F333374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 221 | 136 | 218 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10127395|Ga0157370_101273953 |
| Length | 129 |
| Sequence | VDYITLKYKVLFIVLHMKISRKKFVIIFVLSAFVFQFITNSLLGPKVGGLPVNGDWFSGAGSPIVWKRTVAAIIYPIRIVLVGPLSPIFNDPDPVPPLLGFFCALYWTFLALALHFIISKINLGKKRDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 3 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 4 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 119 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 132 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 133 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 134 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 135 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 136 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 0 |
| Isolates | 1.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.24 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 90.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1664813 | 2162886007 | Bacteria | 51394 |
| 2 | JGI24737J22298_10000630 | 3300001990 | Bacteria | 12426 |
| 3 | JGI24735J21928_10067313 | 3300002067 | Bacteria | 1027 |
| 4 | JGI25152J39213_1000135 | 3300002773 | Bacteria | 50172 |
| 5 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 6 | JGI25151J46595_10000005 | 3300003187 | Bacteria | 431598 |
| 7 | JGI25406J46586_10011635 | 3300003203 | Bacteria | 3853 |
| 8 | JGI25153J46596_10000018 | 3300003215 | Bacteria | 269774 |
| 9 | rootH1_10146827 | 3300003316 | Bacteria | 1273 |
| 10 | Ga0065714_10002338 | 3300005288 | Bacteria | 23916 |
| 11 | Ga0065714_10007953 | 3300005288 | Bacteria | 12974 |
| 12 | Ga0065704_10000208 | 3300005289 | Bacteria | 101850 |
| 13 | Ga0065704_10208868 | 3300005289 | Bacteria | 1116 |
| 14 | Ga0070658_10003547 | 3300005327 | Bacteria | 12808 |
| 15 | Ga0070658_10407594 | 3300005327 | Unclassified | 1168 |
| 16 | Ga0070690_100825476 | 3300005330 | Bacteria | 721 |
| 17 | Ga0070670_100289757 | 3300005331 | Bacteria | 1430 |
| 18 | Ga0070670_100627960 | 3300005331 | Bacteria | 963 |
| 19 | Ga0068869_100127266 | 3300005334 | Bacteria | 1955 |
| 20 | Ga0068869_101331787 | 3300005334 | Bacteria | 634 |
| 21 | Ga0070680_101401617 | 3300005336 | Bacteria | 605 |
| 22 | Ga0068868_100044567 | 3300005338 | Bacteria | 3468 |
| 23 | Ga0070661_100355250 | 3300005344 | Bacteria | 1151 |
| 24 | Ga0070661_100628460 | 3300005344 | Bacteria | 870 |
| 25 | Ga0070668_102161520 | 3300005347 | Bacteria | 514 |
| 26 | Ga0070674_100127597 | 3300005356 | Bacteria | 1892 |
| 27 | Ga0070673_100205117 | 3300005364 | Bacteria | 1699 |
| 28 | Ga0070688_101562635 | 3300005365 | Bacteria | 538 |
| 29 | Ga0070659_100062040 | 3300005366 | Bacteria | 2954 |
| 30 | Ga0070659_101460073 | 3300005366 | Bacteria | 609 |
| 31 | Ga0070667_100012121 | 3300005367 | Bacteria | 7137 |
| 32 | Ga0070667_100311451 | 3300005367 | Bacteria | 1419 |
| 33 | Ga0070667_101319753 | 3300005367 | Bacteria | 676 |
| 34 | Ga0070678_102376697 | 3300005456 | Bacteria | 503 |
| 35 | Ga0070681_11268697 | 3300005458 | Bacteria | 659 |
| 36 | Ga0068867_101280921 | 3300005459 | Bacteria | 676 |
| 37 | Ga0070685_10094004 | 3300005466 | Bacteria | 1820 |
| 38 | Ga0070679_101209374 | 3300005530 | Unclassified | 701 |
| 39 | Ga0068853_101296212 | 3300005539 | Bacteria | 704 |
| 40 | Ga0068855_100000240 | 3300005563 | Bacteria | 69408 |
| 41 | Ga0068855_100041628 | 3300005563 | Bacteria | 5444 |
| 42 | Ga0068855_100178329 | 3300005563 | Bacteria | 2403 |
| 43 | Ga0068855_100203130 | 3300005563 | Bacteria | 2230 |
| 44 | Ga0068855_100295724 | 3300005563 | Bacteria | 1794 |
| 45 | Ga0068857_100019908 | 3300005577 | Bacteria | 5899 |
| 46 | Ga0068857_100405343 | 3300005577 | Bacteria | 1269 |
| 47 | Ga0068854_100992628 | 3300005578 | Unclassified | 743 |
| 48 | Ga0068856_100010333 | 3300005614 | Bacteria | 9068 |
| 49 | Ga0068856_100763730 | 3300005614 | Bacteria | 987 |
