F331969

General Info

Members Datasets Scaffolds Average Seq Length
220 144 198 327

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100030043|Ga0068867_1000300432
Length 338
Sequence MSQAASYAVSLVLPVFNEEQVLDELLRRLRLMLELQDQAGRWEVIFVNDGSIDATRQHIERACQTEPRFRLINLSRNFGHQIAITAGIDRADGEAVVVMDADLQDPPELIAEMLQRYSEGYDVVYAVRRQRHGEGWFKRASAALFYRMLKRVVGVDIPADTGDFRLMSRRAVLALRGLREANRFVRGLVAWVGFRQTAVHYDRSARFAGDTHYPLRKMLRFASDGIVSFSTLPLRVATLLGLLSGLAALGVALWVLFVVLTGVQAVPGWATLMIAVSLASGAQLLMIGILGEYLGRVYDEVKRRPLYLVDATQNFAPRTESSAGAGPLGESGDPRSRR

Samples

Sample ID Description Type Environment
1 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
2 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
3 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
4 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
5 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
6 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
7 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
8 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
9 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
10 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
11 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
12 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
13 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
14 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
15 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
16 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
17 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
18 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
19 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
20 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
21 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
22 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 9.55
Rhizoplane 8.18
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10220533 3300003322 Bacteria 2334
2 Ga0070683_100020607 3300005329 Bacteria 5868
3 Ga0070683_100107979 3300005329 Bacteria 2624
4 Ga0070680_100010371 3300005336 Bacteria 7182
5 Ga0068868_100071702 3300005338 Bacteria 2763
6 Ga0070660_100119682 3300005339 Bacteria 2101
7 Ga0070668_100255591 3300005347 Bacteria 1455
8 Ga0070675_100216082 3300005354 Bacteria 1668
9 Ga0070659_100074010 3300005366 Bacteria 2713
10 Ga0070709_10011348 3300005434 Bacteria 4962
11 Ga0070714_100035357 3300005435 Unclassified 4187
12 Ga0070714_100199484 3300005435 Bacteria 1830
13 Ga0070710_10170233 3300005437 Bacteria 1357
14 Ga0070711_100090204 3300005439 Bacteria 2207
15 Ga0070711_100268143 3300005439 Bacteria 1346
16 Ga0070663_100043013 3300005455 Bacteria 3177
17 Ga0070681_10017992 3300005458 Bacteria 7061
18 Ga0068867_100030043 3300005459 Bacteria 3919
19 Ga0070685_10088941 3300005466 Bacteria 1866
20 Ga0070685_10216719 3300005466 Bacteria 1252
21 Ga0070679_100017648 3300005530 Bacteria 6909
22 Ga0070684_100042123 3300005535 Bacteria 3940
23 Ga0070696_100138923 3300005546 Bacteria 1774
24 Ga0068855_100019205 3300005563 Bacteria 8214
25 Ga0068857_100011306 3300005577 Bacteria 7766
26 Ga0068856_100111659 3300005614 Bacteria 2731
27 Ga0070702_100054571 3300005615 Bacteria 2300
28 Ga0068861_100117021 3300005719 Bacteria 2144
29 Ga0068860_100011305 3300005843 Bacteria 8797
