F333148

General Info

Members Datasets Scaffolds Average Seq Length
221 140 442 99

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_101218333|Ga0070679_1012183331
Length 111
Sequence MAYIVPSLRETLEDRELYTRSRLADVVCRQCHARVMVRKNSEHHTSIQWTREAVETCAVFSDLDQREDGRPVHSGCPQLAASIEYAVSEGMVTVGNGVDPVGLDQGDHDHE

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
70 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
71 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
75 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 2643221561 Nocardioides sp. Root151 Isolate Unclassified
137 2643221696 Nocardioides sp. Root140 Isolate Unclassified
138 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
139 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
140 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.13
Nodule 0
Rhizoplane 6.33
Rhizosphere 56.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_101218333 3300005530 Bacteria 698
2 rootH1_10103988 3300003323 Bacteria 1137
3 JGI25405J52794_10130390 3300003911 Bacteria 569
4 Ga0070658_11333609 3300005327 Bacteria 623
5 Ga0070670_100675016 3300005331 Bacteria 928
6 Ga0070660_101620005 3300005339 Bacteria 551
7 Ga0070660_101679848 3300005339 Bacteria 541
8 Ga0070660_101703193 3300005339 Bacteria 537
9 Ga0070675_100669855 3300005354 Bacteria 944
10 Ga0070675_100926535 3300005354 Bacteria 799
11 Ga0070674_101669188 3300005356 Bacteria 576
12 Ga0070673_100502318 3300005364 Bacteria 1097
13 Ga0070688_100512500 3300005365 Bacteria 906
14 Ga0070708_100742964 3300005445 Bacteria 923
15 Ga0070707_100053500 3300005468 Bacteria 3871
16 Ga0070698_100036757 3300005471 Bacteria 5054
17 Ga0070699_101598950 3300005518 Bacteria 597
18 Ga0070672_100842955 3300005543 Bacteria 808
19 Ga0070702_101636572 3300005615 Bacteria 534
20 Ga0068852_102098910 3300005616 Bacteria 587
21 Ga0068864_101060046 3300005618 Bacteria 806
22 Ga0081455_10000174 3300005937 Bacteria 80174
23 Ga0075365_10002755 3300006038 Bacteria 8777
24 Ga0075365_10120129 3300006038 Bacteria 1812
25 Ga0075365_10124963 3300006038 Bacteria 1777
26 Ga0075365_10138651 3300006038 Bacteria 1687
27 Ga0075365_10193594 3300006038 Bacteria 1423
28 Ga0075365_10200050 3300006038 Bacteria 1399
29 Ga0075365_10247811 3300006038 Bacteria 1251
30 Ga0075365_10340120 3300006038 Bacteria 1057
31 Ga0075365_10340814 3300006038 Bacteria 1056
32 Ga0075365_10865249 3300006038 Bacteria 637
33 Ga0075365_10895972 3300006038 Bacteria 625
34 Ga0075365_11047904 3300006038 Bacteria 574
35 Ga0075365_11248186 3300006038 Bacteria 522
36 Ga0075368_10052375 3300006042 Bacteria 1624
37 Ga0075368_10188080 3300006042 Bacteria 871
38 Ga0075363_100007636 3300006048 Bacteria 4986
39 Ga0075363_100046042 3300006048 Bacteria 2313
40 Ga0075363_100227294 3300006048 Bacteria 1070
41 Ga0075363_100243441 3300006048 Bacteria 1034
42 Ga0075363_100788138 3300006048 Bacteria 577
43 Ga0075363_101065739 3300006048 Bacteria 500
44 Ga0075364_10089086 3300006051 Bacteria 2046
45 Ga0075364_10127874 3300006051 Bacteria 1704
