F333374

General Info

Members Datasets Scaffolds Average Seq Length
221 136 218 110

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10127395|Ga0157370_101273953
Length 129
Sequence VDYITLKYKVLFIVLHMKISRKKFVIIFVLSAFVFQFITNSLLGPKVGGLPVNGDWFSGAGSPIVWKRTVAAIIYPIRIVLVGPLSPIFNDPDPVPPLLGFFCALYWTFLALALHFIISKINLGKKRDS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
3 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
4 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
136 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 0
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1664813 2162886007 Bacteria 51394
2 JGI24737J22298_10000630 3300001990 Bacteria 12426
3 JGI24735J21928_10067313 3300002067 Bacteria 1027
4 JGI25152J39213_1000135 3300002773 Bacteria 50172
5 JGI25150J39212_1000001 3300002774 Bacteria 1318726
6 JGI25151J46595_10000005 3300003187 Bacteria 431598
7 JGI25406J46586_10011635 3300003203 Bacteria 3853
8 JGI25153J46596_10000018 3300003215 Bacteria 269774
9 rootH1_10146827 3300003316 Bacteria 1273
10 Ga0065714_10002338 3300005288 Bacteria 23916
11 Ga0065714_10007953 3300005288 Bacteria 12974
12 Ga0065704_10000208 3300005289 Bacteria 101850
13 Ga0065704_10208868 3300005289 Bacteria 1116
14 Ga0070658_10003547 3300005327 Bacteria 12808
15 Ga0070658_10407594 3300005327 Unclassified 1168
16 Ga0070690_100825476 3300005330 Bacteria 721
17 Ga0070670_100289757 3300005331 Bacteria 1430
18 Ga0070670_100627960 3300005331 Bacteria 963
19 Ga0068869_100127266 3300005334 Bacteria 1955
20 Ga0068869_101331787 3300005334 Bacteria 634
21 Ga0070680_101401617 3300005336 Bacteria 605
22 Ga0068868_100044567 3300005338 Bacteria 3468
23 Ga0070661_100355250 3300005344 Bacteria 1151
24 Ga0070661_100628460 3300005344 Bacteria 870
25 Ga0070668_102161520 3300005347 Bacteria 514
26 Ga0070674_100127597 3300005356 Bacteria 1892
27 Ga0070673_100205117 3300005364 Bacteria 1699
28 Ga0070688_101562635 3300005365 Bacteria 538
29 Ga0070659_100062040 3300005366 Bacteria 2954
30 Ga0070659_101460073 3300005366 Bacteria 609
31 Ga0070667_100012121 3300005367 Bacteria 7137
32 Ga0070667_100311451 3300005367 Bacteria 1419
33 Ga0070667_101319753 3300005367 Bacteria 676
34 Ga0070678_102376697 3300005456 Bacteria 503
35 Ga0070681_11268697 3300005458 Bacteria 659
36 Ga0068867_101280921 3300005459 Bacteria 676
37 Ga0070685_10094004 3300005466 Bacteria 1820
38 Ga0070679_101209374 3300005530 Unclassified 701
39 Ga0068853_101296212 3300005539 Bacteria 704
40 Ga0068855_100000240 3300005563 Bacteria 69408
41 Ga0068855_100041628 3300005563 Bacteria 5444
42 Ga0068855_100178329 3300005563 Bacteria 2403
43 Ga0068855_100203130 3300005563 Bacteria 2230
44 Ga0068855_100295724 3300005563 Bacteria 1794
45 Ga0068857_100019908 3300005577 Bacteria 5899
46 Ga0068857_100405343 3300005577 Bacteria 1269
47 Ga0068854_100992628 3300005578 Unclassified 743
48 Ga0068856_100010333 3300005614 Bacteria 9068
49 Ga0068856_100763730 3300005614 Bacteria 987
50 Ga0068852_100127579 3300005616 Bacteria 2338
51 Ga0068864_100435371 3300005618 Bacteria 1252
52 Ga0068866_10036727 3300005718 Bacteria 2401
53 Ga0068866_10229927 3300005718 Bacteria 1124
54 Ga0068861_102154268 3300005719 Bacteria 558