30 Ga0081539_10045861 3300005985 Bacteria 2510
31 Ga0070717_10018368 3300006028 Bacteria 5458
32 Ga0075432_10030520 3300006058 Bacteria 1863
33 Ga0070712_100014621 3300006175 Bacteria 5037
34 Ga0070712_100039170 3300006175 Bacteria 3243
35 Ga0070712_100156578 3300006175 Bacteria 1755
36 Ga0070712_100302023 3300006175 Bacteria 1296
37 Ga0075428_100332952 3300006844 Bacteria 1631
38 Ga0075431_100061844 3300006847 Bacteria 3863
39 Ga0075433_10150924 3300006852 Bacteria 2067
40 Ga0075434_100009604 3300006871 Bacteria 9032
41 Ga0075434_100074193 3300006871 Bacteria 3395
42 Ga0075434_100532087 3300006871 Bacteria 1195
43 Ga0075436_100049923 3300006914 Bacteria 2887
44 Ga0075435_100067070 3300007076 Bacteria 2921
45 Ga0075435_100073847 3300007076 Bacteria 2789
46 Ga0111539_10120864 3300009094 Bacteria 3069
47 Ga0105245_10005381 3300009098 Bacteria 11251
48 Ga0105245_10008957 3300009098 Bacteria 8727
49 Ga0105245_10070559 3300009098 Unclassified 3171
50 Ga0114129_10046862 3300009147 Bacteria 6075
51 Ga0114129_10077006 3300009147 Bacteria 4641
52 Ga0114129_10536773 3300009147 Bacteria 1523
53 Ga0114129_10629500 3300009147 Bacteria 1387
54 Ga0105243_10065163 3300009148 Bacteria 2926
55 Ga0105239_10011998 3300010375 Bacteria 9662
56 Ga0105239_10208655 3300010375 Bacteria 2189
57 Ga0105246_10127592 3300011119 Bacteria 1895
58 Ga0157372_10018584 3300013307 Bacteria 7478
59 Ga0163163_10131537 3300014325 Bacteria 2542
60 Ga0157377_10053327 3300014745 Bacteria 2286
61 Ga0207692_10084493 3300025898 Bacteria 1705
62 Ga0207692_10093529 3300025898 Bacteria 1635
63 Ga0207688_10010721 3300025901 Bacteria 4988
64 Ga0207699_10281473 3300025906 Bacteria 1156
65 Ga0207707_10039820 3300025912 Bacteria 4107
66 Ga0207693_10017318 3300025915 Bacteria 5747
67 Ga0207693_10079437 3300025915 Bacteria 2567
68 Ga0207663_10189127 3300025916 Bacteria 1477
69 Ga0207663_10274550 3300025916 Bacteria 1250
70 Ga0207652_10019330 3300025921 Bacteria 5602
71 Ga0207687_10046776 3300025927 Bacteria 2997
72 Ga0207664_10366192 3300025929 Bacteria 1278
73 Ga0207690_10009476 3300025932 Bacteria 5783
74 Ga0207706_10087011 3300025933 Bacteria 2747
75 Ga0207709_10061926 3300025935 Bacteria 2340
76 Ga0207709_10204925 3300025935 Bacteria 1411
77 Ga0207670_10446316 3300025936 Bacteria 1042
78 Ga0207665_10128731 3300025939 Bacteria 1795
79 Ga0207679_10195150 3300025945 Bacteria 1687
80 Ga0207667_10118261 3300025949 Bacteria 2731
81 Ga0207677_10037540 3300026023 Bacteria 3167
82 Ga0207677_10125797 3300026023 Bacteria 1937
83 Ga0207678_10036573 3300026067 Bacteria 4274
84 Ga0207708_10149257 3300026075 Bacteria 1839
85 Ga0207648_10017238 3300026089 Bacteria 6580
86 Ga0207648_10101538 3300026089 Bacteria 2521
87 Ga0207674_10006420 3300026116 Bacteria 13831
88 Ga0207675_100084458 3300026118 Bacteria 2979
89 Ga0265318_10017470 3300028577 Bacteria 2944
90 Ga0265338_10046611 3300028800 Bacteria 3970
91 Ga0316576_10055833 3300031727 Unclassified 2883
92 Ga0307405_10146003 3300031731 Bacteria 1657
93 Ga0395899_0042581 3300037312 Bacteria 3389
94 Ga0395899_0134636 3300037312 Unclassified 1762
95 Ga0395899_0141217 3300037312 Bacteria 1713
96 Ga0395899_0174400 3300037312 Bacteria 1513
97 Ga0395899_0213986 3300037312 Bacteria 1338