| 50 | Ga0068852_100127579 | 3300005616 | Bacteria | 2338 |
| 51 | Ga0068864_100435371 | 3300005618 | Bacteria | 1252 |
| 52 | Ga0068866_10036727 | 3300005718 | Bacteria | 2401 |
| 53 | Ga0068866_10229927 | 3300005718 | Bacteria | 1124 |
| 54 | Ga0068861_102154268 | 3300005719 | Bacteria | 558 |
| 55 | Ga0068851_10114503 | 3300005834 | Bacteria | 1443 |
| 56 | Ga0068863_100038019 | 3300005841 | Bacteria | 4580 |
| 57 | Ga0068860_100087778 | 3300005843 | Bacteria | 2961 |
| 58 | Ga0068860_100938719 | 3300005843 | Bacteria | 882 |
| 59 | Ga0068860_101418586 | 3300005843 | Bacteria | 716 |
| 60 | Ga0081539_10017335 | 3300005985 | Bacteria | 5064 |
| 61 | Ga0070717_11332776 | 3300006028 | Bacteria | 652 |
| 62 | Ga0070716_101534417 | 3300006173 | Bacteria | 545 |
| 63 | Ga0075366_10388853 | 3300006195 | Bacteria | 858 |
| 64 | Ga0097621_100055015 | 3300006237 | Bacteria | 3249 |
| 65 | Ga0068871_100185203 | 3300006358 | Bacteria | 1791 |
| 66 | Ga0068871_101014734 | 3300006358 | Bacteria | 773 |
| 67 | Ga0068871_102147542 | 3300006358 | Bacteria | 532 |
| 68 | Ga0068865_100198469 | 3300006881 | Bacteria | 1556 |
| 69 | Ga0097620_101754236 | 3300006931 | Bacteria | 686 |
| 70 | Ga0105240_10006046 | 3300009093 | Bacteria | 17877 |
| 71 | Ga0105240_10352326 | 3300009093 | Bacteria | 1670 |
| 72 | Ga0105240_10611574 | 3300009093 | Bacteria | 1199 |
| 73 | Ga0105240_11445140 | 3300009093 | Bacteria | 722 |
| 74 | Ga0111539_11279601 | 3300009094 | Bacteria | 851 |
| 75 | Ga0105245_11282684 | 3300009098 | Bacteria | 781 |
| 76 | Ga0105241_10271760 | 3300009174 | Bacteria | 1444 |
| 77 | Ga0105241_10658830 | 3300009174 | Unclassified | 952 |
| 78 | Ga0105241_10682658 | 3300009174 | Bacteria | 936 |
| 79 | Ga0105242_10527991 | 3300009176 | Bacteria | 1127 |
| 80 | Ga0105242_11344955 | 3300009176 | Bacteria | 740 |
| 81 | Ga0105237_10000362 | 3300009545 | Bacteria | 64230 |
| 82 | Ga0105237_10013895 | 3300009545 | Bacteria | 8424 |
| 83 | Ga0105237_10094787 | 3300009545 | Bacteria | 2974 |
| 84 | Ga0105237_10352399 | 3300009545 | Bacteria | 1476 |
| 85 | Ga0105237_10537213 | 3300009545 | Unclassified | 1176 |
| 86 | Ga0105237_11677382 | 3300009545 | Bacteria | 643 |
| 87 | Ga0105249_10005708 | 3300009553 | Bacteria | 10763 |
| 88 | Ga0105249_10031280 | 3300009553 | Bacteria | 4812 |
| 89 | Ga0105239_10002040 | 3300010375 | Bacteria | 26200 |
| 90 | Ga0105239_10103523 | 3300010375 | Bacteria | 3151 |
| 91 | Ga0105239_10152595 | 3300010375 | Unclassified | 2578 |
| 92 | Ga0105239_10155569 | 3300010375 | Bacteria | 2553 |
| 93 | Ga0105246_10882874 | 3300011119 | Bacteria | 800 |
| 94 | Ga0157373_10000064 | 3300013100 | Bacteria | 94176 |
| 95 | Ga0157373_10008962 | 3300013100 | Bacteria | 7402 |
| 96 | Ga0157373_10032678 | 3300013100 | Bacteria | 3745 |
| 97 | Ga0157373_10678663 | 3300013100 | Bacteria | 754 |
| 98 | Ga0157371_10013437 | 3300013102 | Bacteria | 6216 |
| 99 | Ga0157371_10024015 | 3300013102 | Bacteria | 4454 |
| 100 | Ga0157371_10030960 | 3300013102 | Bacteria | 3856 |
| 101 | Ga0157370_10127395 | 3300013104 | Bacteria | 2376 |
| 102 | Ga0157370_10479007 | 3300013104 | Bacteria | 1144 |
| 103 | Ga0157370_11264537 | 3300013104 | Unclassified | 665 |
| 104 | Ga0157369_10191049 | 3300013105 | Bacteria | 2152 |
| 105 | Ga0157369_10961902 | 3300013105 | Bacteria | 875 |
| 106 | Ga0157369_10973791 | 3300013105 | Bacteria | 869 |
| 107 | Ga0157374_10004780 | 3300013296 | Bacteria | 11364 |
| 108 | Ga0157374_10046036 | 3300013296 | Bacteria | 4038 |
| 109 | Ga0157374_10092999 | 3300013296 | Bacteria | 2878 |
| 110 | Ga0157374_11230579 | 3300013296 | Bacteria | 770 |
| 111 | Ga0157374_12829186 | 3300013296 | Bacteria | 513 |
| 112 | Ga0157378_10041672 | 3300013297 | Unclassified | 4073 |
| 113 | Ga0157378_10462052 | 3300013297 | Bacteria | 1262 |
| 114 | Ga0157378_10928339 | 3300013297 | Bacteria | 902 |
| 115 | Ga0157378_11410506 | 3300013297 | Bacteria | 740 |