55 Ga0068851_10114503 3300005834 Bacteria 1443
56 Ga0068863_100038019 3300005841 Bacteria 4580
57 Ga0068860_100087778 3300005843 Bacteria 2961
58 Ga0068860_100938719 3300005843 Bacteria 882
59 Ga0068860_101418586 3300005843 Bacteria 716
60 Ga0081539_10017335 3300005985 Bacteria 5064
61 Ga0070717_11332776 3300006028 Bacteria 652
62 Ga0070716_101534417 3300006173 Bacteria 545
63 Ga0075366_10388853 3300006195 Bacteria 858
64 Ga0097621_100055015 3300006237 Bacteria 3249
65 Ga0068871_100185203 3300006358 Bacteria 1791
66 Ga0068871_101014734 3300006358 Bacteria 773
67 Ga0068871_102147542 3300006358 Bacteria 532
68 Ga0068865_100198469 3300006881 Bacteria 1556
69 Ga0097620_101754236 3300006931 Bacteria 686
70 Ga0105240_10006046 3300009093 Bacteria 17877
71 Ga0105240_10352326 3300009093 Bacteria 1670
72 Ga0105240_10611574 3300009093 Bacteria 1199
73 Ga0105240_11445140 3300009093 Bacteria 722
74 Ga0111539_11279601 3300009094 Bacteria 851
75 Ga0105245_11282684 3300009098 Bacteria 781
76 Ga0105241_10271760 3300009174 Bacteria 1444
77 Ga0105241_10658830 3300009174 Unclassified 952
78 Ga0105241_10682658 3300009174 Bacteria 936
79 Ga0105242_10527991 3300009176 Bacteria 1127
80 Ga0105242_11344955 3300009176 Bacteria 740
81 Ga0105237_10000362 3300009545 Bacteria 64230
82 Ga0105237_10013895 3300009545 Bacteria 8424
83 Ga0105237_10094787 3300009545 Bacteria 2974
84 Ga0105237_10352399 3300009545 Bacteria 1476
85 Ga0105237_10537213 3300009545 Unclassified 1176
86 Ga0105237_11677382 3300009545 Bacteria 643
87 Ga0105249_10005708 3300009553 Bacteria 10763
88 Ga0105249_10031280 3300009553 Bacteria 4812
89 Ga0105239_10002040 3300010375 Bacteria 26200
90 Ga0105239_10103523 3300010375 Bacteria 3151
91 Ga0105239_10152595 3300010375 Unclassified 2578
92 Ga0105239_10155569 3300010375 Bacteria 2553
93 Ga0105246_10882874 3300011119 Bacteria 800
94 Ga0157373_10000064 3300013100 Bacteria 94176
95 Ga0157373_10008962 3300013100 Bacteria 7402
96 Ga0157373_10032678 3300013100 Bacteria 3745
97 Ga0157373_10678663 3300013100 Bacteria 754
98 Ga0157371_10013437 3300013102 Bacteria 6216
99 Ga0157371_10024015 3300013102 Bacteria 4454
100 Ga0157371_10030960 3300013102 Bacteria 3856
101 Ga0157370_10127395 3300013104 Bacteria 2376
102 Ga0157370_10479007 3300013104 Bacteria 1144
103 Ga0157370_11264537 3300013104 Unclassified 665
104 Ga0157369_10191049 3300013105 Bacteria 2152
105 Ga0157369_10961902 3300013105 Bacteria 875
106 Ga0157369_10973791 3300013105 Bacteria 869
107 Ga0157374_10004780 3300013296 Bacteria 11364
108 Ga0157374_10046036 3300013296 Bacteria 4038
109 Ga0157374_10092999 3300013296 Bacteria 2878
110 Ga0157374_11230579 3300013296 Bacteria 770
111 Ga0157374_12829186 3300013296 Bacteria 513
112 Ga0157378_10041672 3300013297 Unclassified 4073
113 Ga0157378_10462052 3300013297 Bacteria 1262
114 Ga0157378_10928339 3300013297 Bacteria 902
115 Ga0157378_11410506 3300013297 Bacteria 740
116 Ga0163162_10006451 3300013306 Bacteria 11366
117 Ga0163162_11084666 3300013306 Bacteria 907
118 Ga0157372_10001038 3300013307 Bacteria 30369
119 Ga0157372_10010105 3300013307 Bacteria 10026
120 Ga0157372_10145045 3300013307 Bacteria 2738
121 Ga0157372_10717477 3300013307 Bacteria 1163
122 Ga0157372_11198037 3300013307 Bacteria 878