98 Ga0395900_0002633 3300037418 Bacteria 19594
99 Ga0395900_0015582 3300037418 Bacteria 7748
100 Ga0395900_0016861 3300037418 Bacteria 7454
101 Ga0395900_0040257 3300037418 Bacteria 4816
102 Ga0395900_0050772 3300037418 Bacteria 4272
103 Ga0395900_0063569 3300037418 Bacteria 3794
104 Ga0395900_0082070 3300037418 Bacteria 3312
105 Ga0395898_0003140 3300037466 Bacteria 18658
106 Ga0395898_0036273 3300037466 Bacteria 4896
107 Ga0395898_0062603 3300037466 Bacteria 3613
108 Ga0395898_0085986 3300037466 Bacteria 3031
109 Ga0395898_0234124 3300037466 Bacteria 1751
110 Ga0395905_0004627 3300037471 Bacteria 14233
111 Ga0395905_0011573 3300037471 Bacteria 8522
112 Ga0395905_0013257 3300037471 Bacteria 7906
113 Ga0395905_0019770 3300037471 Bacteria 6384
114 Ga0395905_0045294 3300037471 Bacteria 4126
115 Ga0395905_0092669 3300037471 Bacteria 2833
116 Ga0395905_0185209 3300037471 Bacteria 1954
117 Ga0395905_0269085 3300037471 Bacteria 1590
118 Ga0395901_0002742 3300038443 Bacteria 17769
119 Ga0395901_0003054 3300038443 Bacteria 16863
120 Ga0395901_0005153 3300038443 Bacteria 13189
121 Ga0395901_0014733 3300038443 Bacteria 7947
122 Ga0395901_0022702 3300038443 Bacteria 6434
123 Ga0395901_0044750 3300038443 Bacteria 4591
124 Ga0395901_0058912 3300038443 Bacteria 3995
125 Ga0395901_0066285 3300038443 Bacteria 3761
126 Ga0395901_0163768 3300038443 Bacteria 2335
127 Ga0395901_0283567 3300038443 Bacteria 1720
128 Ga0395901_0384420 3300038443 Bacteria 1444
129 Ga0395901_0489521 3300038443 Bacteria 1253
130 Ga0395901_0605444 3300038443 Unclassified 1104
131 Ga0451853_0817129 3300041512 Bacteria 1897
132 Ga0495603_0048379 3300046455 Bacteria 2532
133 Ga0495603_0081260 3300046455 Bacteria 1899
134 Ga0495641_0008000 3300046461 Bacteria 6518
135 Ga0495641_0016320 3300046461 Bacteria 3916
136 Ga0495582_0010986 3300046473 Bacteria 4984
137 Ga0495639_0069700 3300046475 Bacteria 1622
138 Ga0495584_0046205 3300046491 Bacteria 2196
139 Ga0495606_0001302 3300046507 Bacteria 34396
140 Ga0495616_0039951 3300046513 Bacteria 2400
141 Ga0495644_0033237 3300046523 Bacteria 1949
142 Ga0495644_0052294 3300046523 Bacteria 1534
143 Ga0495663_0004233 3300046525 Bacteria 4049
144 Ga0495586_0019834 3300046535 Bacteria 3581
145 Ga0495668_0000182 3300046616 Bacteria 93763
146 Ga0495634_0144008 3300046642 Bacteria 1511
147 Ga0495625_0002750 3300046660 Bacteria 18611
148 Ga0495659_0022787 3300046664 Bacteria 2123
149 Ga0495659_0040557 3300046664 Bacteria 1660
150 Ga0495647_0025236 3300046681 Bacteria 2170
151 Ga0495647_0122329 3300046681 Bacteria 1096
152 Ga0495658_0016131 3300046683 Bacteria 3844
153 Ga0495624_0092850 3300046690 Bacteria 1861
154 Ga0495624_0106618 3300046690 Bacteria 1724
155 Ga0495624_0257836 3300046690 Bacteria 1054
156 Ga0495589_0175907 3300046794 Bacteria 1016
157 Ga0495581_0004050 3300047315 Bacteria 8438
158 Ga0495674_0084287 3300047319 Bacteria 2724
159 Ga0495672_0194828 3300047320 Bacteria 1017
160 Ga0495680_0003126 3300047322 Bacteria 16492
161 Ga0495684_0136072 3300047471 Bacteria 1844
162 Ga0495686_0008141 3300047472 Bacteria 7750
163 Ga0495626_0000286 3300048091 Bacteria 54819
164 Ga0496102_0469390 3300048905 Bacteria 1179
165 Ga0496103_0104514 3300048906 Bacteria 1795
166 Ga0496103_0192183 3300048906 Bacteria 1312