| 116 | Ga0163162_10006451 | 3300013306 | Bacteria | 11366 |
| 117 | Ga0163162_11084666 | 3300013306 | Bacteria | 907 |
| 118 | Ga0157372_10001038 | 3300013307 | Bacteria | 30369 |
| 119 | Ga0157372_10010105 | 3300013307 | Bacteria | 10026 |
| 120 | Ga0157372_10145045 | 3300013307 | Bacteria | 2738 |
| 121 | Ga0157372_10717477 | 3300013307 | Bacteria | 1163 |
| 122 | Ga0157372_11198037 | 3300013307 | Bacteria | 878 |
| 123 | Ga0157372_13291310 | 3300013307 | Bacteria | 515 |
| 124 | Ga0157372_13315220 | 3300013307 | Unclassified | 513 |
| 125 | Ga0157375_10064737 | 3300013308 | Bacteria | 3641 |
| 126 | Ga0157375_10106993 | 3300013308 | Bacteria | 2889 |
| 127 | Ga0157375_10129375 | 3300013308 | Bacteria | 2643 |
| 128 | Ga0157375_12143850 | 3300013308 | Bacteria | 665 |
| 129 | Ga0163163_10284525 | 3300014325 | Bacteria | 1705 |
| 130 | Ga0163163_12935656 | 3300014325 | Bacteria | 532 |
| 131 | Ga0157377_10109920 | 3300014745 | Bacteria | 1655 |
| 132 | Ga0157377_10368043 | 3300014745 | Bacteria | 970 |
| 133 | Ga0157379_11193889 | 3300014968 | Unclassified | 732 |
| 134 | Ga0157379_11312818 | 3300014968 | Bacteria | 699 |
| 135 | Ga0157376_10044935 | 3300014969 | Bacteria | 3634 |
| 136 | Ga0157376_11311876 | 3300014969 | Bacteria | 754 |
| 137 | Ga0182006_1011517 | 3300015261 | Bacteria | 3890 |
| 138 | Ga0163161_10008784 | 3300017792 | Bacteria | 6983 |
| 139 | Ga0163161_10022832 | 3300017792 | Bacteria | 4408 |
| 140 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 141 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 142 | Ga0209233_1003098 | 3300025261 | Bacteria | 5918 |
| 143 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 144 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 145 | Ga0207656_10118717 | 3300025321 | Bacteria | 1229 |
| 146 | Ga0207642_10151484 | 3300025899 | Bacteria | 1235 |
| 147 | Ga0207647_10000473 | 3300025904 | Bacteria | 32482 |
| 148 | Ga0207705_10000457 | 3300025909 | Bacteria | 35062 |
| 149 | Ga0207654_10059445 | 3300025911 | Bacteria | 2229 |
| 150 | Ga0207654_10259891 | 3300025911 | Bacteria | 1167 |
| 151 | Ga0207707_10653697 | 3300025912 | Bacteria | 886 |
| 152 | Ga0207695_10004281 | 3300025913 | Bacteria | 19579 |
| 153 | Ga0207695_10878470 | 3300025913 | Bacteria | 776 |
| 154 | Ga0207671_10005998 | 3300025914 | Bacteria | 10989 |
| 155 | Ga0207671_10009912 | 3300025914 | Bacteria | 7918 |
| 156 | Ga0207671_10021051 | 3300025914 | Bacteria | 4954 |
| 157 | Ga0207671_10053596 | 3300025914 | Bacteria | 2989 |
| 158 | Ga0207671_10111299 | 3300025914 | Bacteria | 2083 |
| 159 | Ga0207671_10357235 | 3300025914 | Unclassified | 1159 |
| 160 | Ga0207660_11096312 | 3300025917 | Bacteria | 649 |
| 161 | Ga0207649_10709416 | 3300025920 | Bacteria | 781 |
| 162 | Ga0207650_10493420 | 3300025925 | Bacteria | 1023 |
| 163 | Ga0207650_10566468 | 3300025925 | Bacteria | 953 |
| 164 | Ga0207644_11869275 | 3300025931 | Unclassified | 502 |
| 165 | Ga0207690_10006367 | 3300025932 | Bacteria | 6997 |
| 166 | Ga0207669_10107274 | 3300025937 | Bacteria | 1862 |
| 167 | Ga0207704_10332371 | 3300025938 | Bacteria | 1176 |
| 168 | Ga0207689_10148036 | 3300025942 | Unclassified | 1935 |
| 169 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 170 | Ga0207667_10165857 | 3300025949 | Bacteria | 2271 |
| 171 | Ga0207667_11087194 | 3300025949 | Bacteria | 783 |
| 172 | Ga0207667_11296059 | 3300025949 | Bacteria | 705 |
| 173 | Ga0207651_11567650 | 3300025960 | Bacteria | 593 |
| 174 | Ga0207712_10042445 | 3300025961 | Bacteria | 3132 |
| 175 | Ga0207712_10058641 | 3300025961 | Bacteria | 2721 |
| 176 | Ga0207668_10651582 | 3300025972 | Bacteria | 922 |
| 177 | Ga0207640_10332752 | 3300025981 | Unclassified | 1214 |
| 178 | Ga0207658_10086786 | 3300025986 | Bacteria | 2414 |
| 179 | Ga0207658_12040488 | 3300025986 | Bacteria | 522 |
| 180 | Ga0207677_10157972 | 3300026023 | Bacteria | 1758 |
