F332273

General Info

Members Datasets Scaffolds Average Seq Length
220 135 440 154

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10239482|Ga0182008_102394822
Length 151
Sequence MTTSGFTHVSVHARDLDESARFYEDLFGMEEIPSPDFPFPVHWLRVGGLQLHLLQNEESAPQGYHFGLDVDDFEAVYSRAKQSGVLIGEGYFSKVYELPEGAVQMYLRDPAGNMVEVNHPDVSEIDRSVVVEIEKVPIETEEGSRAELYAG

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 5.91
Rhizosphere 80.45
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10239482 3300014497 Unclassified 933
2 Ga0070658_11338828 3300005327 Bacteria 622
3 Ga0070683_100018993 3300005329 Bacteria 6098
4 Ga0070683_100207906 3300005329 Bacteria 1859
5 Ga0070683_100376565 3300005329 Bacteria 1352
6 Ga0070683_100444576 3300005329 Bacteria 1237
7 Ga0070683_100477971 3300005329 Bacteria 1190
8 Ga0070682_100201096 3300005337 Bacteria 1405
9 Ga0070682_101006902 3300005337 Bacteria 692
10 Ga0068868_100215926 3300005338 Bacteria 1604
11 Ga0068868_100396763 3300005338 Bacteria 1190
12 Ga0070661_100801188 3300005344 Bacteria 773
13 Ga0070669_100612360 3300005353 Bacteria 913
14 Ga0070675_100551808 3300005354 Bacteria 1042
15 Ga0070671_100495361 3300005355 Unclassified 1051
16 Ga0070671_100854873 3300005355 Bacteria 794
17 Ga0070674_100090057 3300005356 Bacteria 2212
18 Ga0070688_100851314 3300005365 Bacteria 716
19 Ga0070659_100324924 3300005366 Bacteria 1287
20 Ga0070659_100561570 3300005366 Bacteria 978
21 Ga0070659_100685938 3300005366 Bacteria 885
22 Ga0070714_100001474 3300005435 Bacteria 17145
23 Ga0070714_100723855 3300005435 Bacteria 961
24 Ga0070713_100500897 3300005436 Bacteria 1146
25 Ga0070713_101417561 3300005436 Bacteria 674
26 Ga0070701_10161337 3300005438 Bacteria 1299
27 Ga0070700_100102473 3300005441 Bacteria 1888
28 Ga0070678_100582057 3300005456 Bacteria 997
29 Ga0070678_100868602 3300005456 Bacteria 823
30 Ga0070662_101275523 3300005457 Bacteria 632
31 Ga0068867_100130544 3300005459 Bacteria 1952
32 Ga0070685_10070481 3300005466 Bacteria 2070
33 Ga0070684_100149199 3300005535 Unclassified 2117
34 Ga0070684_100180974 3300005535 Bacteria 1917
35 Ga0070684_100340065 3300005535 Bacteria 1380
36 Ga0070684_100930172 3300005535 Bacteria 815
37 Ga0070686_100474739 3300005544 Bacteria 966
38 Ga0070693_100984736 3300005547 Bacteria 637
39 Ga0070665_101473670 3300005548 Unclassified 689
40 Ga0070704_100577729 3300005549 Bacteria 985
41 Ga0070664_100940743 3300005564 Bacteria 811
42 Ga0068857_101054432 3300005577 Bacteria 784
43 Ga0068854_100800179 3300005578 Bacteria 822
44 Ga0068856_100408818 3300005614 Unclassified 1377
45 Ga0070702_100037279 3300005615 Bacteria 2699
46 Ga0068864_100218534 3300005618 Bacteria 1757
47 Ga0068858_101176027 3300005842 Unclassified 754
48 Ga0081538_10000098 3300005981 Bacteria 84863
49 Ga0081539_10327376 3300005985 Bacteria 650
50 Ga0070717_10002754 3300006028 Bacteria 12425