123 Ga0157372_13291310 3300013307 Bacteria 515
124 Ga0157372_13315220 3300013307 Unclassified 513
125 Ga0157375_10064737 3300013308 Bacteria 3641
126 Ga0157375_10106993 3300013308 Bacteria 2889
127 Ga0157375_10129375 3300013308 Bacteria 2643
128 Ga0157375_12143850 3300013308 Bacteria 665
129 Ga0163163_10284525 3300014325 Bacteria 1705
130 Ga0163163_12935656 3300014325 Bacteria 532
131 Ga0157377_10109920 3300014745 Bacteria 1655
132 Ga0157377_10368043 3300014745 Bacteria 970
133 Ga0157379_11193889 3300014968 Unclassified 732
134 Ga0157379_11312818 3300014968 Bacteria 699
135 Ga0157376_10044935 3300014969 Bacteria 3634
136 Ga0157376_11311876 3300014969 Bacteria 754
137 Ga0182006_1011517 3300015261 Bacteria 3890
138 Ga0163161_10008784 3300017792 Bacteria 6983
139 Ga0163161_10022832 3300017792 Bacteria 4408
140 Ga0207425_1000002 3300025245 Bacteria 1362590
141 Ga0209129_1000002 3300025258 Bacteria 1359086
142 Ga0209233_1003098 3300025261 Bacteria 5918
143 Ga0209025_1000004 3300025294 Bacteria 1361782
144 Ga0209758_1000006 3300025297 Bacteria 1359562
145 Ga0207656_10118717 3300025321 Bacteria 1229
146 Ga0207642_10151484 3300025899 Bacteria 1235
147 Ga0207647_10000473 3300025904 Bacteria 32482
148 Ga0207705_10000457 3300025909 Bacteria 35062
149 Ga0207654_10059445 3300025911 Bacteria 2229
150 Ga0207654_10259891 3300025911 Bacteria 1167
151 Ga0207707_10653697 3300025912 Bacteria 886
152 Ga0207695_10004281 3300025913 Bacteria 19579
153 Ga0207695_10878470 3300025913 Bacteria 776
154 Ga0207671_10005998 3300025914 Bacteria 10989
155 Ga0207671_10009912 3300025914 Bacteria 7918
156 Ga0207671_10021051 3300025914 Bacteria 4954
157 Ga0207671_10053596 3300025914 Bacteria 2989
158 Ga0207671_10111299 3300025914 Bacteria 2083
159 Ga0207671_10357235 3300025914 Unclassified 1159
160 Ga0207660_11096312 3300025917 Bacteria 649
161 Ga0207649_10709416 3300025920 Bacteria 781
162 Ga0207650_10493420 3300025925 Bacteria 1023
163 Ga0207650_10566468 3300025925 Bacteria 953
164 Ga0207644_11869275 3300025931 Unclassified 502
165 Ga0207690_10006367 3300025932 Bacteria 6997
166 Ga0207669_10107274 3300025937 Bacteria 1862
167 Ga0207704_10332371 3300025938 Bacteria 1176
168 Ga0207689_10148036 3300025942 Unclassified 1935
169 Ga0207667_10000037 3300025949 Bacteria 297252
170 Ga0207667_10165857 3300025949 Bacteria 2271
171 Ga0207667_11087194 3300025949 Bacteria 783
172 Ga0207667_11296059 3300025949 Bacteria 705
173 Ga0207651_11567650 3300025960 Bacteria 593
174 Ga0207712_10042445 3300025961 Bacteria 3132
175 Ga0207712_10058641 3300025961 Bacteria 2721
176 Ga0207668_10651582 3300025972 Bacteria 922
177 Ga0207640_10332752 3300025981 Unclassified 1214
178 Ga0207658_10086786 3300025986 Bacteria 2414
179 Ga0207658_12040488 3300025986 Bacteria 522
180 Ga0207677_10157972 3300026023 Bacteria 1758
181 Ga0207703_11150641 3300026035 Bacteria 746
182 Ga0207639_11538078 3300026041 Bacteria 624
183 Ga0207702_10044064 3300026078 Bacteria 3749
184 Ga0207702_10088609 3300026078 Bacteria 2704
185 Ga0207648_10057703 3300026089 Bacteria 3387
186 Ga0207676_10067673 3300026095 Bacteria 2854
187 Ga0207674_10041840 3300026116 Bacteria 4736
188 Ga0207674_10379647 3300026116 Bacteria 1366