46 Ga0075364_10342739 3300006051 Bacteria 1018
47 Ga0075362_10087654 3300006177 Bacteria 1441
48 Ga0075362_10287778 3300006177 Bacteria 814
49 Ga0075367_10355016 3300006178 Bacteria 925
50 Ga0075367_10820766 3300006178 Bacteria 592
51 Ga0075367_10828135 3300006178 Bacteria 590
52 Ga0075370_10072786 3300006353 Bacteria 1967
53 Ga0075370_10084924 3300006353 Bacteria 1822
54 Ga0075370_10135572 3300006353 Bacteria 1438
55 Ga0105240_12665664 3300009093 Bacteria 516
56 Ga0105245_10246674 3300009098 Bacteria 1733
57 Ga0105247_11563849 3300009101 Bacteria 540
58 Ga0105243_10295694 3300009148 Bacteria 1465
59 Ga0105242_10904496 3300009176 Bacteria 883
60 Ga0105248_10880967 3300009177 Bacteria 1011
61 Ga0105238_10505848 3300009551 Bacteria 1209
62 Ga0105249_11518350 3300009553 Bacteria 742
63 Ga0105246_10299904 3300011119 Bacteria 1297
64 Ga0157371_11084963 3300013102 Bacteria 613
65 Ga0157369_10532071 3300013105 Bacteria 1215
66 Ga0157374_11354715 3300013296 Bacteria 734
67 Ga0157374_11693799 3300013296 Bacteria 657
68 Ga0157372_11422493 3300013307 Bacteria 799
69 Ga0157375_10277911 3300013308 Bacteria 1837
70 Ga0157375_12334427 3300013308 Bacteria 638
71 Ga0157380_10420017 3300014326 Bacteria 1275
72 Ga0157380_11376289 3300014326 Bacteria 755
73 Ga0157377_10290577 3300014745 Bacteria 1075
74 Ga0157376_10615569 3300014969 Bacteria 1082
75 Ga0182006_1210608 3300015261 Bacteria 642
76 Ga0163161_10113073 3300017792 Bacteria 2032
77 Ga0213875_10162420 3300021388 Bacteria 1048
78 Ga0207657_10932145 3300025919 Bacteria 668
79 Ga0207646_10437047 3300025922 Bacteria 1181
80 Ga0207644_11786495 3300025931 Bacteria 515
81 Ga0207706_10621476 3300025933 Bacteria 927
82 Ga0207709_10683189 3300025935 Bacteria 820
83 Ga0207691_10561831 3300025940 Bacteria 967
84 Ga0207661_10744330 3300025944 Bacteria 902
85 Ga0207639_10796177 3300026041 Bacteria 881
86 Ga0207678_10442605 3300026067 Bacteria 1129
87 Ga0207708_10670824 3300026075 Bacteria 884
88 Ga0207708_11199853 3300026075 Bacteria 663
89 Ga0207698_11818129 3300026142 Bacteria 624
90 Ga0207698_11924614 3300026142 Bacteria 606
91 Ga0209813_10007244 3300027866 Bacteria 2759
92 Ga0209813_10066053 3300027866 Bacteria 1166
93 Ga0307405_12047018 3300031731 Bacteria 513
94 Ga0307412_10076033 3300031911 Bacteria 2306
95 Ga0307409_100131353 3300031995 Bacteria 2141
96 Ga0307416_101496124 3300032002 Bacteria 781
97 Ga0307411_10568744 3300032005 Bacteria 970
98 Ga0307411_10656058 3300032005 Bacteria 909
99 Ga0307411_10795531 3300032005 Bacteria 832
100 Ga0307415_100103507 3300032126 Bacteria 2095
101 Ga0395900_1343906 3300037418 Bacteria 628
102 Ga0395905_0068315 3300037471 Bacteria 3329
103 Ga0395905_0457985 3300037471 Bacteria 1174
104 Ga0436364_0248667 3300037853 Bacteria 2083
105 Ga0436365_0592195 3300039437 Bacteria 908
106 Ga0451791_0149259 3300041451 Bacteria 851
107 Ga0451793_0116409 3300041452 Bacteria 535
108 Ga0451793_1036904 3300041452 Bacteria 626
109 Ga0451806_651429 3300041462 Bacteria 588
