F332410

General Info

Members Datasets Scaffolds Average Seq Length
220 167 440 59

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10004057|Ga0307514_100040577
Length 67
Sequence VLAPTLVRMSLDTVAPGSVRSAAELNEQIRSLWMRAGGTLSTQERAEYELLVVEWAAAIRDEIIEAA

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
29 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
33 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
44 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
45 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
46 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
49 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
50 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
57 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
58 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
59 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
90 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
91 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
130 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
131 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
132 2643221647 Streptomyces sp. Root369 Isolate Unclassified
133 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
134 2643221714 Streptomyces sp. Root264 Isolate Unclassified
135 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
136 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
137 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
138 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
139 2808606448 Streptomyces sp. 193411 Isolate Unclassified
140 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
141 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
142 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
143 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
144 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
145 2867428634 Streptomyces sp. RP5T Isolate Unclassified
146 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
147 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
148 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
149 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
150 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
151 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
152 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
153 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
154 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
155 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
156 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
157 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
158 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
159 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
160 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
161 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
162 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
163 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
164 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
165 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
166 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
167 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.27
Metatranscriptomes 0
Isolates 17.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.73
Nodule 0.45
Rhizoplane 7.27
Rhizosphere 69.09
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10004057 3300031649 Bacteria 13612
2 JGI24737J22298_10077772 3300001990 Bacteria 988
3 JGI24738J21930_10071859 3300002075 Bacteria 717
4 rootL2_10173675 3300003322 Bacteria 1719
5 rootH1_10092044 3300003323 Bacteria 3783
6 rootH1_10151873 3300003323 Bacteria 1047
7 Ga0070659_100419715 3300005366 Bacteria 1131
8 Ga0070681_10994051 3300005458 Bacteria 759
9 Ga0068855_100177377 3300005563 Bacteria 2410
10 Ga0068854_100921098 3300005578 Bacteria 769
11 Ga0081455_10307738 3300005937 Bacteria 1134
12 Ga0075368_10004094 3300006042 Bacteria 4906
13 Ga0075363_100156038 3300006048 Bacteria 1290
14 Ga0075363_100795460 3300006048 Bacteria 575
15 Ga0075367_10025725 3300006178 Bacteria 3331
16 Ga0075367_10458840 3300006178 Bacteria 808
17 Ga0075370_10335401 3300006353 Bacteria 902
18 Ga0099826_10140187 3300006948 Bacteria 1398
19 Ga0182008_10001042 3300014497 Bacteria 19234
20 Ga0182006_1035390 3300015261 Bacteria 1991
21 Ga0182007_10002010 3300015262 Bacteria 10476
22 Ga0182005_1124164 3300015265 Bacteria 737
23 Ga0183367_1003 3300015688 Bacteria 814276
24 Ga0209758_1010635 3300025297 Bacteria 5476
25 Ga0207647_10010427 3300025904 Bacteria 6564
26 Ga0207690_11764464 3300025932 Bacteria 517
27 Ga0207667_12013874 3300025949 Bacteria 537
28 Ga0207674_11108716 3300026116 Bacteria 761
29 Ga0209813_10037233 3300027866 Bacteria 1465
30 Ga0307512_10000296 3300030522 Bacteria 71852
31 Ga0316180_1136464 3300030736 Bacteria 2143
32 Ga0316181_1097470 3300030744 Bacteria 1647
33 Ga0307508_10083725 3300031616 Bacteria 2772
34 Ga0307508_10627008 3300031616 Bacteria 678
35 Ga0307514_10304276 3300031649 Bacteria 890
36 Ga0307516_10027956 3300031730 Bacteria 5713
37 Ga0307518_10307032 3300031838 Bacteria 959
38 Ga0307407_10984751 3300031903 Bacteria 651
39 Ga0307416_100822080 3300032002 Bacteria 1026
40 Ga0307507_10226829 3300033179 Bacteria 1246
41 Ga0307510_10048094 3300033180 Bacteria 4557
42 Ga0395899_0000686 3300037312 Bacteria 34116
43 Ga0395900_0523540 3300037418 Bacteria 1133
44 Ga0395900_1001488 3300037418 Unclassified 755
45 Ga0395900_1013713 3300037418 Bacteria 750
46 Ga0395898_0051947 3300037466 Bacteria 4005
47 Ga0395898_0083141 3300037466 Bacteria 3086
48 Ga0395898_0224241 3300037466 Bacteria 1793
49 Ga0395898_0970360 3300037466 Bacteria 786
50 Ga0395905_0089888 3300037471 Bacteria 2878
51 Ga0395901_0829431 3300038443 Unclassified 911
52 Ga0395901_0970391 3300038443 Bacteria 827
53 Ga0395901_1167368 3300038443 Bacteria 737
54 Ga0395901_1547739 3300038443 Bacteria 618
55 Ga0439436_0001414 3300041404 Bacteria 6945
56 Ga0439436_0002005 3300041404 Bacteria 6047
57 Ga0439439_0001932 3300041406 Bacteria 4285
58 Ga0439439_0003443 3300041406 Bacteria 3491
59 Ga0439466_0138260 3300041411 Bacteria 748
60 Ga0439466_0233774 3300041411 Bacteria 557
61 Ga0451797_1390457 3300041453 Bacteria 637
62 Ga0451835_0176429 3300041492 Bacteria 713
63 Ga0451837_1429443 3300041494 Bacteria 550
64 Ga0451845_0865498 3300041501 Bacteria 527
65 Ga0451849_1458907 3300041505 Bacteria 516
66 Ga0451843_1486980 3300041509 Bacteria 605
67 Ga0451853_0183537 3300041512 Bacteria 1534
68 Ga0439433_0001671 3300041999 Bacteria 4628