| 181 | Ga0207703_11150641 | 3300026035 | Bacteria | 746 |
| 182 | Ga0207639_11538078 | 3300026041 | Bacteria | 624 |
| 183 | Ga0207702_10044064 | 3300026078 | Bacteria | 3749 |
| 184 | Ga0207702_10088609 | 3300026078 | Bacteria | 2704 |
| 185 | Ga0207648_10057703 | 3300026089 | Bacteria | 3387 |
| 186 | Ga0207676_10067673 | 3300026095 | Bacteria | 2854 |
| 187 | Ga0207674_10041840 | 3300026116 | Bacteria | 4736 |
| 188 | Ga0207674_10379647 | 3300026116 | Bacteria | 1366 |
| 189 | Ga0207674_11258095 | 3300026116 | Bacteria | 709 |
| 190 | Ga0207683_12059198 | 3300026121 | Bacteria | 519 |
| 191 | Ga0207698_10193092 | 3300026142 | Bacteria | 1816 |
| 192 | Ga0307509_10321125 | 3300031507 | Bacteria | 1285 |
| 193 | Ga0307516_10066990 | 3300031730 | Bacteria | 3461 |
| 194 | Ga0307412_10000009 | 3300031911 | Bacteria | 445987 |
| 195 | Ga0307414_10000243 | 3300032004 | Bacteria | 34739 |
| 196 | Ga0373941_0052425 | 3300035115 | Bacteria | 1301 |
| 197 | Ga0439448_0330106 | 3300042005 | Bacteria | 543 |
| 198 | Ga0495585_0195677 | 3300046492 | Bacteria | 1032 |
| 199 | Ga0495596_0042919 | 3300046500 | Bacteria | 1782 |
| 200 | Ga0495606_0152115 | 3300046507 | Bacteria | 1357 |
| 201 | Ga0495606_0422892 | 3300046507 | Bacteria | 689 |
| 202 | Ga0495616_0001122 | 3300046513 | Bacteria | 18977 |
| 203 | Ga0495630_0763725 | 3300046517 | Unclassified | 739 |
| 204 | Ga0495632_0304367 | 3300046519 | Bacteria | 706 |
| 205 | Ga0495609_0003446 | 3300046538 | Bacteria | 9057 |
| 206 | Ga0495625_0002832 | 3300046660 | Bacteria | 18231 |
| 207 | Ga0495625_0020485 | 3300046660 | Bacteria | 5104 |
| 208 | Ga0495672_0010604 | 3300047320 | Bacteria | 6549 |
| 209 | Ga0495686_0000524 | 3300047472 | Bacteria | 55256 |
| 210 | Ga0495686_0020134 | 3300047472 | Bacteria | 4452 |
| 211 | Ga0495678_008800 | 3300049459 | Bacteria | 5055 |
| 212 | nmdc:mga08y16_1284739_c1 | 3300050511 | Bacteria | 699 |
| 213 | Ga0500562_000018 | 3300053108 | Bacteria | 126890 |
| 214 | Ga0500642_0146199 | 3300053130 | Bacteria | 1109 |
| 215 | Ga0500652_170908 | 3300053131 | Bacteria | 894 |
| 216 | Ga0500658_0357703 | 3300053134 | Bacteria | 670 |
| 217 | Ga0500579_178469 | 3300053143 | Bacteria | 843 |
| 218 | Ga0500552_011375 | 3300053733 | Bacteria | 1117 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2929177148 | 2929180571 | 102 |
| 2 | iso_pu_bacteria | 2945977869 | 2945982972 | 102 |
| 3 | iso_pu_bacteria | 2946013367 | 2946017632 | 102 |
| 4 | 3300005330 | Ga0070690_100825476 | Ga0070690_1008254762 | 104 |
| 5 | 3300005530 | Ga0070679_101209374 | Ga0070679_1012093742 | 104 |
| 6 | 3300005618 | Ga0068864_100435371 | Ga0068864_1004353714 | 104 |
| 7 | 3300006195 | Ga0075366_10388853 | Ga0075366_103888532 | 104 |
| 8 | 3300013104 | Ga0157370_10479007 | Ga0157370_104790072 | 104 |
| 9 | 3300013105 | Ga0157369_10973791 | Ga0157369_109737912 | 104 |
| 10 | 3300013296 | Ga0157374_12829186 | Ga0157374_128291862 | 104 |
| 11 | 3300013307 | Ga0157372_13291310 | Ga0157372_132913101 | 104 |
| 12 | 3300025925 | Ga0207650_10566468 | Ga0207650_105664681 | 104 |
| 13 | 3300026116 | Ga0207674_11258095 | Ga0207674_112580952 | 104 |
| 14 | 3300031507 | Ga0307509_10321125 | Ga0307509_103211252 | 104 |
| 15 | 3300042005 | Ga0439448_0330106 | Ga0439448_0330106_135_452 | 104 |
| 16 | 3300003203 | JGI25406J46586_10011635 | JGI25406J46586_100116358 | 105 |
| 17 | 3300005289 | Ga0065704_10208868 | Ga0065704_102088681 | 105 |
| 18 | 3300005327 | Ga0070658_10003547 | Ga0070658_100035476 | 105 |
| 19 | 3300005331 | Ga0070670_100289757 | Ga0070670_1002897572 | 105 |
| 20 | 3300005344 | Ga0070661_100355250 | Ga0070661_1003552502 | 105 |
| 21 | 3300005344 | Ga0070661_100628460 | Ga0070661_1006284601 | 105 |
| 22 | 3300005347 | Ga0070668_102161520 | Ga0070668_1021615202 | 105 |
| 23 | 3300005365 | Ga0070688_101562635 | Ga0070688_1015626351 | 105 |
| 24 | 3300005366 | Ga0070659_101460073 | Ga0070659_1014600731 | 105 |