110 Ga0451843_0271827 3300041509 Bacteria 532
111 Ga0451853_3119728 3300041512 Bacteria 756
112 Ga0450906_021311 3300042145 Bacteria 1159
113 Ga0439446_0185709 3300042156 Bacteria 697
114 Ga0466972_0080824 3300044658 Bacteria 1548
115 Ga0466965_0239801 3300044683 Bacteria 970
116 Ga0466966_0787735 3300044684 Bacteria 573
117 Ga0466961_0097962 3300044693 Bacteria 1849
118 Ga0466963_1301089 3300044694 Bacteria 510
119 Ga0466970_0008490 3300044765 Bacteria 5171
120 Ga0466970_0186060 3300044765 Bacteria 1153
121 Ga0466960_0075866 3300044901 Bacteria 1683
122 Ga0466960_0330328 3300044901 Bacteria 865
123 Ga0466958_0458746 3300045836 Bacteria 825
124 Ga0466967_0369119 3300045976 Bacteria 1392
125 Ga0495664_0248054 3300046477 Bacteria 1077
126 Ga0495635_0397396 3300046663 Bacteria 916
127 Ga0496100_0093642 3300048903 Bacteria 2056
128 Ga0496102_1384193 3300048905 Bacteria 622
129 Ga0496106_0402748 3300048909 Bacteria 1100
130 Ga0496108_0067140 3300048911 Bacteria 3025
131 Ga0496108_0103622 3300048911 Bacteria 2428
132 Ga0496109_0319267 3300048912 Bacteria 1466
133 Ga0496110_0149931 3300048913 Bacteria 2111
134 Ga0496110_0218245 3300048913 Bacteria 1734
135 Ga0496114_0073016 3300048917 Bacteria 2887
136 Ga0496114_1299693 3300048917 Bacteria 614
137 Ga0496124_0342597 3300048927 Bacteria 1061
138 Ga0501031_0056764 3300049568 Bacteria 2551
139 Ga0501031_0992661 3300049568 Bacteria 537
140 Ga0501032_0023023 3300049569 Bacteria 4312
141 Ga0501033_0035407 3300049570 Bacteria 3743
142 Ga0501033_0611372 3300049570 Bacteria 747
143 Ga0501034_0180156 3300049571 Bacteria 2078
144 Ga0501036_0049794 3300049572 Bacteria 3548
145 Ga0501037_0007753 3300049573 Bacteria 7858
146 Ga0501038_0030366 3300049574 Bacteria 4783
147 Ga0501039_0203096 3300049575 Bacteria 1558
148 Ga0501041_1077309 3300049577 Bacteria 518
149 Ga0501042_0024527 3300049578 Bacteria 4231
150 Ga0501042_1364378 3300049578 Bacteria 517
151 Ga0501043_0020327 3300049579 Bacteria 5208
152 Ga0501046_0002768 3300049580 Bacteria 16327
153 Ga0501047_0337639 3300049581 Bacteria 1344
154 Ga0501048_0004409 3300049582 Bacteria 10718
155 Ga0501048_0223206 3300049582 Bacteria 1337
156 Ga0501068_0590002 3300049584 Bacteria 724
157 Ga0501069_0290363 3300049585 Bacteria 958
158 Ga0501070_0058347 3300049586 Bacteria 3199
159 Ga0501070_0355598 3300049586 Bacteria 1188
160 Ga0501071_0367945 3300049587 Bacteria 1095
161 Ga0501073_0472979 3300049589 Bacteria 866
162 Ga0501074_0158527 3300049590 Bacteria 1616
163 Ga0501074_0414565 3300049590 Bacteria 955
164 Ga0501075_0401204 3300049591 Bacteria 1045
165 Ga0501076_0509136 3300049592 Bacteria 992
166 Ga0501077_0149776 3300049593 Bacteria 1481
167 Ga0501079_0463720 3300049741 Bacteria 995
168 Ga0501080_0136167 3300049742 Bacteria 2273
169 Ga0501080_0439587 3300049742 Bacteria 1170
170 Ga0501080_1071206 3300049742 Bacteria 697
171 Ga0501083_0245023 3300049744 Bacteria 1167
172 Ga0501044_0682735 3300049823 Bacteria 913
173 Ga0501045_0164799 3300049824 Bacteria 1651