69 Ga0439433_0016090 3300041999 Bacteria 1654
70 Ga0439442_090880 3300042002 Bacteria 657
71 Ga0439448_0214453 3300042005 Bacteria 676
72 Ga0439449_0004849 3300042007 Bacteria 5189
73 Ga0439449_0179554 3300042007 Bacteria 791
74 Ga0439449_0315567 3300042007 Bacteria 590
75 Ga0439450_032298 3300042008 Bacteria 1182
76 Ga0439455_0087466 3300042012 Bacteria 852
77 Ga0439457_002337 3300042014 Bacteria 5445
78 Ga0439462_0001150 3300042015 Bacteria 5758
79 Ga0439462_0069760 3300042015 Bacteria 954
80 Ga0450903_005046 3300042138 Bacteria 2221
81 Ga0450906_004387 3300042145 Bacteria 2958
82 Ga0450906_019261 3300042145 Bacteria 1224
83 Ga0439458_0004650 3300042157 Bacteria 3132
84 Ga0466965_0038230 3300044683 Bacteria 2357
85 Ga0466965_0137970 3300044683 Bacteria 1268
86 Ga0466965_0266111 3300044683 Bacteria 922
87 Ga0466964_0028033 3300044706 Bacteria 2216
88 Ga0466971_0579240 3300044719 Bacteria 558
89 Ga0466968_0035156 3300044735 Bacteria 2095
90 Ga0466970_0000831 3300044765 Bacteria 14854
91 Ga0466970_0176055 3300044765 Bacteria 1186
92 Ga0466957_0997400 3300044842 Bacteria 601
93 Ga0466960_0007538 3300044901 Bacteria 4426
94 Ga0466960_0331485 3300044901 Bacteria 864
95 Ga0466967_0148243 3300045976 Bacteria 2190
96 Ga0466967_0550861 3300045976 Bacteria 1135
97 Ga0466967_0880600 3300045976 Bacteria 890
98 Ga0495603_0546818 3300046455 Bacteria 663
99 Ga0495582_0297551 3300046473 Bacteria 927
100 Ga0495639_0000215 3300046475 Bacteria 29715
101 Ga0495662_0000012 3300046476 Bacteria 66974
102 Ga0495662_0020184 3300046476 Bacteria 3223
103 Ga0495662_0029101 3300046476 Bacteria 2667
104 Ga0495594_0000026 3300046499 Bacteria 68304
105 Ga0495594_0333127 3300046499 Bacteria 864
106 Ga0495594_0874740 3300046499 Bacteria 505
107 Ga0495610_0375659 3300046512 Bacteria 530
108 Ga0495643_0485055 3300046522 Bacteria 534
109 Ga0495586_0000054 3300046535 Bacteria 68112
110 Ga0495622_0000284 3300046557 Bacteria 38669
111 Ga0495625_0184083 3300046660 Bacteria 1387
112 Ga0495635_0069383 3300046663 Bacteria 2416
113 Ga0495588_0000717 3300046674 Bacteria 15201
114 Ga0495588_0001323 3300046674 Bacteria 10577
115 Ga0495588_0001843 3300046674 Bacteria 9032
116 Ga0495588_0675708 3300046674 Bacteria 540
117 Ga0495657_0375223 3300046675 Unclassified 839
118 Ga0495613_0008846 3300046689 Bacteria 7470
119 Ga0495613_0080927 3300046689 Bacteria 2360
120 Ga0495613_0342600 3300046689 Bacteria 1028
121 Ga0495649_0125339 3300046694 Bacteria 1357
122 Ga0495600_0186481 3300046809 Bacteria 1335
123 Ga0495581_0000071 3300047315 Bacteria 40218
124 Ga0495581_0097235 3300047315 Bacteria 1710
125 Ga0495581_0145097 3300047315 Bacteria 1385
126 Ga0495687_025173 3300047443 Bacteria 2818
127 Ga0495685_034446 3300047447 Bacteria 1740
128 Ga0495593_0453842 3300047673 Bacteria 642
129 Ga0495614_0012345 3300048089 Bacteria 3749
130 Ga0496100_0862397 3300048903 Bacteria 710
131 Ga0496104_0096746 3300048907 Bacteria 2824
132 Ga0496105_0049159 3300048908 Bacteria 3481
133 Ga0496106_0007307 3300048909 Bacteria 8163
134 Ga0496107_0001259 3300048910 Bacteria 15511
135 Ga0496108_0042224 3300048911 Bacteria 3807
136 Ga0496109_0009156 3300048912 Bacteria 8432
137 Ga0496109_1431394 3300048912 Bacteria 626
138 Ga0496110_0003025 3300048913 Bacteria 12760