167 Ga0496104_0003843 3300048907 Bacteria 12996
168 Ga0496105_0000856 3300048908 Bacteria 20766
169 Ga0496108_0083532 3300048911 Bacteria 2709
170 Ga0496109_0058209 3300048912 Bacteria 3530
171 Ga0496109_0236657 3300048912 Bacteria 1718
172 Ga0496110_0036855 3300048913 Bacteria 4249
173 Ga0496110_0138851 3300048913 Bacteria 2197
174 Ga0496111_0020625 3300048914 Bacteria 4590
175 Ga0496111_0102403 3300048914 Bacteria 2105
176 Ga0496111_0109923 3300048914 Bacteria 2030
177 Ga0496112_0035075 3300048915 Bacteria 4883
178 Ga0496112_0061696 3300048915 Bacteria 3697
179 Ga0496112_0202256 3300048915 Bacteria 1945
180 Ga0496112_0270420 3300048915 Bacteria 1648
181 Ga0496113_0094624 3300048916 Bacteria 2308
182 nmdc:mga03683_141617_c1 3300050489 Bacteria 1081
183 nmdc:mga05p37_1791_c1 3300050507 Bacteria 25083
184 nmdc:mga0qj67_55398_c1 3300050509 Bacteria 3141
185 nmdc:mga06r32_387648_c1 3300050510 Bacteria 1380
186 nmdc:mga0n895_114978_c1 3300050512 Bacteria 2709
187 nmdc:mga0n895_125722_c1 3300050512 Bacteria 2588
188 nmdc:mga0n895_16145_c1 3300050512 Bacteria 6843
189 nmdc:mga0n895_53622_c1 3300050512 Bacteria 3963
190 nmdc:mga0rr50_138313_c1 3300050513 Bacteria 1957
191 nmdc:mga0rr50_178742_c1 3300050513 Bacteria 1734
192 nmdc:mga0rr50_60855_c1 3300050513 Bacteria 2842
193 nmdc:mga08x19_84772_c1 3300050514 Bacteria 2085
194 nmdc:mga0a205_126163_c1 3300050515 Bacteria 2459
195 nmdc:mga0a205_170485_c1 3300050515 Bacteria 2073
196 Ga0495601_0122004 3300053077 Bacteria 1693
197 Ga0500555_042250 3300053103 Bacteria 1266
198 Ga0500588_0044355 3300053146 Bacteria 1356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_10446316 Ga0207670_104463162 272
2 3300050489 nmdc:mga03683_141617_c1 nmdc:mga03683_141617_c1_44_904 279
3 iso_pu_bacteria 2885342637 2885344904 281
4 3300046642 Ga0495634_0144008 Ga0495634_0144008_19_891 285
5 3300009147 Ga0114129_10629500 Ga0114129_106295002 290
6 3300038443 Ga0395901_0163768 Ga0395901_0163768_307_1218 295
7 3300046455 Ga0495603_0081260 Ga0495603_0081260_963_1886 295
8 3300046523 Ga0495644_0052294 Ga0495644_0052294_418_1329 295
9 3300046664 Ga0495659_0022787 Ga0495659_0022787_1109_2020 295
10 3300031727 Ga0316576_10055833 Ga0316576_100558332 296
11 3300041512 Ga0451853_0817129 Ga0451853_0817129_92_1027 303
12 3300048914 Ga0496111_0102403 Ga0496111_0102403_1169_2095 303
13 3300005347 Ga0070668_100255591 Ga0070668_1002555912 306
14 3300006175 Ga0070712_100039170 Ga0070712_1000391705 306
15 3300025915 Ga0207693_10079437 Ga0207693_100794374 306
16 3300025916 Ga0207663_10274550 Ga0207663_102745501 306
17 3300038443 Ga0395901_0605444 Ga0395901_0605444_65_1012 307
18 3300048915 Ga0496112_0061696 Ga0496112_0061696_2324_3271 307
19 3300037471 Ga0395905_0019770 Ga0395905_0019770_1424_2383 309
20 3300038443 Ga0395901_0022702 Ga0395901_0022702_4463_5422 309
21 3300037418 Ga0395900_0050772 Ga0395900_0050772_1466_2428 312
22 3300050509 nmdc:mga0qj67_55398_c1 nmdc:mga0qj67_55398_c1_440_1399 313
23 iso_pu_bacteria 2871495908 2871497180 313
24 iso_pu_bacteria 2878760144 2878761401 313
25 iso_pu_bacteria 2878767105 2878768368 313
26 iso_pu_bacteria 2885305155 2885310987 313
27 iso_pu_bacteria 2885326080 2885329502 313
28 iso_pu_bacteria 2903540706 2903541975 313