189 Ga0207674_11258095 3300026116 Bacteria 709
190 Ga0207683_12059198 3300026121 Bacteria 519
191 Ga0207698_10193092 3300026142 Bacteria 1816
192 Ga0307509_10321125 3300031507 Bacteria 1285
193 Ga0307516_10066990 3300031730 Bacteria 3461
194 Ga0307412_10000009 3300031911 Bacteria 445987
195 Ga0307414_10000243 3300032004 Bacteria 34739
196 Ga0373941_0052425 3300035115 Bacteria 1301
197 Ga0439448_0330106 3300042005 Bacteria 543
198 Ga0495585_0195677 3300046492 Bacteria 1032
199 Ga0495596_0042919 3300046500 Bacteria 1782
200 Ga0495606_0152115 3300046507 Bacteria 1357
201 Ga0495606_0422892 3300046507 Bacteria 689
202 Ga0495616_0001122 3300046513 Bacteria 18977
203 Ga0495630_0763725 3300046517 Unclassified 739
204 Ga0495632_0304367 3300046519 Bacteria 706
205 Ga0495609_0003446 3300046538 Bacteria 9057
206 Ga0495625_0002832 3300046660 Bacteria 18231
207 Ga0495625_0020485 3300046660 Bacteria 5104
208 Ga0495672_0010604 3300047320 Bacteria 6549
209 Ga0495686_0000524 3300047472 Bacteria 55256
210 Ga0495686_0020134 3300047472 Bacteria 4452
211 Ga0495678_008800 3300049459 Bacteria 5055
212 nmdc:mga08y16_1284739_c1 3300050511 Bacteria 699
213 Ga0500562_000018 3300053108 Bacteria 126890
214 Ga0500642_0146199 3300053130 Bacteria 1109
215 Ga0500652_170908 3300053131 Bacteria 894
216 Ga0500658_0357703 3300053134 Bacteria 670
217 Ga0500579_178469 3300053143 Bacteria 843
218 Ga0500552_011375 3300053733 Bacteria 1117

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2929177148 2929180571 102
2 iso_pu_bacteria 2945977869 2945982972 102
3 iso_pu_bacteria 2946013367 2946017632 102
4 3300005330 Ga0070690_100825476 Ga0070690_1008254762 104
5 3300005530 Ga0070679_101209374 Ga0070679_1012093742 104
6 3300005618 Ga0068864_100435371 Ga0068864_1004353714 104
7 3300006195 Ga0075366_10388853 Ga0075366_103888532 104
8 3300013104 Ga0157370_10479007 Ga0157370_104790072 104
9 3300013105 Ga0157369_10973791 Ga0157369_109737912 104
10 3300013296 Ga0157374_12829186 Ga0157374_128291862 104
11 3300013307 Ga0157372_13291310 Ga0157372_132913101 104
12 3300025925 Ga0207650_10566468 Ga0207650_105664681 104
13 3300026116 Ga0207674_11258095 Ga0207674_112580952 104
14 3300031507 Ga0307509_10321125 Ga0307509_103211252 104
15 3300042005 Ga0439448_0330106 Ga0439448_0330106_135_452 104
16 3300003203 JGI25406J46586_10011635 JGI25406J46586_100116358 105
17 3300005289 Ga0065704_10208868 Ga0065704_102088681 105
18 3300005327 Ga0070658_10003547 Ga0070658_100035476 105
19 3300005331 Ga0070670_100289757 Ga0070670_1002897572 105
20 3300005344 Ga0070661_100355250 Ga0070661_1003552502 105
21 3300005344 Ga0070661_100628460 Ga0070661_1006284601 105
22 3300005347 Ga0070668_102161520 Ga0070668_1021615202 105
23 3300005365 Ga0070688_101562635 Ga0070688_1015626351 105
24 3300005366 Ga0070659_101460073 Ga0070659_1014600731 105
25 3300005367 Ga0070667_100012121 Ga0070667_1000121213 105
26 3300005367 Ga0070667_101319753 Ga0070667_1013197532 105
27 3300005459 Ga0068867_101280921 Ga0068867_1012809212 105
28 3300005563 Ga0068855_100000240 Ga0068855_10000024038 105
29 3300005563 Ga0068855_100041628 Ga0068855_1000416284 105
30 3300005563 Ga0068855_100203130 Ga0068855_1002031302 105
31 3300005616 Ga0068852_100127579 Ga0068852_1001275792 105