| 25 | 3300005367 | Ga0070667_100012121 | Ga0070667_1000121213 | 105 |
| 26 | 3300005367 | Ga0070667_101319753 | Ga0070667_1013197532 | 105 |
| 27 | 3300005459 | Ga0068867_101280921 | Ga0068867_1012809212 | 105 |
| 28 | 3300005563 | Ga0068855_100000240 | Ga0068855_10000024038 | 105 |
| 29 | 3300005563 | Ga0068855_100041628 | Ga0068855_1000416284 | 105 |
| 30 | 3300005563 | Ga0068855_100203130 | Ga0068855_1002031302 | 105 |
| 31 | 3300005616 | Ga0068852_100127579 | Ga0068852_1001275792 | 105 |
| 32 | 3300005719 | Ga0068861_102154268 | Ga0068861_1021542682 | 105 |
| 33 | 3300005843 | Ga0068860_100938719 | Ga0068860_1009387192 | 105 |
| 34 | 3300005843 | Ga0068860_101418586 | Ga0068860_1014185862 | 105 |
| 35 | 3300005985 | Ga0081539_10017335 | Ga0081539_100173351 | 105 |
| 36 | 3300006931 | Ga0097620_101754236 | Ga0097620_1017542361 | 105 |
| 37 | 3300009093 | Ga0105240_11445140 | Ga0105240_114451403 | 105 |
| 38 | 3300009174 | Ga0105241_10658830 | Ga0105241_106588302 | 105 |
| 39 | 3300009176 | Ga0105242_11344955 | Ga0105242_113449551 | 105 |
| 40 | 3300009545 | Ga0105237_10000362 | Ga0105237_100003623 | 105 |
| 41 | 3300009545 | Ga0105237_11677382 | Ga0105237_116773821 | 105 |
| 42 | 3300010375 | Ga0105239_10152595 | Ga0105239_101525952 | 105 |
| 43 | 3300010375 | Ga0105239_10155569 | Ga0105239_101555692 | 105 |
| 44 | 3300013100 | Ga0157373_10032678 | Ga0157373_100326786 | 105 |
| 45 | 3300013102 | Ga0157371_10024015 | Ga0157371_100240154 | 105 |
| 46 | 3300013102 | Ga0157371_10030960 | Ga0157371_100309606 | 105 |
| 47 | 3300013104 | Ga0157370_11264537 | Ga0157370_112645372 | 105 |
| 48 | 3300013105 | Ga0157369_10191049 | Ga0157369_101910491 | 105 |
| 49 | 3300013296 | Ga0157374_10004780 | Ga0157374_100047805 | 105 |
| 50 | 3300013296 | Ga0157374_10092999 | Ga0157374_100929993 | 105 |
| 51 | 3300013297 | Ga0157378_10928339 | Ga0157378_109283392 | 105 |
| 52 | 3300013297 | Ga0157378_11410506 | Ga0157378_114105061 | 105 |
| 53 | 3300013306 | Ga0163162_11084666 | Ga0163162_110846661 | 105 |
| 54 | 3300013307 | Ga0157372_10145045 | Ga0157372_101450451 | 105 |
| 55 | 3300013307 | Ga0157372_11198037 | Ga0157372_111980372 | 105 |
| 56 | 3300013307 | Ga0157372_13315220 | Ga0157372_133152201 | 105 |
| 57 | 3300013308 | Ga0157375_10064737 | Ga0157375_100647374 | 105 |
| 58 | 3300013308 | Ga0157375_10129375 | Ga0157375_101293753 | 105 |
| 59 | 3300014325 | Ga0163163_10284525 | Ga0163163_102845253 | 105 |
| 60 | 3300014745 | Ga0157377_10109920 | Ga0157377_101099202 | 105 |
| 61 | 3300014968 | Ga0157379_11312818 | Ga0157379_113128182 | 105 |
| 62 | 3300014969 | Ga0157376_11311876 | Ga0157376_113118761 | 105 |
| 63 | 3300025909 | Ga0207705_10000457 | Ga0207705_1000045711 | 105 |
| 64 | 3300025914 | Ga0207671_10021051 | Ga0207671_100210513 | 105 |
| 65 | 3300025925 | Ga0207650_10493420 | Ga0207650_104934202 | 105 |
| 66 | 3300025949 | Ga0207667_10000037 | Ga0207667_1000003796 | 105 |
| 67 | 3300025949 | Ga0207667_11087194 | Ga0207667_110871941 | 105 |
| 68 | 3300025972 | Ga0207668_10651582 | Ga0207668_106515822 | 105 |
| 69 | 3300025986 | Ga0207658_10086786 | Ga0207658_100867862 | 105 |
| 70 | 3300026035 | Ga0207703_11150641 | Ga0207703_111506412 | 105 |
| 71 | 3300026078 | Ga0207702_10044064 | Ga0207702_100440643 | 105 |
| 72 | 3300026095 | Ga0207676_10067673 | Ga0207676_100676735 | 105 |
| 73 | 3300026142 | Ga0207698_10193092 | Ga0207698_101930921 | 105 |
| 74 | 3300035115 | Ga0373941_0052425 | Ga0373941_0052425_59_376 | 105 |
| 75 | 3300046513 | Ga0495616_0001122 | Ga0495616_0001122_198_581 | 105 |
| 76 | 3300046660 | Ga0495625_0020485 | Ga0495625_0020485_2230_2613 | 105 |
| 77 | 3300047320 | Ga0495672_0010604 | Ga0495672_0010604_5055_5390 | 105 |
| 78 | 3300049459 | Ga0495678_008800 | Ga0495678_008800_566_949 | 105 |
| 79 | 3300053130 | Ga0500642_0146199 | Ga0500642_0146199_255_599 | 105 |
| 80 | 3300053131 | Ga0500652_170908 | Ga0500652_170908_335_718 | 105 |