174 Ga0501045_0651231 3300049824 Bacteria 779
175 nmdc:mga03n38_162676_c1 3300050490 Bacteria 1131
176 nmdc:mga03n38_384613_c1 3300050490 Bacteria 770
177 nmdc:mga03n38_561425_c1 3300050490 Bacteria 647
178 nmdc:mga03n38_79087_c1 3300050490 Bacteria 1541
179 nmdc:mga00v17_192894_c1 3300050491 Bacteria 1316
180 nmdc:mga00v17_492918_c1 3300050491 Bacteria 794
181 nmdc:mga00v17_791921_c1 3300050491 Bacteria 604
182 nmdc:mga00v17_89569_c1 3300050491 Bacteria 1931
183 nmdc:mga00v17_98481_c1 3300050491 Bacteria 1844
184 nmdc:mga0yw44_1000607_c1 3300050492 Bacteria 566
185 nmdc:mga0yw44_1004284_c1 3300050492 Bacteria 565
186 nmdc:mga0yw44_130807_c1 3300050492 Bacteria 1625
187 nmdc:mga0yw44_188440_c1 3300050492 Bacteria 1360
188 nmdc:mga0yw44_22179_c1 3300050492 Bacteria 3556
189 nmdc:mga0yw44_22184_c1 3300050492 Bacteria 3556
190 nmdc:mga0yw44_228136_c1 3300050492 Bacteria 1236
191 nmdc:mga0yw44_230735_c1 3300050492 Bacteria 1229
192 nmdc:mga0yw44_256719_c1 3300050492 Bacteria 1164
193 nmdc:mga0yw44_30416_c1 3300050492 Bacteria 3129
194 nmdc:mga0yw44_379079_c1 3300050492 Bacteria 955
195 nmdc:mga0yw44_4610_c1 3300050492 Bacteria 6357
196 nmdc:mga0yw44_657913_c1 3300050492 Bacteria 712
197 nmdc:mga0yw44_81240_c1 3300050492 Bacteria 2032
198 nmdc:mga0yw44_986149_c1 3300050492 Bacteria 570
199 nmdc:mga06z11_71546_c1 3300050494 Bacteria 1836
200 nmdc:mga06z11_810358_c1 3300050494 Bacteria 571
201 nmdc:mga04h51_19543_c1 3300050495 Bacteria 2011
202 nmdc:mga04h51_230186_c1 3300050495 Bacteria 737
203 nmdc:mga04h51_46473_c1 3300050495 Bacteria 1439
204 nmdc:mga07m45_232433_c1 3300050496 Bacteria 1073
205 nmdc:mga07m45_61313_c1 3300050496 Bacteria 1648
206 nmdc:mga07m45_76077_c1 3300050496 Bacteria 1914
207 Ga0495595_0249822 3300053084 Bacteria 888
208 Ga0495619_0325800 3300053085 Bacteria 1063
209 Ga0500644_0000299 3300053088 Bacteria 26587
210 Ga0500644_0252569 3300053088 Bacteria 744
211 Ga0500641_0002239 3300053096 Bacteria 6845
212 Ga0500641_0063269 3300053096 Bacteria 1544
213 Ga0500573_0001528 3300053140 Bacteria 11131
214 Ga0501084_0185876 3300054114 Bacteria 1754
215 Ga0501082_0224485 3300060353 Bacteria 1635
216 Ga0501082_1299616 3300060353 Bacteria 635
217 2643825987 2643221561 Bacteria 4984412
218 2644531978 2643221696 Bacteria 5431823
219 2645721814 2643221961 Bacteria 3919167
220 2645724241 2643221962 Bacteria 3874254
221 2855387073 2855386786 Bacteria 4752232
222 Ga0070679_101218333
223 rootH1_10103988
224 JGI25405J52794_10130390
225 Ga0070658_11333609
226 Ga0070670_100675016
227 Ga0070660_101620005
228 Ga0070660_101679848
229 Ga0070660_101703193
230 Ga0070675_100669855
231 Ga0070675_100926535
232 Ga0070674_101669188
233 Ga0070673_100502318
234 Ga0070688_100512500
235 Ga0070708_100742964
236 Ga0070707_100053500
237 Ga0070698_100036757
238 Ga0070699_101598950
239 Ga0070672_100842955
240 Ga0070702_101636572
241 Ga0068852_102098910
242 Ga0068864_101060046
243 Ga0081455_10000174
244 Ga0075365_10002755
245 Ga0075365_10120129
246 Ga0075365_10124963
247 Ga0075365_10138651