29 3300005435 Ga0070714_100035357 Ga0070714_1000353573 314
30 3300047472 Ga0495686_0008141 Ga0495686_0008141_1254_2204 315
31 3300005329 Ga0070683_100020607 Ga0070683_1000206072 316
32 3300005354 Ga0070675_100216082 Ga0070675_1002160822 316
33 3300025901 Ga0207688_10010721 Ga0207688_100107213 316
34 3300037471 Ga0395905_0185209 Ga0395905_0185209_109_1086 316
35 3300046461 Ga0495641_0016320 Ga0495641_0016320_1029_1982 316
36 3300046473 Ga0495582_0010986 Ga0495582_0010986_2055_3008 316
37 3300046475 Ga0495639_0069700 Ga0495639_0069700_433_1386 316
38 3300046491 Ga0495584_0046205 Ga0495584_0046205_743_1696 316
39 3300046513 Ga0495616_0039951 Ga0495616_0039951_1073_2026 316
40 3300046525 Ga0495663_0004233 Ga0495663_0004233_57_1010 316
41 3300046535 Ga0495586_0019834 Ga0495586_0019834_500_1453 316
42 3300046664 Ga0495659_0040557 Ga0495659_0040557_72_1025 316
43 3300046681 Ga0495647_0025236 Ga0495647_0025236_380_1333 316
44 3300046683 Ga0495658_0016131 Ga0495658_0016131_1741_2694 316
45 3300046690 Ga0495624_0106618 Ga0495624_0106618_675_1628 316
46 3300046794 Ga0495589_0175907 Ga0495589_0175907_30_983 316
47 3300047315 Ga0495581_0004050 Ga0495581_0004050_4971_5924 316
48 3300047320 Ga0495672_0194828 Ga0495672_0194828_48_1001 316
49 3300048915 Ga0496112_0202256 Ga0496112_0202256_219_1169 316
50 3300053077 Ga0495601_0122004 Ga0495601_0122004_555_1526 316
51 iso_pu_bacteria 2965089291 2965091944 316
52 3300006844 Ga0075428_100332952 Ga0075428_1003329522 317
53 3300037312 Ga0395899_0134636 Ga0395899_0134636_548_1501 317
54 3300037418 Ga0395900_0016861 Ga0395900_0016861_810_1763 317
55 3300037466 Ga0395898_0234124 Ga0395898_0234124_377_1330 317
56 3300037471 Ga0395905_0013257 Ga0395905_0013257_5023_5976 317
57 3300038443 Ga0395901_0014733 Ga0395901_0014733_5881_6834 317
58 3300009147 Ga0114129_10046862 Ga0114129_100468626 318
59 3300037418 Ga0395900_0063569 Ga0395900_0063569_1997_2956 318
60 3300037471 Ga0395905_0092669 Ga0395905_0092669_1145_2104 318
61 3300037471 Ga0395905_0269085 Ga0395905_0269085_146_1105 318
62 3300038443 Ga0395901_0283567 Ga0395901_0283567_729_1688 318
63 3300046523 Ga0495644_0033237 Ga0495644_0033237_96_1055 318
64 3300048912 Ga0496109_0058209 Ga0496109_0058209_1432_2391 318
65 3300048914 Ga0496111_0109923 Ga0496111_0109923_413_1372 318
66 3300050507 nmdc:mga05p37_1791_c1 nmdc:mga05p37_1791_c1_594_1610 319
67 3300011119 Ga0105246_10127592 Ga0105246_101275922 320
68 3300026089 Ga0207648_10101538 Ga0207648_101015382 320
69 3300005338 Ga0068868_100071702 Ga0068868_1000717023 321
70 3300005339 Ga0070660_100119682 Ga0070660_1001196823 321
71 3300005366 Ga0070659_100074010 Ga0070659_1000740102 321
72 3300005563 Ga0068855_100019205 Ga0068855_1000192056 321
73 3300005614 Ga0068856_100111659 Ga0068856_1001116594 321
74 3300005719 Ga0068861_100117021 Ga0068861_1001170213 321
75 3300009098 Ga0105245_10005381 Ga0105245_100053817 321
76 3300009098 Ga0105245_10008957 Ga0105245_100089576 321
77 3300010375 Ga0105239_10011998 Ga0105239_100119986 321
78 3300013307 Ga0157372_10018584 Ga0157372_100185845 321
79 3300014745 Ga0157377_10053327 Ga0157377_100533271 321
80 3300025927 Ga0207687_10046776 Ga0207687_100467763 321
81 3300025932 Ga0207690_10009476 Ga0207690_100094766 321
