F332116

General Info

Members Datasets Scaffolds Average Seq Length
220 146 440 168

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_101072773|Ga0075430_1010727731
Length 172
Sequence MASNQRSQVVMSDDEVARFLEQSRIATMATVGADGRPHLVAMWFGLVDGHVYFETKAKSQKAVNLRRDPRITVSVEAGDTYDQLRGVSIDGTTTIIDDPASDEYWVAGVSVFERYQGPYSEDMRPFVEVMMNKRIVVRVDPLRVRSWDHRKLGMDAMPVAGSTAAFLHSAGA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
41 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
42 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
43 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
62 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
63 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
146 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0.45
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.91
Nodule 0
Rhizoplane 0.91
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_101072773 3300006846 Bacteria 663
2 JGI25406J46586_10029669 3300003203 Bacteria 2067
3 Ga0068868_100341138 3300005338 Bacteria 1281
4 Ga0070668_100046085 3300005347 Bacteria 3347
5 Ga0070668_100372157 3300005347 Bacteria 1214
6 Ga0070671_100000097 3300005355 Bacteria 55082
7 Ga0070714_100361464 3300005435 Bacteria 1365
8 Ga0070713_101176805 3300005436 Bacteria 742
9 Ga0070700_100311281 3300005441 Bacteria 1153
10 Ga0070663_100000739 3300005455 Bacteria 17655
11 Ga0070678_100495495 3300005456 Bacteria 1077
12 Ga0070662_100969517 3300005457 Bacteria 727
13 Ga0070707_100202711 3300005468 Bacteria 1934
14 Ga0070707_100415464 3300005468 Bacteria 1306
15 Ga0070695_100096869 3300005545 Bacteria 1980
16 Ga0070665_100903311 3300005548 Bacteria 896
17 Ga0070702_100757751 3300005615 Bacteria 746
18 Ga0068859_100648723 3300005617 Bacteria 1148
19 Ga0068866_10347502 3300005718 Bacteria 941
20 Ga0068863_100428538 3300005841 Bacteria 1296
21 Ga0068858_100120619 3300005842 Bacteria 2452
22 Ga0068862_100972784 3300005844 Bacteria 838
23 Ga0081539_10005818 3300005985 Bacteria 12255
24 Ga0075365_10000305 3300006038 Bacteria 17199
25 Ga0075365_10003495 3300006038 Bacteria 8116
26 Ga0075365_10011769 3300006038 Bacteria 5160
27 Ga0075365_10253222 3300006038 Bacteria 1237
28 Ga0075365_10270270 3300006038 Bacteria 1196
29 Ga0075365_10335281 3300006038 Bacteria 1066
30 Ga0075365_10412881 3300006038 Bacteria 953
31 Ga0075365_10414358 3300006038 Bacteria 951
32 Ga0075365_10605615 3300006038 Bacteria 775
33 Ga0075363_100052678 3300006048 Bacteria 2172
34 Ga0075363_100057930 3300006048 Bacteria 2080
35 Ga0075363_100440413 3300006048 Bacteria 769
36 Ga0075363_100508655 3300006048 Bacteria 716
37 Ga0075364_10003526 3300006051 Bacteria 8902
38 Ga0075364_10004366 3300006051 Bacteria 8119
39 Ga0075364_10163912 3300006051 Bacteria 1501
40 Ga0075364_10209642 3300006051 Bacteria 1321
41 Ga0075362_10000892 3300006177 Bacteria 9054
42 Ga0075362_10046163 3300006177 Bacteria 1937
43 Ga0075367_10028280 3300006178 Bacteria 3197
44 Ga0075367_10078425 3300006178 Bacteria 1995
45 Ga0075367_10158261 3300006178 Bacteria 1408