248 Ga0075365_10193594
249 Ga0075365_10200050
250 Ga0075365_10247811
251 Ga0075365_10340120
252 Ga0075365_10340814
253 Ga0075365_10865249
254 Ga0075365_10895972
255 Ga0075365_11047904
256 Ga0075365_11248186
257 Ga0075368_10052375
258 Ga0075368_10188080
259 Ga0075363_100007636
260 Ga0075363_100046042
261 Ga0075363_100227294
262 Ga0075363_100243441
263 Ga0075363_100788138
264 Ga0075363_101065739
265 Ga0075364_10089086
266 Ga0075364_10127874
267 Ga0075364_10342739
268 Ga0075362_10087654
269 Ga0075362_10287778
270 Ga0075367_10355016
271 Ga0075367_10820766
272 Ga0075367_10828135
273 Ga0075370_10072786
274 Ga0075370_10084924
275 Ga0075370_10135572
276 Ga0105240_12665664
277 Ga0105245_10246674
278 Ga0105247_11563849
279 Ga0105243_10295694
280 Ga0105242_10904496
281 Ga0105248_10880967
282 Ga0105238_10505848
283 Ga0105249_11518350
284 Ga0105246_10299904
285 Ga0157371_11084963
286 Ga0157369_10532071
287 Ga0157374_11354715
288 Ga0157374_11693799
289 Ga0157372_11422493
290 Ga0157375_10277911
291 Ga0157375_12334427
292 Ga0157380_10420017
293 Ga0157380_11376289
294 Ga0157377_10290577
295 Ga0157376_10615569
296 Ga0182006_1210608
297 Ga0163161_10113073
298 Ga0213875_10162420
299 Ga0207657_10932145
300 Ga0207646_10437047
301 Ga0207644_11786495
302 Ga0207706_10621476
303 Ga0207709_10683189
304 Ga0207691_10561831
305 Ga0207661_10744330
306 Ga0207639_10796177
307 Ga0207678_10442605
308 Ga0207708_10670824
309 Ga0207708_11199853
310 Ga0207698_11818129
311 Ga0207698_11924614
312 Ga0209813_10007244
313 Ga0209813_10066053
314 Ga0307405_12047018
315 Ga0307412_10076033
316 Ga0307409_100131353
317 Ga0307416_101496124
318 Ga0307411_10568744
319 Ga0307411_10656058
320 Ga0307411_10795531
321 Ga0307415_100103507
322 Ga0395900_1343906
323 Ga0395905_0068315
324 Ga0395905_0457985
325 Ga0436364_0248667
326 Ga0436365_0592195
327 Ga0451791_0149259
328 Ga0451793_0116409
329 Ga0451793_1036904
330 Ga0451806_651429
331 Ga0451843_0271827
332 Ga0451853_3119728
333 Ga0450906_021311
334 Ga0439446_0185709
335 Ga0466972_0080824
336 Ga0466965_0239801
337 Ga0466966_0787735
338 Ga0466961_0097962
339 Ga0466963_1301089
340 Ga0466970_0008490
341 Ga0466970_0186060
342 Ga0466960_0075866
343 Ga0466960_0330328
344 Ga0466958_0458746
345 Ga0466967_0369119
346 Ga0495664_0248054
347 Ga0495635_0397396
348 Ga0496100_0093642
349 Ga0496102_1384193
350 Ga0496106_0402748
351 Ga0496108_0067140
352 Ga0496108_0103622
353 Ga0496109_0319267
354 Ga0496110_0149931
355 Ga0496110_0218245
356 Ga0496114_0073016
357 Ga0496114_1299693
358 Ga0496124_0342597
359 Ga0501031_0056764
360 Ga0501031_0992661
361 Ga0501032_0023023
362 Ga0501033_0035407
363 Ga0501033_0611372
364 Ga0501034_0180156
365 Ga0501036_0049794
366 Ga0501037_0007753
367 Ga0501038_0030366
368 Ga0501039_0203096
369 Ga0501041_1077309
370 Ga0501042_0024527
371 Ga0501042_1364378
372 Ga0501043_0020327
373 Ga0501046_0002768
374 Ga0501047_0337639
375 Ga0501048_0004409
376 Ga0501048_0223206
377 Ga0501068_0590002
378 Ga0501069_0290363
379 Ga0501070_0058347