51 Ga0070717_10029752 3300006028 Bacteria 4385
52 Ga0070717_10293497 3300006028 Bacteria 1444
53 Ga0070712_100611506 3300006175 Bacteria 923
54 Ga0068871_100904503 3300006358 Bacteria 818
55 Ga0075428_101010591 3300006844 Unclassified 880
56 Ga0068865_100469227 3300006881 Bacteria 1044
57 Ga0068865_100730404 3300006881 Unclassified 849
58 Ga0068865_101024315 3300006881 Unclassified 724
59 Ga0111539_10496837 3300009094 Bacteria 1421
60 Ga0105245_10173003 3300009098 Bacteria 2057
61 Ga0105245_10190571 3300009098 Bacteria 1964
62 Ga0105245_10956831 3300009098 Bacteria 899
63 Ga0105245_11185339 3300009098 Bacteria 811
64 Ga0105247_10085278 3300009101 Bacteria 1997
65 Ga0105243_10122510 3300009148 Unclassified 2195
66 Ga0105243_10147621 3300009148 Bacteria 2014
67 Ga0105242_11186170 3300009176 Bacteria 782
68 Ga0105248_10587959 3300009177 Bacteria 1256
69 Ga0105238_10277191 3300009551 Bacteria 1658
70 Ga0105238_10830136 3300009551 Bacteria 941
71 Ga0105249_10548925 3300009553 Bacteria 1206
72 Ga0105249_10559608 3300009553 Bacteria 1195
73 Ga0157369_12079490 3300013105 Bacteria 576
74 Ga0163162_10164752 3300013306 Bacteria 2340
75 Ga0163162_11230019 3300013306 Bacteria 850
76 Ga0163162_11825954 3300013306 Bacteria 695
77 Ga0163162_12675887 3300013306 Unclassified 574
78 Ga0157372_11928382 3300013307 Bacteria 679
79 Ga0157375_10652596 3300013308 Bacteria 1208
80 Ga0157375_10946647 3300013308 Bacteria 1003
81 Ga0157380_10691000 3300014326 Bacteria 1024
82 Ga0157379_10292813 3300014968 Bacteria 1483
83 Ga0213873_10074545 3300021358 Bacteria 940
84 Ga0213874_10002887 3300021377 Bacteria 3748
85 Ga0213876_10122900 3300021384 Unclassified 1379
86 Ga0213876_10236207 3300021384 Bacteria 971
87 Ga0213875_10044098 3300021388 Bacteria 2095
88 Ga0213875_10047359 3300021388 Bacteria 2017
89 Ga0213875_10089425 3300021388 Bacteria 1436
90 Ga0207426_1015814 3300025302 Bacteria 2729
91 Ga0207426_1088064 3300025302 Bacteria 827
92 Ga0207688_10128428 3300025901 Bacteria 1484
93 Ga0207643_10049569 3300025908 Bacteria 2380
94 Ga0207705_10691735 3300025909 Bacteria 793
95 Ga0207693_10204801 3300025915 Bacteria 1551
96 Ga0207657_10817735 3300025919 Bacteria 720
97 Ga0207652_11151944 3300025921 Bacteria 677
98 Ga0207694_10482117 3300025924 Bacteria 1037
99 Ga0207687_10052894 3300025927 Unclassified 2835
100 Ga0207700_10398093 3300025928 Bacteria 1206
101 Ga0207664_10001245 3300025929 Bacteria 16858
102 Ga0207690_10248413 3300025932 Bacteria 1373
103 Ga0207690_10304473 3300025932 Bacteria 1248
104 Ga0207690_10319949 3300025932 Bacteria 1219
105 Ga0207706_10346033 3300025933 Bacteria 1293
106 Ga0207669_10105511 3300025937 Bacteria 1875
107 Ga0207704_10696141 3300025938 Unclassified 841
108 Ga0207691_10116009 3300025940 Bacteria 2377
109 Ga0207691_10137068 3300025940 Bacteria 2158
110 Ga0207711_11309620 3300025941 Bacteria 667
111 Ga0207689_10344290 3300025942 Bacteria 1239