46 Ga0075367_10415749 3300006178 Bacteria 851
47 Ga0075367_10703779 3300006178 Bacteria 643
48 Ga0075369_10044763 3300006186 Bacteria 1902
49 Ga0075369_10103052 3300006186 Bacteria 1282
50 Ga0075370_10089534 3300006353 Bacteria 1775
51 Ga0075370_10129039 3300006353 Bacteria 1475
52 Ga0075370_10334872 3300006353 Bacteria 903
53 Ga0075428_100093076 3300006844 Bacteria 3286
54 Ga0075428_100488399 3300006844 Bacteria 1318
55 Ga0075430_100341792 3300006846 Bacteria 1236
56 Ga0075430_100346266 3300006846 Bacteria 1227
57 Ga0075434_100081566 3300006871 Bacteria 3232
58 Ga0075434_100313218 3300006871 Bacteria 1590
59 Ga0068865_100901257 3300006881 Bacteria 769
60 Ga0097620_100648746 3300006931 Bacteria 1148
61 Ga0075435_100123415 3300007076 Bacteria 2163
62 Ga0075435_101439474 3300007076 Bacteria 604
63 Ga0111539_10002094 3300009094 Bacteria 26666
64 Ga0111539_10122174 3300009094 Bacteria 3052
65 Ga0111539_10653931 3300009094 Bacteria 1224
66 Ga0114129_10559141 3300009147 Bacteria 1487
67 Ga0114129_10837908 3300009147 Bacteria 1170
68 Ga0114129_11513333 3300009147 Bacteria 824
69 Ga0105243_11672587 3300009148 Bacteria 665
70 Ga0105242_10009779 3300009176 Bacteria 7349
71 Ga0105242_10748768 3300009176 Bacteria 962
72 Ga0105249_10765171 3300009553 Bacteria 1028
73 Ga0105246_10058832 3300011119 Bacteria 2664
74 Ga0157325_1016992 3300012485 Bacteria 611
75 Ga0157345_1006168 3300012498 Bacteria 947
76 Ga0157313_1000469 3300012503 Bacteria 1866
77 Ga0157326_1017888 3300012513 Bacteria 851
78 Ga0157380_10145982 3300014326 Bacteria 2039
79 Ga0157376_10563511 3300014969 Bacteria 1129
80 Ga0206353_11840378 3300020082 Bacteria 1316
81 Ga0207680_10706029 3300025903 Bacteria 723
82 Ga0207646_10218875 3300025922 Bacteria 1720
83 Ga0207646_10514792 3300025922 Bacteria 1077
84 Ga0207664_10418115 3300025929 Bacteria 1194
85 Ga0207644_10029046 3300025931 Bacteria 3833
86 Ga0207686_10393191 3300025934 Bacteria 1054
87 Ga0207686_10487874 3300025934 Bacteria 954
88 Ga0207704_11356620 3300025938 Bacteria 609
89 Ga0207712_10723916 3300025961 Bacteria 870
90 Ga0207668_10216000 3300025972 Bacteria 1537
91 Ga0207668_10306994 3300025972 Bacteria 1311
92 Ga0207703_10001521 3300026035 Bacteria 21062
93 Ga0207678_10000145 3300026067 Bacteria 58214
94 Ga0207708_10313400 3300026075 Bacteria 1279
95 Ga0207708_10952592 3300026075 Bacteria 744
96 Ga0207683_10620566 3300026121 Bacteria 1001
97 Ga0207428_10179392 3300027907 Bacteria 1601
98 Ga0268265_10650858 3300028380 Bacteria 1013
99 Ga0316176_1153422 3300030732 Bacteria 5314
100 Ga0314311_1060991 3300030733 Bacteria 7568
101 Ga0316180_1164966 3300030736 Bacteria 1232
102 Ga0265325_10003908 3300031241 Bacteria 9550
103 Ga0265339_10002980 3300031249 Bacteria 11964
104 Ga0265327_10010634 3300031251 Bacteria 6441
105 Ga0265316_10401314 3300031344 Bacteria 987
106 Ga0307513_10215318 3300031456 Bacteria 1748
107 Ga0307513_10883032 3300031456 Bacteria 601
108 Ga0265314_10117601 3300031711 Bacteria 1679