| 81 | 3300053143 | Ga0500579_178469 | Ga0500579_178469_380_748 | 105 |
| 82 | 2162886007 | SwRhRL2b_contig_1664813 | SwRhRL2b_0282.00001560 | 106 |
| 83 | 3300001990 | JGI24737J22298_10000630 | JGI24737J22298_100006303 | 106 |
| 84 | 3300002067 | JGI24735J21928_10067313 | JGI24735J21928_100673131 | 106 |
| 85 | 3300002773 | JGI25152J39213_1000135 | JGI25152J39213_100013531 | 106 |
| 86 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_10000011093 | 106 |
| 87 | 3300003187 | JGI25151J46595_10000005 | JGI25151J46595_10000005108 | 106 |
| 88 | 3300003215 | JGI25153J46596_10000018 | JGI25153J46596_10000018126 | 106 |
| 89 | 3300003316 | rootH1_10146827 | rootH1_101468272 | 106 |
| 90 | 3300005288 | Ga0065714_10002338 | Ga0065714_100023383 | 106 |
| 91 | 3300005288 | Ga0065714_10007953 | Ga0065714_100079532 | 106 |
| 92 | 3300005289 | Ga0065704_10000208 | Ga0065704_1000020825 | 106 |
| 93 | 3300005327 | Ga0070658_10407594 | Ga0070658_104075941 | 106 |
| 94 | 3300005331 | Ga0070670_100627960 | Ga0070670_1006279601 | 106 |
| 95 | 3300005334 | Ga0068869_100127266 | Ga0068869_1001272662 | 106 |
| 96 | 3300005334 | Ga0068869_101331787 | Ga0068869_1013317871 | 106 |
| 97 | 3300005336 | Ga0070680_101401617 | Ga0070680_1014016172 | 106 |
| 98 | 3300005338 | Ga0068868_100044567 | Ga0068868_1000445673 | 106 |
| 99 | 3300005356 | Ga0070674_100127597 | Ga0070674_1001275974 | 106 |
| 100 | 3300005364 | Ga0070673_100205117 | Ga0070673_1002051171 | 106 |
| 101 | 3300005366 | Ga0070659_100062040 | Ga0070659_1000620402 | 106 |
| 102 | 3300005367 | Ga0070667_100311451 | Ga0070667_1003114511 | 106 |
| 103 | 3300005456 | Ga0070678_102376697 | Ga0070678_1023766971 | 106 |
| 104 | 3300005458 | Ga0070681_11268697 | Ga0070681_112686972 | 106 |
| 105 | 3300005466 | Ga0070685_10094004 | Ga0070685_100940043 | 106 |
| 106 | 3300005539 | Ga0068853_101296212 | Ga0068853_1012962121 | 106 |
| 107 | 3300005563 | Ga0068855_100178329 | Ga0068855_1001783292 | 106 |
| 108 | 3300005563 | Ga0068855_100295724 | Ga0068855_1002957242 | 106 |
| 109 | 3300005577 | Ga0068857_100019908 | Ga0068857_1000199083 | 106 |
| 110 | 3300005577 | Ga0068857_100405343 | Ga0068857_1004053432 | 106 |
| 111 | 3300005578 | Ga0068854_100992628 | Ga0068854_1009926282 | 106 |
| 112 | 3300005614 | Ga0068856_100010333 | Ga0068856_10001033311 | 106 |
| 113 | 3300005614 | Ga0068856_100763730 | Ga0068856_1007637302 | 106 |
| 114 | 3300005718 | Ga0068866_10036727 | Ga0068866_100367272 | 106 |
| 115 | 3300005718 | Ga0068866_10229927 | Ga0068866_102299272 | 106 |
| 116 | 3300005834 | Ga0068851_10114503 | Ga0068851_101145033 | 106 |
| 117 | 3300005841 | Ga0068863_100038019 | Ga0068863_1000380195 | 106 |
| 118 | 3300005843 | Ga0068860_100087778 | Ga0068860_1000877782 | 106 |
| 119 | 3300006028 | Ga0070717_11332776 | Ga0070717_113327762 | 106 |
| 120 | 3300006173 | Ga0070716_101534417 | Ga0070716_1015344171 | 106 |
| 121 | 3300006237 | Ga0097621_100055015 | Ga0097621_1000550154 | 106 |
| 122 | 3300006358 | Ga0068871_100185203 | Ga0068871_1001852033 | 106 |
| 123 | 3300006358 | Ga0068871_101014734 | Ga0068871_1010147342 | 106 |
| 124 | 3300006358 | Ga0068871_102147542 | Ga0068871_1021475421 | 106 |
| 125 | 3300006881 | Ga0068865_100198469 | Ga0068865_1001984693 | 106 |
| 126 | 3300009093 | Ga0105240_10006046 | Ga0105240_100060464 | 106 |
| 127 | 3300009093 | Ga0105240_10352326 | Ga0105240_103523262 | 106 |
| 128 | 3300009093 | Ga0105240_10611574 | Ga0105240_106115742 | 106 |
| 129 | 3300009094 | Ga0111539_11279601 | Ga0111539_112796011 | 106 |
| 130 | 3300009098 | Ga0105245_11282684 | Ga0105245_112826841 | 106 |
| 131 | 3300009174 | Ga0105241_10271760 | Ga0105241_102717602 | 106 |
| 132 | 3300009174 | Ga0105241_10682658 | Ga0105241_106826582 | 106 |
| 133 | 3300009176 | Ga0105242_10527991 | Ga0105242_105279911 | 106 |
| 134 | 3300009545 | Ga0105237_10013895 | Ga0105237_100138959 | 106 |
| 135 | 3300009545 | Ga0105237_10094787 | Ga0105237_100947871 | 106 |