112 Ga0207661_10013517 3300025944 Bacteria 5961
113 Ga0207661_10328216 3300025944 Bacteria 1377
114 Ga0207661_11330799 3300025944 Bacteria 660
115 Ga0207679_11530222 3300025945 Bacteria 612
116 Ga0207712_10246407 3300025961 Bacteria 1442
117 Ga0207640_10198476 3300025981 Unclassified 1518
118 Ga0207677_10336494 3300026023 Bacteria 1260
119 Ga0207703_11096347 3300026035 Unclassified 765
120 Ga0207708_10211216 3300026075 Bacteria 1551
121 Ga0207708_10958424 3300026075 Bacteria 742
122 Ga0207702_10123364 3300026078 Unclassified 2322
123 Ga0207648_10046384 3300026089 Bacteria 3810
124 Ga0207676_10229676 3300026095 Bacteria 1658
125 Ga0207676_10665444 3300026095 Bacteria 1006
126 Ga0207676_10688423 3300026095 Unclassified 989
127 Ga0207674_10145607 3300026116 Bacteria 2328
128 Ga0207675_100193153 3300026118 Bacteria 1953
129 Ga0207675_100768501 3300026118 Bacteria 975
130 Ga0207675_100889269 3300026118 Bacteria 907
131 Ga0207683_10255525 3300026121 Bacteria 1599
132 Ga0207698_10775384 3300026142 Bacteria 959
133 Ga0207698_10787091 3300026142 Unclassified 952
134 Ga0207428_10098006 3300027907 Bacteria 2269
135 Ga0268266_10945871 3300028379 Bacteria 834
136 Ga0268265_11725759 3300028380 Bacteria 632
137 Ga0268264_10150525 3300028381 Bacteria 2086
138 Ga0307405_10421252 3300031731 Bacteria 1051
139 Ga0307405_10754779 3300031731 Bacteria 811
140 Ga0307405_11100986 3300031731 Unclassified 683
141 Ga0307413_10237696 3300031824 Bacteria 1343
142 Ga0307410_10084328 3300031852 Bacteria 2240
143 Ga0307410_10219137 3300031852 Bacteria 1463
144 Ga0307410_10469349 3300031852 Bacteria 1030
145 Ga0307406_10756886 3300031901 Bacteria 816
146 Ga0307407_10098647 3300031903 Bacteria 1808
147 Ga0307407_11624609 3300031903 Unclassified 513
148 Ga0307409_100270214 3300031995 Bacteria 1565
149 Ga0307416_100042499 3300032002 Bacteria 3549
150 Ga0307416_100121966 3300032002 Bacteria 2325
151 Ga0307416_100596639 3300032002 Bacteria 1184
152 Ga0307416_101329949 3300032002 Bacteria 824
153 Ga0307415_100014235 3300032126 Bacteria 4669
154 Ga0307415_100039469 3300032126 Bacteria 3121
155 Ga0373961_0236350 3300035241 Bacteria 657
156 Ga0436364_0151866 3300037853 Bacteria 14717
157 Ga0436364_0699271 3300037853 Bacteria 3692
158 Ga0436364_0704193 3300037853 Bacteria 18367
159 Ga0436364_0800791 3300037853 Bacteria 1799
160 Ga0436364_1037856 3300037853 Bacteria 6117
161 Ga0436364_1173508 3300037853 Bacteria 1188
162 Ga0436364_1543144 3300037853 Bacteria 2636
163 Ga0436365_0052225 3300039437 Unclassified 1423
164 Ga0436365_0149717 3300039437 Bacteria 8761
165 Ga0436365_0503704 3300039437 Bacteria 2222
166 Ga0436365_0625402 3300039437 Bacteria 5094
167 Ga0436365_1081166 3300039437 Bacteria 2219
168 Ga0436365_1516261 3300039437 Bacteria 1201
169 Ga0436365_1531134 3300039437 Bacteria 691
170 Ga0436365_1817543 3300039437 Bacteria 5024