109 Ga0307406_10896657 3300031901 Bacteria 755
110 Ga0307409_101298831 3300031995 Bacteria 753
111 Ga0373936_0235484 3300035113 Bacteria 815
112 Ga0373955_0321208 3300035172 Bacteria 935
113 Ga0373927_0075545 3300035695 Bacteria 2182
114 Ga0373927_0470427 3300035695 Unclassified 830
115 Ga0373933_0256765 3300035724 Bacteria 1126
116 Ga0373933_0320509 3300035724 Bacteria 1005
117 Ga0373937_0006706 3300036401 Bacteria 9937
118 Ga0373937_0267918 3300036401 Bacteria 1612
119 Ga0373925_0714732 3300037068 Bacteria 826
120 Ga0436365_0575191 3300039437 Bacteria 635
121 Ga0439461_0045276 3300041410 Bacteria 962
122 Ga0451791_1843169 3300041451 Bacteria 661
123 Ga0451843_1167085 3300041509 Bacteria 614
124 Ga0439434_0005211 3300042435 Bacteria 3801
125 Ga0466972_0126962 3300044658 Bacteria 1202
126 Ga0466972_0169250 3300044658 Bacteria 1026
127 Ga0466961_0347307 3300044693 Bacteria 903
128 Ga0466963_0062576 3300044694 Bacteria 2489
129 Ga0466970_0254014 3300044765 Bacteria 985
130 Ga0466957_0697810 3300044842 Bacteria 716
131 Ga0495592_0220182 3300046454 Bacteria 1270
132 Ga0495651_0007505 3300046462 Bacteria 8340
133 Ga0495653_0313843 3300046463 Bacteria 1018
134 Ga0495653_0366709 3300046463 Bacteria 923
135 Ga0495653_0467534 3300046463 Bacteria 791
136 Ga0495662_0357990 3300046476 Bacteria 717
137 Ga0495664_0182804 3300046477 Bacteria 1271
138 Ga0495664_0198618 3300046477 Bacteria 1216
139 Ga0495608_0010716 3300046511 Bacteria 6395
140 Ga0495618_0113997 3300046514 Bacteria 1731
141 Ga0495618_0193541 3300046514 Bacteria 1289
142 Ga0495630_0009966 3300046517 Bacteria 6842
143 Ga0495630_0852021 3300046517 Bacteria 695
144 Ga0495640_0043400 3300046533 Bacteria 3132
145 Ga0495587_0058980 3300046536 Bacteria 2254
146 Ga0495645_0537200 3300046543 Bacteria 726
147 Ga0495667_0035352 3300046559 Bacteria 3339
148 Ga0495634_0000689 3300046642 Bacteria 32856
149 Ga0495635_0153275 3300046663 Bacteria 1569
150 Ga0495635_0641495 3300046663 Bacteria 691
151 Ga0495657_0008938 3300046675 Bacteria 7623
152 Ga0495599_0246764 3300046678 Bacteria 1088
153 Ga0495623_0008443 3300046679 Bacteria 6691
154 Ga0495658_0454047 3300046683 Bacteria 819
155 Ga0495613_0000554 3300046689 Bacteria 30746
156 Ga0495600_0362449 3300046809 Bacteria 906
157 Ga0495604_0089123 3300047317 Bacteria 2294
158 Ga0495680_0008024 3300047322 Bacteria 9628
159 Ga0495675_0051699 3300047444 Bacteria 2609
160 Ga0495684_0321633 3300047471 Bacteria 1106
161 Ga0495602_0218286 3300048088 Bacteria 1441
162 Ga0496112_0083881 3300048915 Bacteria 3152
163 Ga0496125_0227202 3300048928 Bacteria 1197
164 Ga0501033_0150563 3300049570 Bacteria 1679
165 Ga0501034_0004567 3300049571 Bacteria 15348
166 Ga0501034_0010612 3300049571 Bacteria 9586
167 Ga0501034_0055658 3300049571 Bacteria 3980
168 Ga0501037_0188709 3300049573 Bacteria 1460
169 Ga0501047_0602624 3300049581 Bacteria 920
170 Ga0501070_0259175 3300049586 Bacteria 1421
171 Ga0501070_0347525 3300049586 Bacteria 1204
172 Ga0501070_0511148 3300049586 Bacteria 964