| 136 | 3300009545 | Ga0105237_10352399 | Ga0105237_103523992 | 106 |
| 137 | 3300009545 | Ga0105237_10537213 | Ga0105237_105372132 | 106 |
| 138 | 3300009553 | Ga0105249_10005708 | Ga0105249_100057084 | 106 |
| 139 | 3300009553 | Ga0105249_10031280 | Ga0105249_100312805 | 106 |
| 140 | 3300010375 | Ga0105239_10002040 | Ga0105239_100020406 | 106 |
| 141 | 3300010375 | Ga0105239_10103523 | Ga0105239_101035233 | 106 |
| 142 | 3300011119 | Ga0105246_10882874 | Ga0105246_108828741 | 106 |
| 143 | 3300013100 | Ga0157373_10000064 | Ga0157373_1000006410 | 106 |
| 144 | 3300013100 | Ga0157373_10008962 | Ga0157373_100089623 | 106 |
| 145 | 3300013100 | Ga0157373_10678663 | Ga0157373_106786631 | 106 |
| 146 | 3300013102 | Ga0157371_10013437 | Ga0157371_100134376 | 106 |
| 147 | 3300013104 | Ga0157370_10127395 | Ga0157370_101273953 | 106 |
| 148 | 3300013105 | Ga0157369_10961902 | Ga0157369_109619022 | 106 |
| 149 | 3300013296 | Ga0157374_10046036 | Ga0157374_100460362 | 106 |
| 150 | 3300013296 | Ga0157374_11230579 | Ga0157374_112305792 | 106 |
| 151 | 3300013297 | Ga0157378_10041672 | Ga0157378_100416722 | 106 |
| 152 | 3300013297 | Ga0157378_10462052 | Ga0157378_104620521 | 106 |
| 153 | 3300013306 | Ga0163162_10006451 | Ga0163162_100064514 | 106 |
| 154 | 3300013307 | Ga0157372_10001038 | Ga0157372_1000103821 | 106 |
| 155 | 3300013307 | Ga0157372_10010105 | Ga0157372_100101058 | 106 |
| 156 | 3300013307 | Ga0157372_10717477 | Ga0157372_107174771 | 106 |
| 157 | 3300013308 | Ga0157375_10106993 | Ga0157375_101069932 | 106 |
| 158 | 3300013308 | Ga0157375_12143850 | Ga0157375_121438502 | 106 |
| 159 | 3300014325 | Ga0163163_12935656 | Ga0163163_129356561 | 106 |
| 160 | 3300014745 | Ga0157377_10368043 | Ga0157377_103680431 | 106 |
| 161 | 3300014968 | Ga0157379_11193889 | Ga0157379_111938892 | 106 |
| 162 | 3300014969 | Ga0157376_10044935 | Ga0157376_100449354 | 106 |
| 163 | 3300015261 | Ga0182006_1011517 | Ga0182006_10115175 | 106 |
| 164 | 3300017792 | Ga0163161_10008784 | Ga0163161_100087843 | 106 |
| 165 | 3300017792 | Ga0163161_10022832 | Ga0163161_100228323 | 106 |
| 166 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002105 | 106 |
| 167 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002105 | 106 |
| 168 | 3300025261 | Ga0209233_1003098 | Ga0209233_10030982 | 106 |
| 169 | 3300025294 | Ga0209025_1000004 | Ga0209025_10000041084 | 106 |
| 170 | 3300025297 | Ga0209758_1000006 | Ga0209758_10000061084 | 106 |
| 171 | 3300025321 | Ga0207656_10118717 | Ga0207656_101187171 | 106 |
| 172 | 3300025899 | Ga0207642_10151484 | Ga0207642_101514842 | 106 |
| 173 | 3300025904 | Ga0207647_10000473 | Ga0207647_1000047327 | 106 |
| 174 | 3300025911 | Ga0207654_10059445 | Ga0207654_100594453 | 106 |
| 175 | 3300025911 | Ga0207654_10259891 | Ga0207654_102598911 | 106 |
| 176 | 3300025912 | Ga0207707_10653697 | Ga0207707_106536972 | 106 |
| 177 | 3300025913 | Ga0207695_10004281 | Ga0207695_100042813 | 106 |
| 178 | 3300025913 | Ga0207695_10878470 | Ga0207695_108784701 | 106 |
| 179 | 3300025914 | Ga0207671_10005998 | Ga0207671_100059989 | 106 |
| 180 | 3300025914 | Ga0207671_10009912 | Ga0207671_100099128 | 106 |
| 181 | 3300025914 | Ga0207671_10053596 | Ga0207671_100535961 | 106 |
| 182 | 3300025914 | Ga0207671_10111299 | Ga0207671_101112992 | 106 |
| 183 | 3300025914 | Ga0207671_10357235 | Ga0207671_103572351 | 106 |
| 184 | 3300025917 | Ga0207660_11096312 | Ga0207660_110963121 | 106 |
| 185 | 3300025920 | Ga0207649_10709416 | Ga0207649_107094162 | 106 |
| 186 | 3300025931 | Ga0207644_11869275 | Ga0207644_118692751 | 106 |
| 187 | 3300025932 | Ga0207690_10006367 | Ga0207690_100063674 | 106 |
| 188 | 3300025937 | Ga0207669_10107274 | Ga0207669_101072741 | 106 |
| 189 | 3300025938 | Ga0207704_10332371 | Ga0207704_103323712 | 106 |
| 190 | 3300025942 | Ga0207689_10148036 | Ga0207689_101480362 | 106 |
| 191 | 3300025949 | Ga0207667_10165857 | Ga0207667_101658572 | 106 |