32 3300005719 Ga0068861_102154268 Ga0068861_1021542682 105
33 3300005843 Ga0068860_100938719 Ga0068860_1009387192 105
34 3300005843 Ga0068860_101418586 Ga0068860_1014185862 105
35 3300005985 Ga0081539_10017335 Ga0081539_100173351 105
36 3300006931 Ga0097620_101754236 Ga0097620_1017542361 105
37 3300009093 Ga0105240_11445140 Ga0105240_114451403 105
38 3300009174 Ga0105241_10658830 Ga0105241_106588302 105
39 3300009176 Ga0105242_11344955 Ga0105242_113449551 105
40 3300009545 Ga0105237_10000362 Ga0105237_100003623 105
41 3300009545 Ga0105237_11677382 Ga0105237_116773821 105
42 3300010375 Ga0105239_10152595 Ga0105239_101525952 105
43 3300010375 Ga0105239_10155569 Ga0105239_101555692 105
44 3300013100 Ga0157373_10032678 Ga0157373_100326786 105
45 3300013102 Ga0157371_10024015 Ga0157371_100240154 105
46 3300013102 Ga0157371_10030960 Ga0157371_100309606 105
47 3300013104 Ga0157370_11264537 Ga0157370_112645372 105
48 3300013105 Ga0157369_10191049 Ga0157369_101910491 105
49 3300013296 Ga0157374_10004780 Ga0157374_100047805 105
50 3300013296 Ga0157374_10092999 Ga0157374_100929993 105
51 3300013297 Ga0157378_10928339 Ga0157378_109283392 105
52 3300013297 Ga0157378_11410506 Ga0157378_114105061 105
53 3300013306 Ga0163162_11084666 Ga0163162_110846661 105
54 3300013307 Ga0157372_10145045 Ga0157372_101450451 105
55 3300013307 Ga0157372_11198037 Ga0157372_111980372 105
56 3300013307 Ga0157372_13315220 Ga0157372_133152201 105
57 3300013308 Ga0157375_10064737 Ga0157375_100647374 105
58 3300013308 Ga0157375_10129375 Ga0157375_101293753 105
59 3300014325 Ga0163163_10284525 Ga0163163_102845253 105
60 3300014745 Ga0157377_10109920 Ga0157377_101099202 105
61 3300014968 Ga0157379_11312818 Ga0157379_113128182 105
62 3300014969 Ga0157376_11311876 Ga0157376_113118761 105
63 3300025909 Ga0207705_10000457 Ga0207705_1000045711 105
64 3300025914 Ga0207671_10021051 Ga0207671_100210513 105
65 3300025925 Ga0207650_10493420 Ga0207650_104934202 105
66 3300025949 Ga0207667_10000037 Ga0207667_1000003796 105
67 3300025949 Ga0207667_11087194 Ga0207667_110871941 105
68 3300025972 Ga0207668_10651582 Ga0207668_106515822 105
69 3300025986 Ga0207658_10086786 Ga0207658_100867862 105
70 3300026035 Ga0207703_11150641 Ga0207703_111506412 105
71 3300026078 Ga0207702_10044064 Ga0207702_100440643 105
72 3300026095 Ga0207676_10067673 Ga0207676_100676735 105
73 3300026142 Ga0207698_10193092 Ga0207698_101930921 105
74 3300035115 Ga0373941_0052425 Ga0373941_0052425_59_376 105
75 3300046513 Ga0495616_0001122 Ga0495616_0001122_198_581 105
76 3300046660 Ga0495625_0020485 Ga0495625_0020485_2230_2613 105
77 3300047320 Ga0495672_0010604 Ga0495672_0010604_5055_5390 105
78 3300049459 Ga0495678_008800 Ga0495678_008800_566_949 105
79 3300053130 Ga0500642_0146199 Ga0500642_0146199_255_599 105
80 3300053131 Ga0500652_170908 Ga0500652_170908_335_718 105
81 3300053143 Ga0500579_178469 Ga0500579_178469_380_748 105
82 2162886007 SwRhRL2b_contig_1664813 SwRhRL2b_0282.00001560 106
83 3300001990 JGI24737J22298_10000630 JGI24737J22298_100006303 106
84 3300002067 JGI24735J21928_10067313 JGI24735J21928_100673131 106
85 3300002773 JGI25152J39213_1000135 JGI25152J39213_100013531 106