171 Ga0436363_0822672 3300039450 Bacteria 10142
172 Ga0436363_1155623 3300039450 Unclassified 1913
173 Ga0436363_1351314 3300039450 Bacteria 2080
174 Ga0436363_1459061 3300039450 Bacteria 3261
175 Ga0436362_0745454 3300039453 Bacteria 559
176 Ga0436362_0784296 3300039453 Bacteria 1657
177 Ga0436362_1091508 3300039453 Bacteria 1366
178 Ga0436362_1101737 3300039453 Unclassified 779
179 Ga0436362_1304689 3300039453 Unclassified 692
180 Ga0451789_0826484 3300041443 Bacteria 1293
181 Ga0451791_0560880 3300041451 Bacteria 1599
182 Ga0451802_0001317 3300041460 Bacteria 856
183 Ga0451837_1096143 3300041494 Bacteria 1868
184 Ga0451843_1582245 3300041509 Bacteria 1002
185 Ga0451853_0873853 3300041512 Bacteria 1605
186 Ga0466966_0100858 3300044684 Bacteria 1786
187 Ga0466966_0585257 3300044684 Bacteria 672
188 Ga0466961_0399659 3300044693 Bacteria 834
189 Ga0466963_0011698 3300044694 Bacteria 5349
190 Ga0466963_0337500 3300044694 Bacteria 1061
191 Ga0466963_0519191 3300044694 Bacteria 841
192 Ga0466968_0095150 3300044735 Unclassified 1325
193 Ga0466968_0252938 3300044735 Unclassified 837
194 Ga0466970_0195192 3300044765 Bacteria 1126
195 Ga0466960_0210661 3300044901 Bacteria 1065
196 Ga0466960_0478990 3300044901 Bacteria 727
197 Ga0466960_0837060 3300044901 Unclassified 559
198 Ga0466959_0130213 3300045049 Bacteria 1783
199 Ga0466959_0169803 3300045049 Unclassified 1530
200 Ga0466959_0340667 3300045049 Bacteria 1023
201 Ga0466958_0143845 3300045836 Bacteria 1502
202 Ga0466967_0036938 3300045976 Bacteria 4175
203 Ga0466967_0045476 3300045976 Bacteria 3814
204 Ga0466967_0047586 3300045976 Bacteria 3739
205 Ga0495582_0075518 3300046473 Bacteria 1867
206 Ga0495606_0291527 3300046507 Bacteria 888
207 Ga0495645_0352610 3300046543 Bacteria 948
208 Ga0496101_0279593 3300048904 Bacteria 1304
209 Ga0496102_0395522 3300048905 Bacteria 1299
210 Ga0496102_0467135 3300048905 Bacteria 1183
211 Ga0496105_0212073 3300048908 Bacteria 1578
212 Ga0496106_0360008 3300048909 Bacteria 1169
213 Ga0496106_0976202 3300048909 Bacteria 667
214 Ga0496110_0163226 3300048913 Bacteria 2020
215 Ga0496112_0268277 3300048915 Bacteria 1655
216 Ga0496113_1351056 3300048916 Bacteria 553
217 Ga0496114_0488936 3300048917 Bacteria 1089
218 nmdc:mga08y16_223943_c1 3300050511 Bacteria 1946
219 nmdc:mga0rr50_826118_c1 3300050513 Unclassified 790
220 Ga0466962_0044615 3300061719 Bacteria 2121
221 Ga0182008_10239482
222 Ga0070658_11338828
223 Ga0070683_100018993
224 Ga0070683_100207906
225 Ga0070683_100376565
226 Ga0070683_100444576
227 Ga0070683_100477971
228 Ga0070682_100201096
229 Ga0070682_101006902
230 Ga0068868_100215926
231 Ga0068868_100396763
232 Ga0070661_100801188
233 Ga0070669_100612360
234 Ga0070675_100551808
235 Ga0070671_100495361
236 Ga0070671_100854873
237 Ga0070674_100090057
238 Ga0070688_100851314
239 Ga0070659_100324924
240 Ga0070659_100561570
241 Ga0070659_100685938