173 Ga0501072_0068962 3300049588 Bacteria 2791
174 Ga0501073_0009591 3300049589 Bacteria 7139
175 Ga0501074_0002343 3300049590 Bacteria 13180
176 Ga0501077_0413177 3300049593 Bacteria 863
177 Ga0501080_0084098 3300049742 Bacteria 2957
178 Ga0501080_0125398 3300049742 Bacteria 2378
179 Ga0501083_0129610 3300049744 Bacteria 1653
180 nmdc:mga03683_10924_c1 3300050489 Bacteria 3268
181 nmdc:mga03683_40348_c1 3300050489 Bacteria 1914
182 nmdc:mga03n38_127721_c1 3300050490 Bacteria 1257
183 nmdc:mga03n38_21172_c1 3300050490 Bacteria 2613
184 nmdc:mga03n38_359757_c1 3300050490 Bacteria 794
185 nmdc:mga00v17_122403_c1 3300050491 Bacteria 1658
186 nmdc:mga00v17_134980_c1 3300050491 Bacteria 1579
187 nmdc:mga00v17_323703_c1 3300050491 Bacteria 1002
188 nmdc:mga00v17_427852_c1 3300050491 Bacteria 860
189 nmdc:mga00v17_48713_c1 3300050491 Bacteria 2569
190 nmdc:mga00v17_600574_c1 3300050491 Bacteria 710
191 nmdc:mga0yw44_148444_c1 3300050492 Bacteria 1528
192 nmdc:mga0yw44_1534_c1 3300050492 Bacteria 9230
193 nmdc:mga0yw44_23036_c1 3300050492 Bacteria 3503
194 nmdc:mga0yw44_252235_c1 3300050492 Bacteria 1175
195 nmdc:mga0yw44_519513_c1 3300050492 Bacteria 808
196 nmdc:mga0yw44_912706_c1 3300050492 Bacteria 595
197 nmdc:mga0k408_336330_c1 3300050493 Bacteria 900
198 nmdc:mga06z11_156225_c1 3300050494 Bacteria 1301
199 nmdc:mga06z11_244882_c1 3300050494 Bacteria 1054
200 nmdc:mga06z11_284662_c1 3300050494 Bacteria 980
201 nmdc:mga07m45_352624_c1 3300050496 Bacteria 855
202 nmdc:mga07m45_433492_c1 3300050496 Bacteria 762
203 nmdc:mga07m45_74754_c1 3300050496 Bacteria 1930
204 nmdc:mga05p37_1214822_c1 3300050507 Bacteria 777
205 nmdc:mga05p37_288096_c1 3300050507 Bacteria 1955
206 nmdc:mga08y16_124787_c1 3300050511 Bacteria 2678
207 nmdc:mga08y16_43003_c1 3300050511 Bacteria 3312
208 nmdc:mga0n895_138563_c1 3300050512 Bacteria 2460
209 nmdc:mga0n895_154634_c1 3300050512 Bacteria 2324
210 nmdc:mga0rr50_1271647_c1 3300050513 Bacteria 624
211 nmdc:mga0a205_1298706_c1 3300050515 Bacteria 575
212 nmdc:mga0sz30_32955_c1 3300050516 Bacteria 2151
213 Ga0495601_0383809 3300053077 Bacteria 912
214 Ga0500635_0288144 3300053080 Bacteria 647
215 Ga0495595_0009564 3300053084 Bacteria 4015
216 Ga0495619_0031927 3300053085 Bacteria 3414
217 Ga0500577_0122219 3300053142 Bacteria 1084
218 Ga0500604_0127868 3300053151 Bacteria 853
219 2645723448 2643221962 Bacteria 3874254
220 2899368382 2899359706 Bacteria 10940472
221 Ga0075430_101072773
222 JGI25406J46586_10029669
223 Ga0068868_100341138
224 Ga0070668_100046085
225 Ga0070668_100372157
226 Ga0070671_100000097
227 Ga0070714_100361464
228 Ga0070713_101176805
229 Ga0070700_100311281
230 Ga0070663_100000739
231 Ga0070678_100495495
232 Ga0070662_100969517
233 Ga0070707_100202711
234 Ga0070707_100415464
235 Ga0070695_100096869
236 Ga0070665_100903311
237 Ga0070702_100757751
238 Ga0068859_100648723
239 Ga0068866_10347502
240 Ga0068863_100428538
241 Ga0068858_100120619
242 Ga0068862_100972784
243 Ga0081539_10005818
244 Ga0075365_10000305
245 Ga0075365_10003495