86 3300002774 JGI25150J39212_1000001 JGI25150J39212_10000011093 106
87 3300003187 JGI25151J46595_10000005 JGI25151J46595_10000005108 106
88 3300003215 JGI25153J46596_10000018 JGI25153J46596_10000018126 106
89 3300003316 rootH1_10146827 rootH1_101468272 106
90 3300005288 Ga0065714_10002338 Ga0065714_100023383 106
91 3300005288 Ga0065714_10007953 Ga0065714_100079532 106
92 3300005289 Ga0065704_10000208 Ga0065704_1000020825 106
93 3300005327 Ga0070658_10407594 Ga0070658_104075941 106
94 3300005331 Ga0070670_100627960 Ga0070670_1006279601 106
95 3300005334 Ga0068869_100127266 Ga0068869_1001272662 106
96 3300005334 Ga0068869_101331787 Ga0068869_1013317871 106
97 3300005336 Ga0070680_101401617 Ga0070680_1014016172 106
98 3300005338 Ga0068868_100044567 Ga0068868_1000445673 106
99 3300005356 Ga0070674_100127597 Ga0070674_1001275974 106
100 3300005364 Ga0070673_100205117 Ga0070673_1002051171 106
101 3300005366 Ga0070659_100062040 Ga0070659_1000620402 106
102 3300005367 Ga0070667_100311451 Ga0070667_1003114511 106
103 3300005456 Ga0070678_102376697 Ga0070678_1023766971 106
104 3300005458 Ga0070681_11268697 Ga0070681_112686972 106
105 3300005466 Ga0070685_10094004 Ga0070685_100940043 106
106 3300005539 Ga0068853_101296212 Ga0068853_1012962121 106
107 3300005563 Ga0068855_100178329 Ga0068855_1001783292 106
108 3300005563 Ga0068855_100295724 Ga0068855_1002957242 106
109 3300005577 Ga0068857_100019908 Ga0068857_1000199083 106
110 3300005577 Ga0068857_100405343 Ga0068857_1004053432 106
111 3300005578 Ga0068854_100992628 Ga0068854_1009926282 106
112 3300005614 Ga0068856_100010333 Ga0068856_10001033311 106
113 3300005614 Ga0068856_100763730 Ga0068856_1007637302 106
114 3300005718 Ga0068866_10036727 Ga0068866_100367272 106
115 3300005718 Ga0068866_10229927 Ga0068866_102299272 106
116 3300005834 Ga0068851_10114503 Ga0068851_101145033 106
117 3300005841 Ga0068863_100038019 Ga0068863_1000380195 106
118 3300005843 Ga0068860_100087778 Ga0068860_1000877782 106
119 3300006028 Ga0070717_11332776 Ga0070717_113327762 106
120 3300006173 Ga0070716_101534417 Ga0070716_1015344171 106
121 3300006237 Ga0097621_100055015 Ga0097621_1000550154 106
122 3300006358 Ga0068871_100185203 Ga0068871_1001852033 106
123 3300006358 Ga0068871_101014734 Ga0068871_1010147342 106
124 3300006358 Ga0068871_102147542 Ga0068871_1021475421 106
125 3300006881 Ga0068865_100198469 Ga0068865_1001984693 106
126 3300009093 Ga0105240_10006046 Ga0105240_100060464 106
127 3300009093 Ga0105240_10352326 Ga0105240_103523262 106
128 3300009093 Ga0105240_10611574 Ga0105240_106115742 106
129 3300009094 Ga0111539_11279601 Ga0111539_112796011 106
130 3300009098 Ga0105245_11282684 Ga0105245_112826841 106
131 3300009174 Ga0105241_10271760 Ga0105241_102717602 106
132 3300009174 Ga0105241_10682658 Ga0105241_106826582 106
133 3300009176 Ga0105242_10527991 Ga0105242_105279911 106
134 3300009545 Ga0105237_10013895 Ga0105237_100138959 106
135 3300009545 Ga0105237_10094787 Ga0105237_100947871 106
136 3300009545 Ga0105237_10352399 Ga0105237_103523992 106
137 3300009545 Ga0105237_10537213 Ga0105237_105372132 106
138 3300009553 Ga0105249_10005708 Ga0105249_100057084 106
139 3300009553 Ga0105249_10031280 Ga0105249_100312805 106