242 Ga0070714_100001474
243 Ga0070714_100723855
244 Ga0070713_100500897
245 Ga0070713_101417561
246 Ga0070701_10161337
247 Ga0070700_100102473
248 Ga0070678_100582057
249 Ga0070678_100868602
250 Ga0070662_101275523
251 Ga0068867_100130544
252 Ga0070685_10070481
253 Ga0070684_100149199
254 Ga0070684_100180974
255 Ga0070684_100340065
256 Ga0070684_100930172
257 Ga0070686_100474739
258 Ga0070693_100984736
259 Ga0070665_101473670
260 Ga0070704_100577729
261 Ga0070664_100940743
262 Ga0068857_101054432
263 Ga0068854_100800179
264 Ga0068856_100408818
265 Ga0070702_100037279
266 Ga0068864_100218534
267 Ga0068858_101176027
268 Ga0081538_10000098
269 Ga0081539_10327376
270 Ga0070717_10002754
271 Ga0070717_10029752
272 Ga0070717_10293497
273 Ga0070712_100611506
274 Ga0068871_100904503
275 Ga0075428_101010591
276 Ga0068865_100469227
277 Ga0068865_100730404
278 Ga0068865_101024315
279 Ga0111539_10496837
280 Ga0105245_10173003
281 Ga0105245_10190571
282 Ga0105245_10956831
283 Ga0105245_11185339
284 Ga0105247_10085278
285 Ga0105243_10122510
286 Ga0105243_10147621
287 Ga0105242_11186170
288 Ga0105248_10587959
289 Ga0105238_10277191
290 Ga0105238_10830136
291 Ga0105249_10548925
292 Ga0105249_10559608
293 Ga0157369_12079490
294 Ga0163162_10164752
295 Ga0163162_11230019
296 Ga0163162_11825954
297 Ga0163162_12675887
298 Ga0157372_11928382
299 Ga0157375_10652596
300 Ga0157375_10946647
301 Ga0157380_10691000
302 Ga0157379_10292813
303 Ga0213873_10074545
304 Ga0213874_10002887
305 Ga0213876_10122900
306 Ga0213876_10236207
307 Ga0213875_10044098
308 Ga0213875_10047359
309 Ga0213875_10089425
310 Ga0207426_1015814
311 Ga0207426_1088064
312 Ga0207688_10128428
313 Ga0207643_10049569
314 Ga0207705_10691735
315 Ga0207693_10204801
316 Ga0207657_10817735
317 Ga0207652_11151944
318 Ga0207694_10482117
319 Ga0207687_10052894
320 Ga0207700_10398093
321 Ga0207664_10001245
322 Ga0207690_10248413
323 Ga0207690_10304473
324 Ga0207690_10319949
325 Ga0207706_10346033
326 Ga0207669_10105511
327 Ga0207704_10696141
328 Ga0207691_10116009
329 Ga0207691_10137068
330 Ga0207711_11309620
331 Ga0207689_10344290
332 Ga0207661_10013517
333 Ga0207661_10328216
334 Ga0207661_11330799
335 Ga0207679_11530222
336 Ga0207712_10246407
337 Ga0207640_10198476
338 Ga0207677_10336494
339 Ga0207703_11096347
340 Ga0207708_10211216
341 Ga0207708_10958424
342 Ga0207702_10123364
343 Ga0207648_10046384
344 Ga0207676_10229676
345 Ga0207676_10665444
346 Ga0207676_10688423
347 Ga0207674_10145607
348 Ga0207675_100193153
349 Ga0207675_100768501
350 Ga0207675_100889269
351 Ga0207683_10255525
352 Ga0207698_10775384
353 Ga0207698_10787091
354 Ga0207428_10098006
355 Ga0268266_10945871
356 Ga0268265_11725759
357 Ga0268264_10150525
358 Ga0307405_10421252
359 Ga0307405_10754779
360 Ga0307405_11100986
361 Ga0307413_10237696
362 Ga0307410_10084328
363 Ga0307410_10219137
364 Ga0307410_10469349
365 Ga0307406_10756886