139 Ga0496110_0659438 3300048913 Viruses 946
140 Ga0496111_0000978 3300048914 Bacteria 15635
141 Ga0496111_0005919 3300048914 Bacteria 7885
142 Ga0496111_0430648 3300048914 Bacteria 974
143 Ga0496114_0282893 3300048917 Bacteria 1462
144 Ga0496115_0004543 3300048918 Bacteria 10041
145 Ga0501032_0331572 3300049569 Bacteria 981
146 Ga0501032_0783496 3300049569 Bacteria 602
147 Ga0501033_0009105 3300049570 Bacteria 7658
148 Ga0501034_0005099 3300049571 Bacteria 14418
149 Ga0501036_0009325 3300049572 Bacteria 8071
150 Ga0501038_0027500 3300049574 Bacteria 5060
151 Ga0501038_0202737 3300049574 Bacteria 1591
152 Ga0501039_0001579 3300049575 Bacteria 16768
153 Ga0501039_1261947 3300049575 Bacteria 570
154 Ga0501043_0003436 3300049579 Bacteria 13009
155 Ga0501046_0145697 3300049580 Bacteria 1789
156 Ga0501047_0111723 3300049581 Bacteria 2615
157 Ga0501068_0087268 3300049584 Bacteria 1921
158 Ga0501070_0000195 3300049586 Bacteria 56683
159 Ga0501070_1044171 3300049586 Bacteria 632
160 Ga0501070_1244498 3300049586 Bacteria 570
161 Ga0501071_0870269 3300049587 Bacteria 695
162 Ga0501073_0151050 3300049589 Bacteria 1610
163 Ga0501074_0265348 3300049590 Bacteria 1220
164 Ga0501075_0000061 3300049591 Bacteria 46656
165 Ga0501035_0003960 3300049822 Bacteria 14121
166 Ga0501035_0820177 3300049822 Bacteria 742
167 Ga0501044_0003202 3300049823 Bacteria 18453
168 Ga0501044_0368714 3300049823 Bacteria 1353
169 Ga0501044_0491409 3300049823 Bacteria 1129
170 nmdc:mga03n38_618294_c1 3300050490 Bacteria 618
171 nmdc:mga03n38_732710_c1 3300050490 Bacteria 572
172 nmdc:mga03n38_835986_c1 3300050490 Bacteria 538
173 nmdc:mga03n38_921766_c1 3300050490 Bacteria 514
174 nmdc:mga06z11_15900_c1 3300050494 Bacteria 3373
175 nmdc:mga04h51_2228_c1 3300050495 Bacteria 4569
176 nmdc:mga07m45_172883_c1 3300050496 Bacteria 1256
177 Ga0500578_0214928 3300053086 Bacteria 1171
178 Ga0500600_0142946 3300053149 Bacteria 1202
179 Ga0501084_0601832 3300054114 Bacteria 929
180 Ga0590071_045061 3300059421 Bacteria 1064
181 Ga0530510_0920255 3300061734 Unclassified 668
182 2547409182 2547132111 Bacteria 8013147
183 2585310868 2582581313 Bacteria 10042643
184 2585316004 2582581314 Bacteria 11452267
185 2644264205 2643221647 Bacteria 10741251
186 2644438229 2643221678 Bacteria 9540101
187 2644629987 2643221714 Bacteria 9015452
188 2785366965 2784746768 Bacteria 10036182
189 2786668009 2786546132 Bacteria 10419719
190 2808847468 2808606359 Bacteria 9866990
191 2808918198 2808606375 Bacteria 9466072
192 2809230103 2808606448 Bacteria 8656184
193 2812360493 2811994879 Bacteria 9313447
194 2812482582 2811994917 Bacteria 7761064
195 2852641308 2852635781 Bacteria 8251373
196 2862289843 2862281513 Bacteria 9621493
197 2862509797 2862507626 Bacteria 9425308
198 2867437122 2867428634 Bacteria 9590268
199 2877683574 2877676314 Bacteria 9512378
200 2912726359 2912723979 Bacteria 8557534
201 2919474422 2919468124 Bacteria 9133025
202 2946065395 2946064051 Bacteria 8957905
203 2946073747 2946072368 Bacteria 8999607
204 2954388829 2954380949 Bacteria 10050426
205 2954674295 2954673503 Bacteria 9685905
206 2954689836 2954682443 Bacteria 9862841
207 2954699617 2954691527 Bacteria 10720516
208 2954702601 2954701450 Bacteria 10834262