380 Ga0501070_0355598
381 Ga0501071_0367945
382 Ga0501073_0472979
383 Ga0501074_0158527
384 Ga0501074_0414565
385 Ga0501075_0401204
386 Ga0501076_0509136
387 Ga0501077_0149776
388 Ga0501079_0463720
389 Ga0501080_0136167
390 Ga0501080_0439587
391 Ga0501080_1071206
392 Ga0501083_0245023
393 Ga0501044_0682735
394 Ga0501045_0164799
395 Ga0501045_0651231
396 nmdc:mga03n38_162676_c1
397 nmdc:mga03n38_384613_c1
398 nmdc:mga03n38_561425_c1
399 nmdc:mga03n38_79087_c1
400 nmdc:mga00v17_192894_c1
401 nmdc:mga00v17_492918_c1
402 nmdc:mga00v17_791921_c1
403 nmdc:mga00v17_89569_c1
404 nmdc:mga00v17_98481_c1
405 nmdc:mga0yw44_1000607_c1
406 nmdc:mga0yw44_1004284_c1
407 nmdc:mga0yw44_130807_c1
408 nmdc:mga0yw44_188440_c1
409 nmdc:mga0yw44_22179_c1
410 nmdc:mga0yw44_22184_c1
411 nmdc:mga0yw44_228136_c1
412 nmdc:mga0yw44_230735_c1
413 nmdc:mga0yw44_256719_c1
414 nmdc:mga0yw44_30416_c1
415 nmdc:mga0yw44_379079_c1
416 nmdc:mga0yw44_4610_c1
417 nmdc:mga0yw44_657913_c1
418 nmdc:mga0yw44_81240_c1
419 nmdc:mga0yw44_986149_c1
420 nmdc:mga06z11_71546_c1
421 nmdc:mga06z11_810358_c1
422 nmdc:mga04h51_19543_c1
423 nmdc:mga04h51_230186_c1
424 nmdc:mga04h51_46473_c1
425 nmdc:mga07m45_232433_c1
426 nmdc:mga07m45_61313_c1
427 nmdc:mga07m45_76077_c1
428 Ga0495595_0249822
429 Ga0495619_0325800
430 Ga0500644_0000299
431 Ga0500644_0252569
432 Ga0500641_0002239
433 Ga0500641_0063269
434 Ga0500573_0001528
435 Ga0501084_0185876
436 Ga0501082_0224485
437 Ga0501082_1299616
438 2643825987
439 2644531978
440 2645721814
441 2645724241
442 2855387073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zsz-assembly1.cif.gz_A catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 0.4596 8 52
3q5z-assembly1.cif.gz_A crystal structure of virulent allele rop5b pseudokinase domain 0.4506 9 41
5nko-assembly1.cif.gz_B solution structure of the c-terminal domain of s. aureus hibernating promoting factor (ctd-sahpf) 0.4471 1 52
6i3z-assembly1.cif.gz_A fab fragment of an antibody selective for wild-type alpha-1-antitrypsin in complex with its antigen 0.441 23 56
1u5i-assembly1.cif.gz_A crystal structure analysis of rat m-calpain mutant lys10 thr 0.4138 5 49
ID Description Score Start End Superfamily
af_Q7YZN9_344_430_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.5031 22 52 2.40.30.10
af_I1KB15_223_272_3.30.505.50 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;Sigma 54 modulation/S30EA ribosomal protein, C-terminal domain 0.4926 6 51 3.30.505.50
1mpyD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.49 10 52 3.10.180.10
5zszA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.4596 8 52 3.10.180.10
1lq8G01 Mainly Beta;Roll;Alpha-1-antitrypsin; domain 1;Alpha-1-antitrypsin, domain 1 0.4572 22 84 2.30.39.10
ID Description Score Start End GO Terms
AF-A0A2S9QT89-F1-model_v4 deleted 0.9313 22 94
AF-A0A652M1X6-F1-model_v4 deleted 0.9302 22 94
AF-A0A2I9D8X0-F1-model_v4 deleted 0.9109 23 97
AF-A0A6B2RSM0-F1-model_v4 Ferredoxin 0.9108 23 94
AF-A0A419ZD05-F1-model_v4 deleted 0.906 25 97

Map