140 3300010375 Ga0105239_10002040 Ga0105239_100020406 106
141 3300010375 Ga0105239_10103523 Ga0105239_101035233 106
142 3300011119 Ga0105246_10882874 Ga0105246_108828741 106
143 3300013100 Ga0157373_10000064 Ga0157373_1000006410 106
144 3300013100 Ga0157373_10008962 Ga0157373_100089623 106
145 3300013100 Ga0157373_10678663 Ga0157373_106786631 106
146 3300013102 Ga0157371_10013437 Ga0157371_100134376 106
147 3300013104 Ga0157370_10127395 Ga0157370_101273953 106
148 3300013105 Ga0157369_10961902 Ga0157369_109619022 106
149 3300013296 Ga0157374_10046036 Ga0157374_100460362 106
150 3300013296 Ga0157374_11230579 Ga0157374_112305792 106
151 3300013297 Ga0157378_10041672 Ga0157378_100416722 106
152 3300013297 Ga0157378_10462052 Ga0157378_104620521 106
153 3300013306 Ga0163162_10006451 Ga0163162_100064514 106
154 3300013307 Ga0157372_10001038 Ga0157372_1000103821 106
155 3300013307 Ga0157372_10010105 Ga0157372_100101058 106
156 3300013307 Ga0157372_10717477 Ga0157372_107174771 106
157 3300013308 Ga0157375_10106993 Ga0157375_101069932 106
158 3300013308 Ga0157375_12143850 Ga0157375_121438502 106
159 3300014325 Ga0163163_12935656 Ga0163163_129356561 106
160 3300014745 Ga0157377_10368043 Ga0157377_103680431 106
161 3300014968 Ga0157379_11193889 Ga0157379_111938892 106
162 3300014969 Ga0157376_10044935 Ga0157376_100449354 106
163 3300015261 Ga0182006_1011517 Ga0182006_10115175 106
164 3300017792 Ga0163161_10008784 Ga0163161_100087843 106
165 3300017792 Ga0163161_10022832 Ga0163161_100228323 106
166 3300025245 Ga0207425_1000002 Ga0207425_1000002105 106
167 3300025258 Ga0209129_1000002 Ga0209129_1000002105 106
168 3300025261 Ga0209233_1003098 Ga0209233_10030982 106
169 3300025294 Ga0209025_1000004 Ga0209025_10000041084 106
170 3300025297 Ga0209758_1000006 Ga0209758_10000061084 106
171 3300025321 Ga0207656_10118717 Ga0207656_101187171 106
172 3300025899 Ga0207642_10151484 Ga0207642_101514842 106
173 3300025904 Ga0207647_10000473 Ga0207647_1000047327 106
174 3300025911 Ga0207654_10059445 Ga0207654_100594453 106
175 3300025911 Ga0207654_10259891 Ga0207654_102598911 106
176 3300025912 Ga0207707_10653697 Ga0207707_106536972 106
177 3300025913 Ga0207695_10004281 Ga0207695_100042813 106
178 3300025913 Ga0207695_10878470 Ga0207695_108784701 106
179 3300025914 Ga0207671_10005998 Ga0207671_100059989 106
180 3300025914 Ga0207671_10009912 Ga0207671_100099128 106
181 3300025914 Ga0207671_10053596 Ga0207671_100535961 106
182 3300025914 Ga0207671_10111299 Ga0207671_101112992 106
183 3300025914 Ga0207671_10357235 Ga0207671_103572351 106
184 3300025917 Ga0207660_11096312 Ga0207660_110963121 106
185 3300025920 Ga0207649_10709416 Ga0207649_107094162 106
186 3300025931 Ga0207644_11869275 Ga0207644_118692751 106
187 3300025932 Ga0207690_10006367 Ga0207690_100063674 106
188 3300025937 Ga0207669_10107274 Ga0207669_101072741 106
189 3300025938 Ga0207704_10332371 Ga0207704_103323712 106
190 3300025942 Ga0207689_10148036 Ga0207689_101480362 106
191 3300025949 Ga0207667_10165857 Ga0207667_101658572 106
192 3300025949 Ga0207667_11296059 Ga0207667_112960591 106
193 3300025960 Ga0207651_11567650 Ga0207651_115676501 106
194 3300025961 Ga0207712_10042445 Ga0207712_100424452 106
195 3300025961 Ga0207712_10058641 Ga0207712_100586412 106