82 3300025933 Ga0207706_10087011 Ga0207706_100870114 321
83 3300025949 Ga0207667_10118261 Ga0207667_101182614 321
84 3300026023 Ga0207677_10037540 Ga0207677_100375403 321
85 3300026075 Ga0207708_10149257 Ga0207708_101492572 321
86 3300026118 Ga0207675_100084458 Ga0207675_1000844582 321
87 3300048906 Ga0496103_0104514 Ga0496103_0104514_581_1546 321
88 3300048911 Ga0496108_0083532 Ga0496108_0083532_1499_2464 321
89 3300048912 Ga0496109_0236657 Ga0496109_0236657_161_1141 321
90 3300048913 Ga0496110_0036855 Ga0496110_0036855_1077_2042 321
91 3300048913 Ga0496110_0138851 Ga0496110_0138851_817_1797 321
92 3300048914 Ga0496111_0020625 Ga0496111_0020625_2956_3921 321
93 3300048915 Ga0496112_0035075 Ga0496112_0035075_2426_3406 321
94 3300048916 Ga0496113_0094624 Ga0496113_0094624_807_1787 321
95 3300005434 Ga0070709_10011348 Ga0070709_100113481 322
96 3300005435 Ga0070714_100199484 Ga0070714_1001994842 322
97 3300005439 Ga0070711_100090204 Ga0070711_1000902042 322
98 3300005439 Ga0070711_100268143 Ga0070711_1002681432 322
99 3300005466 Ga0070685_10216719 Ga0070685_102167192 322
100 3300006028 Ga0070717_10018368 Ga0070717_100183682 322
101 3300006058 Ga0075432_10030520 Ga0075432_100305202 322
102 3300006175 Ga0070712_100156578 Ga0070712_1001565782 322
103 3300006175 Ga0070712_100302023 Ga0070712_1003020232 322
104 3300006847 Ga0075431_100061844 Ga0075431_1000618442 322
105 3300006852 Ga0075433_10150924 Ga0075433_101509242 322
106 3300006871 Ga0075434_100009604 Ga0075434_1000096045 322
107 3300006871 Ga0075434_100074193 Ga0075434_1000741932 322
108 3300006871 Ga0075434_100532087 Ga0075434_1005320871 322
109 3300006914 Ga0075436_100049923 Ga0075436_1000499232 322
110 3300007076 Ga0075435_100067070 Ga0075435_1000670702 322
111 3300009098 Ga0105245_10070559 Ga0105245_100705594 322
112 3300009147 Ga0114129_10077006 Ga0114129_100770062 322
113 3300009147 Ga0114129_10536773 Ga0114129_105367731 322
114 3300009148 Ga0105243_10065163 Ga0105243_100651632 322
115 3300010375 Ga0105239_10208655 Ga0105239_102086552 322
116 3300025898 Ga0207692_10084493 Ga0207692_100844931 322
117 3300025898 Ga0207692_10093529 Ga0207692_100935291 322
118 3300025906 Ga0207699_10281473 Ga0207699_102814731 322
119 3300025916 Ga0207663_10189127 Ga0207663_101891271 322
120 3300025929 Ga0207664_10366192 Ga0207664_103661921 322
121 3300025935 Ga0207709_10204925 Ga0207709_102049251 322
122 3300025939 Ga0207665_10128731 Ga0207665_101287312 322
123 3300028577 Ga0265318_10017470 Ga0265318_100174701 322
124 3300037312 Ga0395899_0174400 Ga0395899_0174400_47_1039 322
125 3300037418 Ga0395900_0002633 Ga0395900_0002633_9353_10345 322
126 3300037466 Ga0395898_0003140 Ga0395898_0003140_8417_9409 322
127 3300037471 Ga0395905_0011573 Ga0395905_0011573_7394_8386 322
128 3300038443 Ga0395901_0002742 Ga0395901_0002742_6746_7738 322
129 3300038443 Ga0395901_0489521 Ga0395901_0489521_148_1134 322
130 3300046455 Ga0495603_0048379 Ga0495603_0048379_1015_1986 322
131 3300046461 Ga0495641_0008000 Ga0495641_0008000_3425_4396 322
132 3300046690 Ga0495624_0257836 Ga0495624_0257836_69_1040 322
133 3300048905 Ga0496102_0469390 Ga0496102_0469390_97_1089 322
134 3300048906 Ga0496103_0192183 Ga0496103_0192183_31_1023 322
135 3300048915 Ga0496112_0270420 Ga0496112_0270420_110_1096 322