246 Ga0075365_10011769
247 Ga0075365_10253222
248 Ga0075365_10270270
249 Ga0075365_10335281
250 Ga0075365_10412881
251 Ga0075365_10414358
252 Ga0075365_10605615
253 Ga0075363_100052678
254 Ga0075363_100057930
255 Ga0075363_100440413
256 Ga0075363_100508655
257 Ga0075364_10003526
258 Ga0075364_10004366
259 Ga0075364_10163912
260 Ga0075364_10209642
261 Ga0075362_10000892
262 Ga0075362_10046163
263 Ga0075367_10028280
264 Ga0075367_10078425
265 Ga0075367_10158261
266 Ga0075367_10415749
267 Ga0075367_10703779
268 Ga0075369_10044763
269 Ga0075369_10103052
270 Ga0075370_10089534
271 Ga0075370_10129039
272 Ga0075370_10334872
273 Ga0075428_100093076
274 Ga0075428_100488399
275 Ga0075430_100341792
276 Ga0075430_100346266
277 Ga0075434_100081566
278 Ga0075434_100313218
279 Ga0068865_100901257
280 Ga0097620_100648746
281 Ga0075435_100123415
282 Ga0075435_101439474
283 Ga0111539_10002094
284 Ga0111539_10122174
285 Ga0111539_10653931
286 Ga0114129_10559141
287 Ga0114129_10837908
288 Ga0114129_11513333
289 Ga0105243_11672587
290 Ga0105242_10009779
291 Ga0105242_10748768
292 Ga0105249_10765171
293 Ga0105246_10058832
294 Ga0157325_1016992
295 Ga0157345_1006168
296 Ga0157313_1000469
297 Ga0157326_1017888
298 Ga0157380_10145982
299 Ga0157376_10563511
300 Ga0206353_11840378
301 Ga0207680_10706029
302 Ga0207646_10218875
303 Ga0207646_10514792
304 Ga0207664_10418115
305 Ga0207644_10029046
306 Ga0207686_10393191
307 Ga0207686_10487874
308 Ga0207704_11356620
309 Ga0207712_10723916
310 Ga0207668_10216000
311 Ga0207668_10306994
312 Ga0207703_10001521
313 Ga0207678_10000145
314 Ga0207708_10313400
315 Ga0207708_10952592
316 Ga0207683_10620566
317 Ga0207428_10179392
318 Ga0268265_10650858
319 Ga0316176_1153422
320 Ga0314311_1060991
321 Ga0316180_1164966
322 Ga0265325_10003908
323 Ga0265339_10002980
324 Ga0265327_10010634
325 Ga0265316_10401314
326 Ga0307513_10215318
327 Ga0307513_10883032
328 Ga0265314_10117601
329 Ga0307406_10896657
330 Ga0307409_101298831
331 Ga0373936_0235484
332 Ga0373955_0321208
333 Ga0373927_0075545
334 Ga0373927_0470427
335 Ga0373933_0256765
336 Ga0373933_0320509
337 Ga0373937_0006706
338 Ga0373937_0267918
339 Ga0373925_0714732
340 Ga0436365_0575191
341 Ga0439461_0045276
342 Ga0451791_1843169
343 Ga0451843_1167085
344 Ga0439434_0005211
345 Ga0466972_0126962
346 Ga0466972_0169250
347 Ga0466961_0347307
348 Ga0466963_0062576
349 Ga0466970_0254014
350 Ga0466957_0697810
351 Ga0495592_0220182
352 Ga0495651_0007505
353 Ga0495653_0313843
354 Ga0495653_0366709
355 Ga0495653_0467534
356 Ga0495662_0357990
357 Ga0495664_0182804
358 Ga0495664_0198618
359 Ga0495608_0010716
360 Ga0495618_0113997
361 Ga0495618_0193541
362 Ga0495630_0009966
363 Ga0495630_0852021
364 Ga0495640_0043400
365 Ga0495587_0058980
366 Ga0495645_0537200
367 Ga0495667_0035352
368 Ga0495634_0000689
369 Ga0495635_0153275
370 Ga0495635_0641495
371 Ga0495657_0008938
372 Ga0495599_0246764
373 Ga0495623_0008443
374 Ga0495658_0454047
375 Ga0495613_0000554
376 Ga0495600_0362449
377 Ga0495604_0089123