196 3300025981 Ga0207640_10332752 Ga0207640_103327522 106
197 3300025986 Ga0207658_12040488 Ga0207658_120404881 106
198 3300026023 Ga0207677_10157972 Ga0207677_101579722 106
199 3300026041 Ga0207639_11538078 Ga0207639_115380781 106
200 3300026078 Ga0207702_10088609 Ga0207702_100886093 106
201 3300026089 Ga0207648_10057703 Ga0207648_100577031 106
202 3300026116 Ga0207674_10041840 Ga0207674_100418403 106
203 3300026116 Ga0207674_10379647 Ga0207674_103796472 106
204 3300026121 Ga0207683_12059198 Ga0207683_120591981 106
205 3300031730 Ga0307516_10066990 Ga0307516_100669902 106
206 3300031911 Ga0307412_10000009 Ga0307412_10000009111 106
207 3300032004 Ga0307414_10000243 Ga0307414_1000024321 106
208 3300046492 Ga0495585_0195677 Ga0495585_0195677_422_760 106
209 3300046500 Ga0495596_0042919 Ga0495596_0042919_1236_1580 106
210 3300046507 Ga0495606_0152115 Ga0495606_0152115_242_586 106
211 3300046507 Ga0495606_0422892 Ga0495606_0422892_127_447 106
212 3300046517 Ga0495630_0763725 Ga0495630_0763725_19_363 106
213 3300046519 Ga0495632_0304367 Ga0495632_0304367_241_579 106
214 3300046538 Ga0495609_0003446 Ga0495609_0003446_5508_5828 106
215 3300046660 Ga0495625_0002832 Ga0495625_0002832_15115_15453 106
216 3300047472 Ga0495686_0000524 Ga0495686_0000524_19517_19855 106
217 3300047472 Ga0495686_0020134 Ga0495686_0020134_1499_1888 106
218 3300050511 nmdc:mga08y16_1284739_c1 nmdc:mga08y16_1284739_c1_261_599 106
219 3300053108 Ga0500562_000018 Ga0500562_000018_36694_37032 106
220 3300053134 Ga0500658_0357703 Ga0500658_0357703_193_513 106
221 3300053733 Ga0500552_011375 Ga0500552_011375_452_772 106

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oxl-assembly1.cif.gz_B cryo-em structure of phosphorylated ap-2 (mu e302k) bound to necap in the presence of ss dna 0.3115 5 91
8ctj-assembly1.cif.gz_A cryo-em structure of tmem87a 0.2824 4 99
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.2713 12 91
6oxl-assembly1.cif.gz_B cryo-em structure of phosphorylated ap-2 (mu e302k) bound to necap in the presence of ss dna 0.2642 5 91
6s7o-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-a 0.2562 5 102
ID Description Score Start End Superfamily
af_I1LXC2_176_272_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4404 13 98 1.20.58.160
af_I1LXC2_176_272_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3743 13 98 1.20.58.160
af_I1MBJ2_46_141_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.333 1 92 1.10.472.10
af_A0A0R0J5T7_524_682_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3108 4 103 1.25.10.10
af_I1MBJ2_46_141_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3059 1 92 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A7D4TTJ8-F1-model_v4 DUF1648 domain-containing protein 0.9807 1 99 GO:0016020
AF-A0A1Q4FF71-F1-model_v4 Uncharacterized protein 0.9402 1 104 GO:0016020
AF-A0A1I5S601-F1-model_v4 DUF4328 domain-containing protein 0.9389 1 106 GO:0016020
AF-A0A1I5S601-F1-model_v4 DUF4328 domain-containing protein 0.9305 1 106 GO:0016020
AF-A0A7D4TTJ8-F1-model_v4 DUF1648 domain-containing protein 0.9167 1 99 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.6 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map