136 3300050512 nmdc:mga0n895_16145_c1 nmdc:mga0n895_16145_c1_3590_4582 322
137 3300050512 nmdc:mga0n895_53622_c1 nmdc:mga0n895_53622_c1_2729_3721 322
138 3300050513 nmdc:mga0rr50_138313_c1 nmdc:mga0rr50_138313_c1_719_1711 322
139 3300050515 nmdc:mga0a205_126163_c1 nmdc:mga0a205_126163_c1_808_1800 322
140 iso_pu_bacteria 2513237351 2514588859 322
141 3300028800 Ga0265338_10046611 Ga0265338_100466112 323
142 3300038443 Ga0395901_0066285 Ga0395901_0066285_1390_2394 323
143 3300046681 Ga0495647_0122329 Ga0495647_0122329_52_1038 323
144 3300046690 Ga0495624_0092850 Ga0495624_0092850_210_1196 323
145 3300047319 Ga0495674_0084287 Ga0495674_0084287_718_1704 323
146 3300047322 Ga0495680_0003126 Ga0495680_0003126_2731_3717 323
147 3300047471 Ga0495684_0136072 Ga0495684_0136072_91_1077 323
148 iso_pu_bacteria 2847670302 2847671465 323
149 iso_pu_bacteria 2856314179 2856315369 323
150 iso_pu_bacteria 2878035449 2878036568 323
151 iso_pu_bacteria 2906414383 2906415364 323
152 3300005329 Ga0070683_100107979 Ga0070683_1001079791 324
153 3300005535 Ga0070684_100042123 Ga0070684_1000421233 324
154 3300005577 Ga0068857_100011306 Ga0068857_1000113066 324
155 3300005985 Ga0081539_10045861 Ga0081539_100458611 324
156 3300025945 Ga0207679_10195150 Ga0207679_101951502 324
157 3300026116 Ga0207674_10006420 Ga0207674_1000642011 324
158 3300037312 Ga0395899_0042581 Ga0395899_0042581_1765_2772 324
159 3300037312 Ga0395899_0141217 Ga0395899_0141217_676_1677 324
160 3300038443 Ga0395901_0044750 Ga0395901_0044750_2507_3595 325
161 3300053103 Ga0500555_042250 Ga0500555_042250_174_1157 325
162 3300053146 Ga0500588_0044355 Ga0500588_0044355_280_1263 325
163 3300005336 Ga0070680_100010371 Ga0070680_1000103712 326
164 3300005437 Ga0070710_10170233 Ga0070710_101702332 326
165 3300005458 Ga0070681_10017992 Ga0070681_100179922 326
166 3300005530 Ga0070679_100017648 Ga0070679_1000176483 326
167 3300005546 Ga0070696_100138923 Ga0070696_1001389232 326
168 3300007076 Ga0075435_100073847 Ga0075435_1000738472 326
169 3300025912 Ga0207707_10039820 Ga0207707_100398202 326
170 3300025921 Ga0207652_10019330 Ga0207652_100193303 326
171 3300037418 Ga0395900_0082070 Ga0395900_0082070_438_1442 326
172 3300037466 Ga0395898_0036273 Ga0395898_0036273_1721_2725 326
173 3300038443 Ga0395901_0058912 Ga0395901_0058912_803_1807 326
174 3300050512 nmdc:mga0n895_125722_c1 nmdc:mga0n895_125722_c1_1463_2473 326
175 3300050513 nmdc:mga0rr50_60855_c1 nmdc:mga0rr50_60855_c1_1305_2315 326
176 3300009094 Ga0111539_10120864 Ga0111539_101208643 328
177 3300031731 Ga0307405_10146003 Ga0307405_101460032 328
178 iso_pu_bacteria 2887478801 2887484031 328
179 3300005843 Ga0068860_100011305 Ga0068860_1000113051 329
180 3300048907 Ga0496104_0003843 Ga0496104_0003843_1408_2427 329
181 3300048908 Ga0496105_0000856 Ga0496105_0000856_12866_13885 329
182 3300050510 nmdc:mga06r32_387648_c1 nmdc:mga06r32_387648_c1_302_1309 330
183 3300050512 nmdc:mga0n895_114978_c1 nmdc:mga0n895_114978_c1_916_1923 330
184 3300050513 nmdc:mga0rr50_178742_c1 nmdc:mga0rr50_178742_c1_651_1658 330
185 3300050514 nmdc:mga08x19_84772_c1 nmdc:mga08x19_84772_c1_537_1544 330
186 3300050515 nmdc:mga0a205_170485_c1 nmdc:mga0a205_170485_c1_502_1509 330
187 3300005455 Ga0070663_100043013 Ga0070663_1000430133 331
