_0042487_726_1022 96
203 3300050494 nmdc:mga06z11_974239_c1 nmdc:mga06z11_974239_c1_180_479 96
204 3300050507 nmdc:mga05p37_319612_c1 nmdc:mga05p37_319612_c1_196_498 96
205 3300050507 nmdc:mga05p37_524570_c1 nmdc:mga05p37_524570_c1_475_771 96
206 3300050507 nmdc:mga05p37_84320_c1 nmdc:mga05p37_84320_c1_3040_3333 96
207 3300050508 nmdc:mga09592_492727_c1 nmdc:mga09592_492727_c1_524_820 96
208 3300050509 nmdc:mga0qj67_1220277_c1 nmdc:mga0qj67_1220277_c1_261_557 96
209 3300050510 nmdc:mga06r32_1403705_c1 nmdc:mga06r32_1403705_c1_257_553 96
210 3300050512 nmdc:mga0n895_282391_c1 nmdc:mga0n895_282391_c1_1071_1367 96
211 3300050512 nmdc:mga0n895_65314_c1 nmdc:mga0n895_65314_c1_3123_3416 96
212 3300050513 nmdc:mga0rr50_25489_c1 nmdc:mga0rr50_25489_c1_468_761 96
213 3300050513 nmdc:mga0rr50_307145_c1 nmdc:mga0rr50_307145_c1_480_776 96
214 3300050513 nmdc:mga0rr50_852726_c1 nmdc:mga0rr50_852726_c1_320_613 96
215 3300050514 nmdc:mga08x19_88934_c1 nmdc:mga08x19_88934_c1_47_349 96
216 3300050515 nmdc:mga0a205_180113_c1 nmdc:mga0a205_180113_c1_1022_1315 96
217 3300053077 Ga0495601_0239777 Ga0495601_0239777_664_966 96
218 3300053139 Ga0500568_0007881 Ga0500568_0007881_2102_2416 96
219 3300053147 Ga0500589_162375 Ga0500589_162375_229_543 96
220 3300053153 Ga0500616_0000202 Ga0500616_0000202_83625_83924 96
221 3300061734 Ga0530510_0610175 Ga0530510_0610175_370_678 96

Feature Viewer

pLDDT pTM Quality
74.02 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map