366 Ga0307407_10098647
367 Ga0307407_11624609
368 Ga0307409_100270214
369 Ga0307416_100042499
370 Ga0307416_100121966
371 Ga0307416_100596639
372 Ga0307416_101329949
373 Ga0307415_100014235
374 Ga0307415_100039469
375 Ga0373961_0236350
376 Ga0436364_0151866
377 Ga0436364_0699271
378 Ga0436364_0704193
379 Ga0436364_0800791
380 Ga0436364_1037856
381 Ga0436364_1173508
382 Ga0436364_1543144
383 Ga0436365_0052225
384 Ga0436365_0149717
385 Ga0436365_0503704
386 Ga0436365_0625402
387 Ga0436365_1081166
388 Ga0436365_1516261
389 Ga0436365_1531134
390 Ga0436365_1817543
391 Ga0436363_0822672
392 Ga0436363_1155623
393 Ga0436363_1351314
394 Ga0436363_1459061
395 Ga0436362_0745454
396 Ga0436362_0784296
397 Ga0436362_1091508
398 Ga0436362_1101737
399 Ga0436362_1304689
400 Ga0451789_0826484
401 Ga0451791_0560880
402 Ga0451802_0001317
403 Ga0451837_1096143
404 Ga0451843_1582245
405 Ga0451853_0873853
406 Ga0466966_0100858
407 Ga0466966_0585257
408 Ga0466961_0399659
409 Ga0466963_0011698
410 Ga0466963_0337500
411 Ga0466963_0519191
412 Ga0466968_0095150
413 Ga0466968_0252938
414 Ga0466970_0195192
415 Ga0466960_0210661
416 Ga0466960_0478990
417 Ga0466960_0837060
418 Ga0466959_0130213
419 Ga0466959_0169803
420 Ga0466959_0340667
421 Ga0466958_0143845
422 Ga0466967_0036938
423 Ga0466967_0045476
424 Ga0466967_0047586
425 Ga0495582_0075518
426 Ga0495606_0291527
427 Ga0495645_0352610
428 Ga0496101_0279593
429 Ga0496102_0395522
430 Ga0496102_0467135
431 Ga0496105_0212073
432 Ga0496106_0360008
433 Ga0496106_0976202
434 Ga0496110_0163226
435 Ga0496112_0268277
436 Ga0496113_1351056
437 Ga0496114_0488936
438 nmdc:mga08y16_223943_c1
439 nmdc:mga0rr50_826118_c1
440 Ga0466962_0044615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

117

0.92

PF18029

Glyoxalase_6

Glyoxalase-like domain

8

118

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7988 4 116
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7959 1 116
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7904 1 118
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.788 4 119
6a4z-assembly1.cif.gz_B oxidase chap 0.7877 1 119
ID Description Score Start End Superfamily
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7921 8 120 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7857 8 120 3.10.180.10
af_Q9SKZ0_1_135_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7803 4 120 3.10.180.10
af_I1LTD0_10_138_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7779 4 117 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7778 1 55 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7C3AQV9-F1-model_v4 VOC family protein 0.947 70 152
AF-A0A1Q7UGU9-F1-model_v4 Glyoxalase 0.926 15 151
AF-A0A1H1UB47-F1-model_v4 Catechol 2,3-dioxygenase 0.9186 1 152 GO:0051213
AF-A0A7C9RHC7-F1-model_v4 VOC family protein 0.9173 4 107
AF-A0A356A2N8-F1-model_v4 deleted 0.9157 5 55

Map