| 192 | 3300025949 | Ga0207667_11296059 | Ga0207667_112960591 | 106 |
| 193 | 3300025960 | Ga0207651_11567650 | Ga0207651_115676501 | 106 |
| 194 | 3300025961 | Ga0207712_10042445 | Ga0207712_100424452 | 106 |
| 195 | 3300025961 | Ga0207712_10058641 | Ga0207712_100586412 | 106 |
| 196 | 3300025981 | Ga0207640_10332752 | Ga0207640_103327522 | 106 |
| 197 | 3300025986 | Ga0207658_12040488 | Ga0207658_120404881 | 106 |
| 198 | 3300026023 | Ga0207677_10157972 | Ga0207677_101579722 | 106 |
| 199 | 3300026041 | Ga0207639_11538078 | Ga0207639_115380781 | 106 |
| 200 | 3300026078 | Ga0207702_10088609 | Ga0207702_100886093 | 106 |
| 201 | 3300026089 | Ga0207648_10057703 | Ga0207648_100577031 | 106 |
| 202 | 3300026116 | Ga0207674_10041840 | Ga0207674_100418403 | 106 |
| 203 | 3300026116 | Ga0207674_10379647 | Ga0207674_103796472 | 106 |
| 204 | 3300026121 | Ga0207683_12059198 | Ga0207683_120591981 | 106 |
| 205 | 3300031730 | Ga0307516_10066990 | Ga0307516_100669902 | 106 |
| 206 | 3300031911 | Ga0307412_10000009 | Ga0307412_10000009111 | 106 |
| 207 | 3300032004 | Ga0307414_10000243 | Ga0307414_1000024321 | 106 |
| 208 | 3300046492 | Ga0495585_0195677 | Ga0495585_0195677_422_760 | 106 |
| 209 | 3300046500 | Ga0495596_0042919 | Ga0495596_0042919_1236_1580 | 106 |
| 210 | 3300046507 | Ga0495606_0152115 | Ga0495606_0152115_242_586 | 106 |
| 211 | 3300046507 | Ga0495606_0422892 | Ga0495606_0422892_127_447 | 106 |
| 212 | 3300046517 | Ga0495630_0763725 | Ga0495630_0763725_19_363 | 106 |
| 213 | 3300046519 | Ga0495632_0304367 | Ga0495632_0304367_241_579 | 106 |
| 214 | 3300046538 | Ga0495609_0003446 | Ga0495609_0003446_5508_5828 | 106 |
| 215 | 3300046660 | Ga0495625_0002832 | Ga0495625_0002832_15115_15453 | 106 |
| 216 | 3300047472 | Ga0495686_0000524 | Ga0495686_0000524_19517_19855 | 106 |
| 217 | 3300047472 | Ga0495686_0020134 | Ga0495686_0020134_1499_1888 | 106 |
| 218 | 3300050511 | nmdc:mga08y16_1284739_c1 | nmdc:mga08y16_1284739_c1_261_599 | 106 |
| 219 | 3300053108 | Ga0500562_000018 | Ga0500562_000018_36694_37032 | 106 |
| 220 | 3300053134 | Ga0500658_0357703 | Ga0500658_0357703_193_513 | 106 |
| 221 | 3300053733 | Ga0500552_011375 | Ga0500552_011375_452_772 | 106 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oxl-assembly1.cif.gz_B | cryo-em structure of phosphorylated ap-2 (mu e302k) bound to necap in the presence of ss dna | 0.3115 | 5 | 91 |
| 8ctj-assembly1.cif.gz_A | cryo-em structure of tmem87a | 0.2824 | 4 | 99 |
| 7xzi-assembly1.cif.gz_D | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.2713 | 12 | 91 |
| 6oxl-assembly1.cif.gz_B | cryo-em structure of phosphorylated ap-2 (mu e302k) bound to necap in the presence of ss dna | 0.2642 | 5 | 91 |
| 6s7o-assembly1.cif.gz_H | cryo-em structure of human oligosaccharyltransferase complex ost-a | 0.2562 | 5 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LXC2_176_272_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.4404 | 13 | 98 | 1.20.58.160 |
| af_I1LXC2_176_272_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3743 | 13 | 98 | 1.20.58.160 |
| af_I1MBJ2_46_141_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.333 | 1 | 92 | 1.10.472.10 |
| af_A0A0R0J5T7_524_682_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3108 | 4 | 103 | 1.25.10.10 |
| af_I1MBJ2_46_141_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.3059 | 1 | 92 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D4TTJ8-F1-model_v4 | DUF1648 domain-containing protein | 0.9807 | 1 | 99 |
GO:0016020
|
| AF-A0A1Q4FF71-F1-model_v4 | Uncharacterized protein | 0.9402 | 1 | 104 |
GO:0016020
|
| AF-A0A1I5S601-F1-model_v4 | DUF4328 domain-containing protein | 0.9389 | 1 | 106 |
GO:0016020
|
| AF-A0A1I5S601-F1-model_v4 | DUF4328 domain-containing protein | 0.9305 | 1 | 106 |
GO:0016020
|
| AF-A0A7D4TTJ8-F1-model_v4 | DUF1648 domain-containing protein | 0.9167 | 1 | 99 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar