F333243

General Info

Members Datasets Scaffolds Average Seq Length
221 160 215 201

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10002819|Ga0075366_1000281910
Length 234
Sequence MQNQLQQTFGNIDIYLFDQLLKGRFDGCKTVLDAGCGGGRNLVYFLQNGFDVYGVDQSPAAIEAVKQLSATLAPANPLSNFAVSGVEDLPYADNTFELVICSAVLHFAKSIEHFDNMVNSLWRVLKPGGYFFARLASDIGIENLVKPVDNDNRFLLPDGSERFLVDEQILLRYGVALNGTLYEPIKTTNVQNLRCMTTWCLQKQQLNLLGDEFKSGTARVLRSQQVKQQKNIFT

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
148 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 0
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.38
Nodule 0
Rhizoplane 0.45
Rhizosphere 74.66
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020623 3300001989 Bacteria 2354
2 JGI24739J22299_10082146 3300001989 Bacteria 988
3 JGI25162J39368_1000203 3300002737 Bacteria 62704
4 rootH1_10066630 3300003316 Bacteria 4113
5 rootH2_10052210 3300003320 Bacteria 35441
6 rootH2_10259805 3300003320 Bacteria 2750
7 rootL2_10062895 3300003322 Bacteria 4055
8 rootH1_10007484 3300003323 Bacteria 19804
9 rootH1_10164146 3300003323 Bacteria 1205
10 Ga0055531_10000142 3300003794 Bacteria 82490
11 Ga0070690_100285632 3300005330 Bacteria 1178
12 Ga0068869_100033207 3300005334 Bacteria 3642
13 Ga0068869_100105116 3300005334 Bacteria 2141
14 Ga0068869_100158122 3300005334 Bacteria 1762
15 Ga0068869_101094362 3300005334 Bacteria 697
16 Ga0070666_10000907 3300005335 Bacteria 17995
17 Ga0070666_10022741 3300005335 Bacteria 4074
18 Ga0070660_100082527 3300005339 Bacteria 2524
19 Ga0070668_100027154 3300005347 Bacteria 4345
20 Ga0070668_100794125 3300005347 Bacteria 841
21 Ga0070669_100155338 3300005353 Bacteria 1774
22 Ga0070674_100002993 3300005356 Bacteria 9389
23 Ga0070659_100000352 3300005366 Bacteria 35096
24 Ga0070667_100061502 3300005367 Bacteria 3179
25 Ga0070708_100204665 3300005445 Bacteria 1849
26 Ga0070708_100836270 3300005445 Unclassified 865
27 Ga0070678_100113307 3300005456 Bacteria 2126
28 Ga0070662_100495794 3300005457 Bacteria 1018
29 Ga0068867_100025860 3300005459 Bacteria 4211
30 Ga0070679_100022925 3300005530 Bacteria 6106
31 Ga0068853_100345525 3300005539 Bacteria 1383
32 Ga0068853_100607975 3300005539 Bacteria 1038
33 Ga0070686_100216312 3300005544 Bacteria 1382
34 Ga0070686_100625114 3300005544 Bacteria 851
35 Ga0070665_100467508 3300005548 Bacteria 1271
36 Ga0068855_100074802 3300005563 Bacteria 3934
37 Ga0068856_100583282 3300005614 Bacteria 1139
38 Ga0068852_100075922 3300005616 Bacteria 2966
39 Ga0068859_100000131 3300005617 Bacteria 70847
40 Ga0068859_100343714 3300005617 Bacteria 1586
41 Ga0068864_100367282 3300005618 Bacteria 1361
42 Ga0068866_10113765 3300005718 Bacteria 1514
43 Ga0068861_100017831 3300005719 Bacteria 5046
44 Ga0068861_100398911 3300005719 Bacteria 1220
45 Ga0068851_10062127 3300005834 Bacteria 1916
46 Ga0068870_10017610 3300005840 Bacteria 3435
47 Ga0068863_100047082 3300005841 Bacteria 4092
48 Ga0068858_100047539 3300005842 Bacteria 3977
49 Ga0068858_100965265 3300005842 Bacteria 835
50 Ga0068860_100035491 3300005843 Bacteria 4782
51 Ga0068860_100349446 3300005843 Bacteria 1455
52 Ga0068862_100438525 3300005844 Bacteria 1229
53 Ga0075366_10001404 3300006195 Bacteria 12032
54 Ga0075366_10002819 3300006195 Bacteria 8996
55 Ga0097621_100199638 3300006237 Unclassified 1736
56 Ga0068871_100029225 3300006358 Bacteria 4327
57 Ga0068871_100197903 3300006358 Bacteria 1734
58 Ga0068865_100058254 3300006881 Bacteria 2697
59 Ga0097620_100000131 3300006931 Bacteria 70847
60 Ga0097620_100343724 3300006931 Bacteria 1586
61 Ga0105240_10002305 3300009093 Bacteria 30865
62 Ga0105240_10140793 3300009093 Bacteria 2884
63 Ga0105240_10170126 3300009093 Bacteria 2581
64 Ga0111539_10054065 3300009094 Bacteria 4778
65 Ga0105247_10002845 3300009101 Bacteria 11549
66 Ga0114129_10235690 3300009147 Bacteria 2462
67 Ga0105241_10006516 3300009174 Bacteria 8605
68 Ga0105241_10101691 3300009174 Bacteria 2286
69 Ga0105242_10030259 3300009176 Bacteria 4323
70 Ga0105242_10114923 3300009176 Unclassified 2300
71 Ga0105242_11155969 3300009176 Unclassified 791
72 Ga0105237_10007874 3300009545 Bacteria 11614
73 Ga0105237_10009412 3300009545 Bacteria 10465
74 Ga0105237_10047401 3300009545 Bacteria 4320
75 Ga0105237_10500773 3300009545 Bacteria 1221
76 Ga0105249_10075336 3300009553 Bacteria 3125
77 Ga0105239_10000016 3300010375 Bacteria 293142
78 Ga0105239_10010995 3300010375 Bacteria 10104
79 Ga0105239_10040367 3300010375 Bacteria 5113
80 Ga0105239_11803169 3300010375 Bacteria 709
81 Ga0105246_10275231 3300011119 Bacteria 1348
82 Ga0157374_10133107 3300013296 Unclassified 2407
83 Ga0157374_10331963 3300013296 Bacteria 1509
84 Ga0157374_10684570 3300013296 Bacteria 1038
85 Ga0157374_10892942 3300013296 Bacteria 906
86 Ga0157378_10028956 3300013297 Unclassified 4889
87 Ga0163162_10006493 3300013306 Bacteria 11324
88 Ga0163162_10138368 3300013306 Bacteria 2546
89 Ga0163162_10570608 3300013306 Bacteria 1259
90 Ga0157375_10544262 3300013308 Bacteria 1323
91 Ga0157375_10951708 3300013308 Bacteria 1000
92 Ga0163163_10106201 3300014325 Unclassified 2834
93 Ga0157379_10491191 3300014968 Bacteria 1137
94 Ga0157376_10198366 3300014969 Unclassified 1845
95 Ga0163161_10013471 3300017792 Bacteria 5692
96 Ga0209437_100102 3300025233 Bacteria 224216
97 Ga0209646_1000394 3300025246 Bacteria 26679
98 Ga0209026_1001887 3300025250 Bacteria 8525
99 Ga0209233_1012542 3300025261 Bacteria 2455
100 Ga0209233_1017391 3300025261 Bacteria 1960
101 Ga0209257_1000001 3300025304 Bacteria 2274655
102 Ga0207656_10042021 3300025321 Bacteria 1944
103 Ga0207642_10425253 3300025899 Bacteria 800
104 Ga0207710_10005009 3300025900 Bacteria 5737
105 Ga0207680_10000280 3300025903 Bacteria 24408
106 Ga0207680_10038431 3300025903 Bacteria 2770
107 Ga0207643_10229270 3300025908 Unclassified 1139
108 Ga0207705_10000530 3300025909 Bacteria 32308
109 Ga0207654_10016403 3300025911 Bacteria 3857
110 Ga0207654_10118058 3300025911 Bacteria 1661
111 Ga0207695_10138763 3300025913 Bacteria 2382
112 Ga0207695_10513357 3300025913 Unclassified 1080
113 Ga0207671_10000157 3300025914 Bacteria 105839
114 Ga0207671_10004487 3300025914 Bacteria 13301
115 Ga0207671_10004827 3300025914 Bacteria 12700
116 Ga0207671_10323645 3300025914 Bacteria 1220
117 Ga0207657_10068531 3300025919 Bacteria 3014
118 Ga0207650_10673961 3300025925 Unclassified 873
119 Ga0207659_10849440 3300025926 Unclassified 785
120 Ga0207690_10001013 3300025932 Bacteria 17954
121 Ga0207686_10282215 3300025934 Bacteria 1226
122 Ga0207704_10039507 3300025938 Bacteria 2748
123 Ga0207689_10014599 3300025942 Bacteria 6676
124 Ga0207689_10115210 3300025942 Bacteria 2209
125 Ga0207667_10021946 3300025949 Bacteria 7066
126 Ga0207712_10032484 3300025961 Bacteria 3524
127 Ga0207712_10077881 3300025961 Bacteria 2404
128 Ga0207668_10193535 3300025972 Bacteria 1614
129 Ga0207677_10023643 3300026023 Unclassified 3800
130 Ga0207677_10398715 3300026023 Bacteria 1166
131 Ga0207703_10015218 3300026035 Bacteria 6002
132 Ga0207703_10923523 3300026035 Bacteria 836
133 Ga0207641_10001783 3300026088 Bacteria 20719
134 Ga0207641_10503313 3300026088 Bacteria 1177
135 Ga0207648_10001960 3300026089 Bacteria 22497
136 Ga0207676_10645646 3300026095 Bacteria 1021
137 Ga0207683_10076421 3300026121 Bacteria 2965
138 Ga0207698_10055686 3300026142 Bacteria 3050
139 Ga0268266_10367528 3300028379 Bacteria 1354
140 Ga0268264_10003209 3300028381 Bacteria 14165
141 Ga0268264_10179246 3300028381 Bacteria 1923
142 Ga0307515_10009026 3300028794 Bacteria 19352
143 Ga0307515_10029144 3300028794 Bacteria 9347
144 Ga0265327_10131398 3300031251 Bacteria 1178
145 Ga0265327_10212221 3300031251 Bacteria 873
146 Ga0307513_10102889 3300031456 Bacteria 2874
147 Ga0307513_10210997 3300031456 Bacteria 1773
148 Ga0307509_10237157 3300031507 Bacteria 1620
149 Ga0265314_10014542 3300031711 Bacteria 6291
150 Ga0307516_10412509 3300031730 Bacteria 1009
151 Ga0307507_10000152 3300033179 Bacteria 122095
152 Ga0373937_0115109 3300036401 Bacteria 2504
153 Ga0373937_0362499 3300036401 Bacteria 1374
154 Ga0395899_0000001 3300037312 Bacteria 1750322
155 Ga0439436_0007120 3300041404 Unclassified 3444
156 Ga0439439_0076287 3300041406 Bacteria 902
157 Ga0451843_1561897 3300041509 Bacteria 697
158 Ga0451853_1003486 3300041512 Unclassified 2915
159 Ga0439449_0037954 3300042007 Bacteria 1792
160 Ga0439457_001623 3300042014 Bacteria 6710
161 Ga0439462_0029275 3300042015 Bacteria 1457
162 Ga0495651_0100249 3300046462 Bacteria 2158
163 Ga0495580_0261056 3300046472 Unclassified 1185
164 Ga0495606_0000021 3300046507 Bacteria 271238
165 Ga0495606_0005612 3300046507 Bacteria 11927
166 Ga0495610_0000349 3300046512 Bacteria 48625
167 Ga0495628_0270963 3300046516 Bacteria 1263
168 Ga0495630_0681152 3300046517 Bacteria 787
169 Ga0495632_0042990 3300046519 Bacteria 2262
170 Ga0495644_0021781 3300046523 Bacteria 2443
171 Ga0495648_0052442 3300046524 Bacteria 2477
172 Ga0495654_0165611 3300046530 Bacteria 967
173 Ga0495640_0307426 3300046533 Bacteria 984
174 Ga0495609_0006812 3300046538 Bacteria 5779
175 Ga0495633_0000172 3300046558 Bacteria 84811
176 Ga0495633_0024971 3300046558 Bacteria 2948
177 Ga0495668_0000207 3300046616 Bacteria 85136
178 Ga0495625_0002448 3300046660 Bacteria 20056
179 Ga0495625_0005961 3300046660 Bacteria 10956
180 Ga0495661_0106350 3300046665 Bacteria 1570
181 Ga0495623_0099741 3300046679 Bacteria 1771
182 Ga0495658_0307615 3300046683 Bacteria 1003
183 Ga0495670_0109726 3300046691 Bacteria 1427
184 Ga0495600_0389834 3300046809 Bacteria 868
185 Ga0495660_0006983 3300046810 Bacteria 6655
186 Ga0495683_0076248 3300047323 Bacteria 1641
187 Ga0496126_0511085 3300048929 Bacteria 959
188 Ga0495682_0056140 3300049460 Bacteria 1428
189 nmdc:mga0k408_16040_c2 3300050493 Bacteria 3431
190 nmdc:mga0k408_17780_c1 3300050493 Bacteria 3962
191 nmdc:mga0k408_197910_c1 3300050493 Bacteria 1199
192 nmdc:mga05p37_533496_c1 3300050507 Unclassified 1340
193 Ga0500578_0000012 3300053086 Bacteria 188658
194 Ga0500644_0000581 3300053088 Bacteria 13992
195 Ga0500646_0002900 3300053090 Bacteria 4397
196 Ga0500583_0000155 3300053092 Bacteria 28507
197 Ga0500583_0001125 3300053092 Bacteria 7635
198 Ga0500583_0026174 3300053092 Bacteria 2501
199 Ga0500651_0242299 3300053093 Bacteria 1051
200 Ga0500569_002437 3300053109 Bacteria 3664
201 Ga0500607_034459 3300053121 Bacteria 2772
202 Ga0500618_000057 3300053125 Bacteria 98383
203 Ga0500642_0095779 3300053130 Bacteria 1376
204 Ga0500652_003116 3300053131 Bacteria 4999
205 Ga0500655_051218 3300053133 Bacteria 823
206 Ga0500658_0017549 3300053134 Bacteria 2674
207 Ga0500573_0080068 3300053140 Bacteria 1857
208 Ga0500577_0000553 3300053142 Bacteria 9657
209 Ga0500588_0097926 3300053146 Unclassified 1007
210 Ga0500616_0007380 3300053153 Bacteria 7000
211 Ga0500622_0000473 3300053156 Bacteria 37893
212 Ga0500622_0029284 3300053156 Bacteria 2896
213 Ga0500622_0070287 3300053156 Unclassified 1771
214 Ga0500633_0127312 3300053160 Bacteria 949
215 Ga0500636_0086540 3300053177 Bacteria 1800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10198366 Ga0157376_101983662 170
2 3300048929 Ga0496126_0511085 Ga0496126_0511085_378_899 173
3 3300053130 Ga0500642_0095779 Ga0500642_0095779_310_936 176
4 3300031507 Ga0307509_10237157 Ga0307509_102371572 177
5 3300005445 Ga0070708_100836270 Ga0070708_1008362701 178
6 3300009147 Ga0114129_10235690 Ga0114129_102356902 178
7 3300031456 Ga0307513_10102889 Ga0307513_101028893 178
8 3300031456 Ga0307513_10210997 Ga0307513_102109972 178
9 3300050493 nmdc:mga0k408_197910_c1 nmdc:mga0k408_197910_c1_345_1046 178
10 3300050507 nmdc:mga05p37_533496_c1 nmdc:mga05p37_533496_c1_476_1090 178
11 3300046517 Ga0495630_0681152 Ga0495630_0681152_16_660 179
12 3300046533 Ga0495640_0307426 Ga0495640_0307426_320_964 179
13 3300053086 Ga0500578_0000012 Ga0500578_0000012_128398_129009 179
14 3300053092 Ga0500583_0000155 Ga0500583_0000155_18803_19417 179
15 3300053146 Ga0500588_0097926 Ga0500588_0097926_270_878 179
16 3300053156 Ga0500622_0029284 Ga0500622_0029284_210_818 179
17 3300053177 Ga0500636_0086540 Ga0500636_0086540_733_1353 179
18 3300009176 Ga0105242_11155969 Ga0105242_111559691 180
19 3300046523 Ga0495644_0021781 Ga0495644_0021781_1375_1983 180
20 3300053092 Ga0500583_0001125 Ga0500583_0001125_6481_7089 180
21 3300053131 Ga0500652_003116 Ga0500652_003116_3819_4427 180
22 3300003322 rootL2_10062895 rootL2_100628954 181
23 3300003323 rootH1_10007484 rootH1_100074848 181
24 3300003323 rootH1_10164146 rootH1_101641462 181
25 3300025246 Ga0209646_1000394 Ga0209646_100039412 181
26 3300053140 Ga0500573_0080068 Ga0500573_0080068_1149_1757 181
27 3300005539 Ga0068853_100345525 Ga0068853_1003455252 182
28 3300042007 Ga0439449_0037954 Ga0439449_0037954_60_668 182
29 3300053156 Ga0500622_0070287 Ga0500622_0070287_354_962 182
30 3300009094 Ga0111539_10054065 Ga0111539_100540652 183
31 3300036401 Ga0373937_0362499 Ga0373937_0362499_807_1358 183
32 3300046679 Ga0495623_0099741 Ga0495623_0099741_72_752 184
33 3300041509 Ga0451843_1561897 Ga0451843_1561897_14_679 188
34 3300041512 Ga0451853_1003486 Ga0451853_1003486_932_1675 189
35 3300005544 Ga0070686_100625114 Ga0070686_1006251141 192
36 3300013296 Ga0157374_10331963 Ga0157374_103319632 192
37 3300031251 Ga0265327_10212221 Ga0265327_102122211 192
38 3300046512 Ga0495610_0000349 Ga0495610_0000349_38762_39376 196
39 3300046519 Ga0495632_0042990 Ga0495632_0042990_1586_2200 196
40 3300046558 Ga0495633_0024971 Ga0495633_0024971_2073_2687 196
41 3300046665 Ga0495661_0106350 Ga0495661_0106350_72_686 196
42 3300047323 Ga0495683_0076248 Ga0495683_0076248_866_1480 196
43 iso_pu_bacteria 2738541278 2738728059 198
44 iso_pu_bacteria 2919437846 2919440236 198
45 iso_pu_bacteria 2599185184 2599481778 200
46 iso_pu_bacteria 2928078545 2928082060 200
47 iso_pu_bacteria 2928147474 2928152078 200
48 iso_pu_bacteria 2932082852 2932088095 200
49 3300003316 rootH1_10066630 rootH1_100666301 202
50 3300003320 rootH2_10052210 rootH2_1005221036 202
51 3300005334 Ga0068869_100158122 Ga0068869_1001581222 202
52 3300005335 Ga0070666_10000907 Ga0070666_1000090715 202
53 3300005347 Ga0070668_100794125 Ga0070668_1007941251 202
54 3300005367 Ga0070667_100061502 Ga0070667_1000615024 202
55 3300005616 Ga0068852_100075922 Ga0068852_1000759222 202
56 3300005617 Ga0068859_100000131 Ga0068859_10000013156 202
57 3300005834 Ga0068851_10062127 Ga0068851_100621272 202
58 3300005841 Ga0068863_100047082 Ga0068863_1000470824 202
59 3300005842 Ga0068858_100047539 Ga0068858_1000475392 202
60 3300005843 Ga0068860_100035491 Ga0068860_1000354914 202
61 3300006358 Ga0068871_100197903 Ga0068871_1001979032 202
62 3300006931 Ga0097620_100000131 Ga0097620_10000013119 202
63 3300009093 Ga0105240_10002305 Ga0105240_1000230526 202
64 3300009093 Ga0105240_10140793 Ga0105240_101407932 202
65 3300009101 Ga0105247_10002845 Ga0105247_100028453 202
66 3300009174 Ga0105241_10006516 Ga0105241_100065167 202
67 3300009176 Ga0105242_10114923 Ga0105242_101149231 202
68 3300009545 Ga0105237_10007874 Ga0105237_100078743 202
69 3300010375 Ga0105239_10000016 Ga0105239_10000016131 202
70 3300010375 Ga0105239_11803169 Ga0105239_118031691 202
71 3300013296 Ga0157374_10133107 Ga0157374_101331072 202
72 3300013306 Ga0163162_10138368 Ga0163162_101383684 202
73 3300013308 Ga0157375_10544262 Ga0157375_105442622 202
74 3300014325 Ga0163163_10106201 Ga0163163_101062014 202
75 3300014968 Ga0157379_10491191 Ga0157379_104911912 202
76 3300025250 Ga0209026_1001887 Ga0209026_10018875 202
77 3300025261 Ga0209233_1012542 Ga0209233_10125422 202
78 3300025321 Ga0207656_10042021 Ga0207656_100420212 202
79 3300025900 Ga0207710_10005009 Ga0207710_100050093 202
80 3300025903 Ga0207680_10000280 Ga0207680_100002808 202
81 3300025909 Ga0207705_10000530 Ga0207705_1000053017 202
82 3300025911 Ga0207654_10016403 Ga0207654_100164032 202
83 3300025913 Ga0207695_10513357 Ga0207695_105133572 202
84 3300025914 Ga0207671_10000157 Ga0207671_1000015724 202
85 3300025934 Ga0207686_10282215 Ga0207686_102822151 202
86 3300025942 Ga0207689_10014599 Ga0207689_100145998 202
87 3300025961 Ga0207712_10032484 Ga0207712_100324842 202
88 3300025972 Ga0207668_10193535 Ga0207668_101935352 202
89 3300026023 Ga0207677_10023643 Ga0207677_100236433 202
90 3300026035 Ga0207703_10015218 Ga0207703_100152183 202
91 3300026088 Ga0207641_10001783 Ga0207641_1000178318 202
92 3300026142 Ga0207698_10055686 Ga0207698_100556864 202
93 3300028381 Ga0268264_10003209 Ga0268264_100032095 202
94 3300031711 Ga0265314_10014542 Ga0265314_100145424 202
95 3300036401 Ga0373937_0115109 Ga0373937_0115109_486_1136 202
96 3300041404 Ga0439436_0007120 Ga0439436_0007120_461_1069 202
97 3300041406 Ga0439439_0076287 Ga0439439_0076287_196_804 202
98 3300042014 Ga0439457_001623 Ga0439457_001623_4639_5247 202
99 3300042015 Ga0439462_0029275 Ga0439462_0029275_231_839 202
100 3300046472 Ga0495580_0261056 Ga0495580_0261056_75_683 202
101 3300002737 JGI25162J39368_1000203 JGI25162J39368_10002037 203
102 3300003320 rootH2_10259805 rootH2_102598053 203
103 3300003794 Ga0055531_10000142 Ga0055531_1000014257 203
104 3300005330 Ga0070690_100285632 Ga0070690_1002856322 203
105 3300005334 Ga0068869_100033207 Ga0068869_1000332072 203
106 3300005334 Ga0068869_101094362 Ga0068869_1010943621 203
107 3300005335 Ga0070666_10022741 Ga0070666_100227412 203
108 3300005339 Ga0070660_100082527 Ga0070660_1000825272 203
109 3300005347 Ga0070668_100027154 Ga0070668_1000271544 203
110 3300005353 Ga0070669_100155338 Ga0070669_1001553382 203
111 3300005356 Ga0070674_100002993 Ga0070674_1000029938 203
112 3300005366 Ga0070659_100000352 Ga0070659_1000003526 203
113 3300005456 Ga0070678_100113307 Ga0070678_1001133072 203
114 3300005457 Ga0070662_100495794 Ga0070662_1004957942 203
115 3300005459 Ga0068867_100025860 Ga0068867_1000258602 203
116 3300005530 Ga0070679_100022925 Ga0070679_1000229254 203
117 3300005539 Ga0068853_100607975 Ga0068853_1006079751 203
118 3300005544 Ga0070686_100216312 Ga0070686_1002163122 203
119 3300005548 Ga0070665_100467508 Ga0070665_1004675082 203
120 3300005563 Ga0068855_100074802 Ga0068855_1000748024 203
121 3300005614 Ga0068856_100583282 Ga0068856_1005832821 203
122 3300005617 Ga0068859_100343714 Ga0068859_1003437142 203
123 3300005718 Ga0068866_10113765 Ga0068866_101137651 203
124 3300005719 Ga0068861_100017831 Ga0068861_1000178312 203
125 3300005840 Ga0068870_10017610 Ga0068870_100176102 203
126 3300005842 Ga0068858_100965265 Ga0068858_1009652651 203
127 3300005844 Ga0068862_100438525 Ga0068862_1004385252 203
128 3300006195 Ga0075366_10001404 Ga0075366_100014042 203
129 3300006195 Ga0075366_10002819 Ga0075366_1000281910 203
130 3300006237 Ga0097621_100199638 Ga0097621_1001996381 203
131 3300006358 Ga0068871_100029225 Ga0068871_1000292252 203
132 3300006881 Ga0068865_100058254 Ga0068865_1000582543 203
133 3300006931 Ga0097620_100343724 Ga0097620_1003437242 203
134 3300009093 Ga0105240_10170126 Ga0105240_101701262 203
135 3300009176 Ga0105242_10030259 Ga0105242_100302591 203
136 3300009545 Ga0105237_10009412 Ga0105237_1000941211 203
137 3300009545 Ga0105237_10047401 Ga0105237_100474013 203
138 3300009545 Ga0105237_10500773 Ga0105237_105007732 203
139 3300009553 Ga0105249_10075336 Ga0105249_100753362 203
140 3300010375 Ga0105239_10010995 Ga0105239_100109953 203
141 3300010375 Ga0105239_10040367 Ga0105239_100403673 203
142 3300011119 Ga0105246_10275231 Ga0105246_102752312 203
143 3300013296 Ga0157374_10684570 Ga0157374_106845702 203
144 3300013296 Ga0157374_10892942 Ga0157374_108929421 203
145 3300013297 Ga0157378_10028956 Ga0157378_100289564 203
146 3300013306 Ga0163162_10006493 Ga0163162_100064939 203
147 3300013306 Ga0163162_10570608 Ga0163162_105706082 203
148 3300013308 Ga0157375_10951708 Ga0157375_109517081 203
149 3300017792 Ga0163161_10013471 Ga0163161_100134712 203
150 3300025233 Ga0209437_100102 Ga0209437_10010256 203
151 3300025261 Ga0209233_1017391 Ga0209233_10173912 203
152 3300025304 Ga0209257_1000001 Ga0209257_1000001729 203
153 3300025899 Ga0207642_10425253 Ga0207642_104252531 203
154 3300025903 Ga0207680_10038431 Ga0207680_100384312 203
155 3300025908 Ga0207643_10229270 Ga0207643_102292702 203
156 3300025913 Ga0207695_10138763 Ga0207695_101387632 203
157 3300025914 Ga0207671_10004487 Ga0207671_100044876 203
158 3300025914 Ga0207671_10004827 Ga0207671_100048271 203
159 3300025914 Ga0207671_10323645 Ga0207671_103236451 203
160 3300025919 Ga0207657_10068531 Ga0207657_100685312 203
161 3300025925 Ga0207650_10673961 Ga0207650_106739611 203
162 3300025926 Ga0207659_10849440 Ga0207659_108494401 203
163 3300025932 Ga0207690_10001013 Ga0207690_1000101313 203
164 3300025938 Ga0207704_10039507 Ga0207704_100395072 203
165 3300025949 Ga0207667_10021946 Ga0207667_100219469 203
166 3300025961 Ga0207712_10077881 Ga0207712_100778811 203
167 3300026023 Ga0207677_10398715 Ga0207677_103987152 203