378 Ga0495680_0008024
379 Ga0495675_0051699
380 Ga0495684_0321633
381 Ga0495602_0218286
382 Ga0496112_0083881
383 Ga0496125_0227202
384 Ga0501033_0150563
385 Ga0501034_0004567
386 Ga0501034_0010612
387 Ga0501034_0055658
388 Ga0501037_0188709
389 Ga0501047_0602624
390 Ga0501070_0259175
391 Ga0501070_0347525
392 Ga0501070_0511148
393 Ga0501072_0068962
394 Ga0501073_0009591
395 Ga0501074_0002343
396 Ga0501077_0413177
397 Ga0501080_0084098
398 Ga0501080_0125398
399 Ga0501083_0129610
400 nmdc:mga03683_10924_c1
401 nmdc:mga03683_40348_c1
402 nmdc:mga03n38_127721_c1
403 nmdc:mga03n38_21172_c1
404 nmdc:mga03n38_359757_c1
405 nmdc:mga00v17_122403_c1
406 nmdc:mga00v17_134980_c1
407 nmdc:mga00v17_323703_c1
408 nmdc:mga00v17_427852_c1
409 nmdc:mga00v17_48713_c1
410 nmdc:mga00v17_600574_c1
411 nmdc:mga0yw44_148444_c1
412 nmdc:mga0yw44_1534_c1
413 nmdc:mga0yw44_23036_c1
414 nmdc:mga0yw44_252235_c1
415 nmdc:mga0yw44_519513_c1
416 nmdc:mga0yw44_912706_c1
417 nmdc:mga0k408_336330_c1
418 nmdc:mga06z11_156225_c1
419 nmdc:mga06z11_244882_c1
420 nmdc:mga06z11_284662_c1
421 nmdc:mga07m45_352624_c1
422 nmdc:mga07m45_433492_c1
423 nmdc:mga07m45_74754_c1
424 nmdc:mga05p37_1214822_c1
425 nmdc:mga05p37_288096_c1
426 nmdc:mga08y16_124787_c1
427 nmdc:mga08y16_43003_c1
428 nmdc:mga0n895_138563_c1
429 nmdc:mga0n895_154634_c1
430 nmdc:mga0rr50_1271647_c1
431 nmdc:mga0a205_1298706_c1
432 nmdc:mga0sz30_32955_c1
433 Ga0495601_0383809
434 Ga0500635_0288144
435 Ga0495595_0009564
436 Ga0495619_0031927
437 Ga0500577_0122219
438 Ga0500604_0127868
439 2645723448
440 2899368382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

12

100

0.97

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

12

145

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.9625 3 161
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.9508 3 161
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8736 14 145
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8728 11 144
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.838 6 145
ID Description Score Start End Superfamily
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9882 10 156 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9816 10 156 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9738 11 155 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9665 11 155 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8442 11 142 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A521MI06-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9884 1 119 GO:0005829
GO:0016627
GO:0070967
AF-A0A521MI06-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9803 1 119 GO:0005829
GO:0016627
GO:0070967
AF-A0A7I7U0P2-F1-model_v4 PPOX class F420-dependent enzyme 0.9724 11 165 GO:0005829
GO:0016627
GO:0070967
AF-A0A522BB31-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9713 1 99 GO:0005829
GO:0016627
GO:0070967
AF-A0A850PM65-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9689 1 165 GO:0005829
GO:0016627
GO:0070967

Map