188 3300005466 Ga0070685_10088941 Ga0070685_100889412 331
189 3300005615 Ga0070702_100054571 Ga0070702_1000545712 331
190 3300014325 Ga0163163_10131537 Ga0163163_101315373 331
191 3300026023 Ga0207677_10125797 Ga0207677_101257972 331
192 3300026067 Ga0207678_10036573 Ga0207678_100365734 331
193 3300037418 Ga0395900_0015582 Ga0395900_0015582_2697_3731 331
194 3300037466 Ga0395898_0062603 Ga0395898_0062603_1633_2667 331
195 3300037471 Ga0395905_0004627 Ga0395905_0004627_5047_6081 331
196 3300038443 Ga0395901_0003054 Ga0395901_0003054_14187_15221 331
197 3300038443 Ga0395901_0384420 Ga0395901_0384420_342_1373 332
198 3300005459 Ga0068867_100030043 Ga0068867_1000300432 333
199 3300006175 Ga0070712_100014621 Ga0070712_1000146212 333
200 3300025915 Ga0207693_10017318 Ga0207693_100173181 333
201 3300025935 Ga0207709_10061926 Ga0207709_100619262 333
202 3300026089 Ga0207648_10017238 Ga0207648_100172385 333
203 3300037312 Ga0395899_0213986 Ga0395899_0213986_136_1197 333
204 3300037418 Ga0395900_0040257 Ga0395900_0040257_853_1914 333
205 3300037466 Ga0395898_0085986 Ga0395898_0085986_1495_2556 333
206 3300037471 Ga0395905_0045294 Ga0395905_0045294_781_1842 333
207 3300038443 Ga0395901_0005153 Ga0395901_0005153_11584_12645 333
208 3300046507 Ga0495606_0001302 Ga0495606_0001302_17255_18307 335
209 3300046616 Ga0495668_0000182 Ga0495668_0000182_37898_38950 335
210 3300046660 Ga0495625_0002750 Ga0495625_0002750_16102_17154 335
211 3300048091 Ga0495626_0000286 Ga0495626_0000286_38426_39478 335
212 iso_pu_bacteria 2881155292 2881158228 340
213 iso_pu_bacteria 2961127735 2961136374 340
214 iso_pu_bacteria 2857349434 2857352852 341
215 iso_pu_bacteria 2977942078 2977943427 341
216 iso_pu_bacteria 2987636660 2987641444 341
217 iso_pu_bacteria 3004203850 3004210253 341
218 iso_pu_bacteria 2977864932 2977868183 342
219 iso_pu_bacteria 2937994558 2937995831 344
220 3300003322 rootL2_10220533 rootL2_102205331 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

10

175

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8462 10 318
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8356 10 318
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8343 10 318
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8323 10 318
5ekp-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8248 10 318
ID Description Score Start End Superfamily
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9168 14 215 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9161 14 199 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9081 15 227 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9024 14 199 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8878 14 215 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1X7MIX0-F1-model_v4 deleted 0.9733 10 114
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9724 11 121 GO:0005886
GO:0016757
AF-W2D0Y6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9692 13 126 GO:0005886
GO:0016757
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9678 12 129 GO:0005886
GO:0016757
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9619 15 113 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
72.93 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map