209 2954718558 2954711539 Bacteria 10867210
210 2954728529 2954721474 Bacteria 10456478
211 2954733282 2954731030 Bacteria 10243860
212 2954747424 2954740390 Bacteria 10229294
213 2954752164 2954749733 Bacteria 10366972
214 2954766540 2954759201 Bacteria 9358192
215 2990063666 2990059506 Bacteria 9321252
216 3006498292 3006493962 Bacteria 8825450
217 8008580922 8008574985 Bacteria 7815457
218 8023625125 8023623736 Bacteria 8593882
219 8048409884 8048406513 Bacteria 8936924
220 8056832501 8056829672 Bacteria 9045328
221 Ga0307514_10004057
222 JGI24737J22298_10077772
223 JGI24738J21930_10071859
224 rootL2_10173675
225 rootH1_10092044
226 rootH1_10151873
227 Ga0070659_100419715
228 Ga0070681_10994051
229 Ga0068855_100177377
230 Ga0068854_100921098
231 Ga0081455_10307738
232 Ga0075368_10004094
233 Ga0075363_100156038
234 Ga0075363_100795460
235 Ga0075367_10025725
236 Ga0075367_10458840
237 Ga0075370_10335401
238 Ga0099826_10140187
239 Ga0182008_10001042
240 Ga0182006_1035390
241 Ga0182007_10002010
242 Ga0182005_1124164
243 Ga0183367_1003
244 Ga0209758_1010635
245 Ga0207647_10010427
246 Ga0207690_11764464
247 Ga0207667_12013874
248 Ga0207674_11108716
249 Ga0209813_10037233
250 Ga0307512_10000296
251 Ga0316180_1136464
252 Ga0316181_1097470
253 Ga0307508_10083725
254 Ga0307508_10627008
255 Ga0307514_10304276
256 Ga0307516_10027956
257 Ga0307518_10307032
258 Ga0307407_10984751
259 Ga0307416_100822080
260 Ga0307507_10226829
261 Ga0307510_10048094
262 Ga0395899_0000686
263 Ga0395900_0523540
264 Ga0395900_1001488
265 Ga0395900_1013713
266 Ga0395898_0051947
267 Ga0395898_0083141
268 Ga0395898_0224241
269 Ga0395898_0970360
270 Ga0395905_0089888
271 Ga0395901_0829431
272 Ga0395901_0970391
273 Ga0395901_1167368
274 Ga0395901_1547739
275 Ga0439436_0001414
276 Ga0439436_0002005
277 Ga0439439_0001932
278 Ga0439439_0003443
279 Ga0439466_0138260
280 Ga0439466_0233774
281 Ga0451797_1390457
282 Ga0451835_0176429
283 Ga0451837_1429443
284 Ga0451845_0865498
285 Ga0451849_1458907
286 Ga0451843_1486980
287 Ga0451853_0183537
288 Ga0439433_0001671
289 Ga0439433_0016090
290 Ga0439442_090880
291 Ga0439448_0214453
292 Ga0439449_0004849
293 Ga0439449_0179554
294 Ga0439449_0315567
295 Ga0439450_032298
296 Ga0439455_0087466
297 Ga0439457_002337
298 Ga0439462_0001150
299 Ga0439462_0069760
300 Ga0450903_005046
301 Ga0450906_004387
302 Ga0450906_019261
303 Ga0439458_0004650
304 Ga0466965_0038230
305 Ga0466965_0137970
306 Ga0466965_0266111
307 Ga0466964_0028033
308 Ga0466971_0579240
309 Ga0466968_0035156
310 Ga0466970_0000831
311 Ga0466970_0176055
312 Ga0466957_0997400
313 Ga0466960_0007538
314 Ga0466960_0331485
315 Ga0466967_0148243
316 Ga0466967_0550861
317 Ga0466967_0880600
318 Ga0495603_0546818
319 Ga0495582_0297551
320 Ga0495639_0000215
321 Ga0495662_0000012
322 Ga0495662_0020184
323 Ga0495662_0029101
324 Ga0495594_0000026
325 Ga0495594_0333127
326 Ga0495594_0874740
327 Ga0495610_0375659
328 Ga0495643_0485055
329 Ga0495586_0000054
330 Ga0495622_0000284
331 Ga0495625_0184083
332 Ga0495635_0069383
333 Ga0495588_0000717
334 Ga0495588_0001323
335 Ga0495588_0001843
336 Ga0495588_0675708
337 Ga0495657_0375223
338 Ga0495613_0008846
339 Ga0495613_0080927
340 Ga0495613_0342600
341 Ga0495649_0125339
342 Ga0495600_0186481
343 Ga0495581_0000071