168 3300026035 Ga0207703_10923523 Ga0207703_109235231 203
169 3300026089 Ga0207648_10001960 Ga0207648_1000196010 203
170 3300026121 Ga0207683_10076421 Ga0207683_100764212 203
171 3300028379 Ga0268266_10367528 Ga0268266_103675282 203
172 3300028794 Ga0307515_10009026 Ga0307515_100090268 203
173 3300028794 Ga0307515_10029144 Ga0307515_100291448 203
174 3300031251 Ga0265327_10131398 Ga0265327_101313982 203
175 3300031730 Ga0307516_10412509 Ga0307516_104125092 203
176 3300033179 Ga0307507_10000152 Ga0307507_1000015292 203
177 3300037312 Ga0395899_0000001 Ga0395899_0000001_1705821_1706441 203
178 3300046462 Ga0495651_0100249 Ga0495651_0100249_937_1551 203
179 3300046507 Ga0495606_0005612 Ga0495606_0005612_77_688 203
180 3300046516 Ga0495628_0270963 Ga0495628_0270963_160_774 203
181 3300046524 Ga0495648_0052442 Ga0495648_0052442_1816_2430 203
182 3300046530 Ga0495654_0165611 Ga0495654_0165611_292_906 203
183 3300046538 Ga0495609_0006812 Ga0495609_0006812_1685_2299 203
184 3300046558 Ga0495633_0000172 Ga0495633_0000172_76699_77313 203
185 3300046616 Ga0495668_0000207 Ga0495668_0000207_37588_38202 203
186 3300046660 Ga0495625_0002448 Ga0495625_0002448_18478_19092 203
187 3300046660 Ga0495625_0005961 Ga0495625_0005961_2519_3133 203
188 3300046683 Ga0495658_0307615 Ga0495658_0307615_138_752 203
189 3300046691 Ga0495670_0109726 Ga0495670_0109726_432_1046 203
190 3300046809 Ga0495600_0389834 Ga0495600_0389834_184_798 203
191 3300046810 Ga0495660_0006983 Ga0495660_0006983_4433_5044 203
192 3300049460 Ga0495682_0056140 Ga0495682_0056140_463_1077 203
193 3300050493 nmdc:mga0k408_16040_c2 nmdc:mga0k408_16040_c2_459_1100 203
194 3300050493 nmdc:mga0k408_17780_c1 nmdc:mga0k408_17780_c1_315_1019 203
195 3300053088 Ga0500644_0000581 Ga0500644_0000581_3691_4302 203
196 3300053090 Ga0500646_0002900 Ga0500646_0002900_879_1490 203
197 3300053092 Ga0500583_0026174 Ga0500583_0026174_518_1129 203
198 3300053093 Ga0500651_0242299 Ga0500651_0242299_47_658 203
199 3300053109 Ga0500569_002437 Ga0500569_002437_1013_1624 203
200 3300053121 Ga0500607_034459 Ga0500607_034459_841_1452 203
201 3300053125 Ga0500618_000057 Ga0500618_000057_49982_50593 203
202 3300053133 Ga0500655_051218 Ga0500655_051218_36_647 203
203 3300053134 Ga0500658_0017549 Ga0500658_0017549_1073_1684 203
204 3300053142 Ga0500577_0000553 Ga0500577_0000553_5406_6017 203
205 3300053153 Ga0500616_0007380 Ga0500616_0007380_5869_6480 203
206 3300053156 Ga0500622_0000473 Ga0500622_0000473_29166_29777 203
207 3300053160 Ga0500633_0127312 Ga0500633_0127312_207_818 203
208 3300001989 JGI24739J22299_10020623 JGI24739J22299_100206234 204
209 3300001989 JGI24739J22299_10082146 JGI24739J22299_100821462 204
210 3300005334 Ga0068869_100105116 Ga0068869_1001051162 204
211 3300005445 Ga0070708_100204665 Ga0070708_1002046652 204
212 3300005618 Ga0068864_100367282 Ga0068864_1003672822 204
213 3300005719 Ga0068861_100398911 Ga0068861_1003989112 204
214 3300005843 Ga0068860_100349446 Ga0068860_1003494462 204
215 3300009174 Ga0105241_10101691 Ga0105241_101016912 204
216 3300025911 Ga0207654_10118058 Ga0207654_101180583 204
217 3300025942 Ga0207689_10115210 Ga0207689_101152102 204
218 3300026088 Ga0207641_10503313 Ga0207641_105033132 204
219 3300026095 Ga0207676_10645646 Ga0207676_106456462 204
220 3300028381 Ga0268264_10179246 Ga0268264_101792462 204
221 3300046507 Ga0495606_0000021 Ga0495606_0000021_253762_254376 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