344 Ga0495581_0097235
345 Ga0495581_0145097
346 Ga0495687_025173
347 Ga0495685_034446
348 Ga0495593_0453842
349 Ga0495614_0012345
350 Ga0496100_0862397
351 Ga0496104_0096746
352 Ga0496105_0049159
353 Ga0496106_0007307
354 Ga0496107_0001259
355 Ga0496108_0042224
356 Ga0496109_0009156
357 Ga0496109_1431394
358 Ga0496110_0003025
359 Ga0496110_0659438
360 Ga0496111_0000978
361 Ga0496111_0005919
362 Ga0496111_0430648
363 Ga0496114_0282893
364 Ga0496115_0004543
365 Ga0501032_0331572
366 Ga0501032_0783496
367 Ga0501033_0009105
368 Ga0501034_0005099
369 Ga0501036_0009325
370 Ga0501038_0027500
371 Ga0501038_0202737
372 Ga0501039_0001579
373 Ga0501039_1261947
374 Ga0501043_0003436
375 Ga0501046_0145697
376 Ga0501047_0111723
377 Ga0501068_0087268
378 Ga0501070_0000195
379 Ga0501070_1044171
380 Ga0501070_1244498
381 Ga0501071_0870269
382 Ga0501073_0151050
383 Ga0501074_0265348
384 Ga0501075_0000061
385 Ga0501035_0003960
386 Ga0501035_0820177
387 Ga0501044_0003202
388 Ga0501044_0368714
389 Ga0501044_0491409
390 nmdc:mga03n38_618294_c1
391 nmdc:mga03n38_732710_c1
392 nmdc:mga03n38_835986_c1
393 nmdc:mga03n38_921766_c1
394 nmdc:mga06z11_15900_c1
395 nmdc:mga04h51_2228_c1
396 nmdc:mga07m45_172883_c1
397 Ga0500578_0214928
398 Ga0500600_0142946
399 Ga0501084_0601832
400 Ga0590071_045061
401 Ga0530510_0920255
402 2547409182
403 2585310868
404 2585316004
405 2644264205
406 2644438229
407 2644629987
408 2785366965
409 2786668009
410 2808847468
411 2808918198
412 2809230103
413 2812360493
414 2812482582
415 2852641308
416 2862289843
417 2862509797
418 2867437122
419 2877683574
420 2912726359
421 2919474422
422 2946065395
423 2946073747
424 2954388829
425 2954674295
426 2954689836
427 2954699617
428 2954702601
429 2954718558
430 2954728529
431 2954733282
432 2954747424
433 2954752164
434 2954766540
435 2990063666
436 3006498292
437 8008580922
438 8023625125
439 8048409884
440 8056832501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c6k-assembly1.cif.gz_A structural basis for preferential recognition of cap 0 rna by a human ifit1-ifit3 protein complex 0.9604 14 55
5udi-assembly1.cif.gz_A ifit1 monomeric mutant (l457e/l464e) with m7gppp-aaaa (syn and anti conformations of cap) 0.9469 14 55
5j10-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8918 14 53
5j10-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8896 14 53
8szz-assembly1.cif.gz_s cryoem structure of computationally designed nanocage o32-zl4 0.8883 14 53
ID Description Score Start End Superfamily
af_Q5VMW9_14_153_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8838 13 55 1.25.40.10
af_C7G036_1295_1678_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8748 14 53 3.40.50.300
af_Q95U34_263_403_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.8433 14 52 1.20.1440.340
4l0rB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8372 14 53 1.20.58.90
3txqE01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8332 14 55 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A0S1UUE5-F1-model_v4 deleted 0.9872 11 53
AF-A0A1Z1W6C8-F1-model_v4 Uncharacterized protein 0.9723 11 59
AF-A0A1Z1W6C8-F1-model_v4 Uncharacterized protein 0.9534 11 59
AF-A0A170WV15-F1-model_v4 Uncharacterized protein 0.9217 7 59
AF-A0A6I4N4N7-F1-model_v4 Integrase 0.9052 1 59

Map