32

133

0.95

PF13649

Methyltransf_25

Methyltransferase domain

31

129

0.92

PF08242

Methyltransf_12

Methyltransferase domain

32

131

0.86

PF13847

Methyltransf_31

Methyltransferase domain

25

212

0.85

PF13489

Methyltransf_23

Methyltransferase domain

14

159

0.83

PF03848

TehB

Tellurite resistance protein TehB

24

154

0.81

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

18

168

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqc-assembly1.cif.gz_A-2 cyclopropane fatty acid synthase from e. coli 0.8786 30 138
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8178 18 204
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8165 30 145
5doo-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi 0.8055 30 145
2lqj-assembly1.cif.gz_A solution structure of the c-terminal domain of the mgtc protein from mycobacterium tuberculosis 0.8035 170 203
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9051 30 134 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8892 30 130 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8625 30 73 3.40.50.150
af_Q18489_32_205_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.859 30 152 3.40.50.150
af_Q50584_122_315_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8477 29 132 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q5ZVI4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9961 6 204 GO:0008757
GO:0032259
AF-A0A1G8NSV8-F1-model_v4 Methyltransferase domain-containing protein 0.9926 56 204 GO:0008757
GO:0032259
AF-A0A7L5AEZ1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9899 31 204 GO:0010420
GO:0032259
AF-A0A4Q3B7I0-F1-model_v4 Class I SAM-dependent methyltransferase 0.988 80 204 GO:0008757
GO:0032259
AF-A0A843SVV1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9879 98 204 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map