F331647

General Info

Members Datasets Scaffolds Average Seq Length
219 191 117 667

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221686|2644484976
Length 702
Sequence KEITMKLEQTETGFTLSFGGRTILDHSALAPAIFAGHGEERMEMYRGNFEIEDYVVERRSLAHAEIEGNRVFLSDAPGRPPCLVLIVDAGTIGLEALDASLNRLWIRVVADQDEHVWGGGEQMSYLDMRGRRFPMWTSEPGVGRDRTSEITFKSNVKDRAGGDYFNTNYPQPTYVSSALYALHVETSAYSVFDFRRKTFHEIEIWAIPERIELFAAPTFVELLEVLSDRFGRQPPLPDWVYNGAIIGLKDGENSFSRXEVLSDRFGRQPPLPDWVYNGAIIGLKDGENSFSRLQAMRDAGVAVSALWCEDWVGLRQTSFGARLFWDWQANEDRYPGLRQRIAELNDDGIRFLGYVNPYLCVDGPLFEIAEKAGYFATDAAGKTALVDFGEFDCGVVDFTNAAAAEWFAEDIIGKKMMDYGLSGWMADFGEYLPIDVHLSNGIDAKLMHNQWPTLWAEVNAKAVASRGQTGEALFFMRAGFTGVQKHCPLLWGGDQSVDFSRHDGLVTVICAALSSGLLGNAYHHSDIGGYTSLFGNVRTPELLMRWAEMAAFTPVMRSHEGNRPRENVQIDQDPQVLSHFARMTRIYTHLAPYLKSLSDEAVARGLPVQRPLFLHYQDDRETYAIQDSYLYGADMLVAPVWEAAQADRVVYLPRGERWVHAWTGETFAGGEKVRIAAPLGQPPVFYRPGCANEALFAGLRGL

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2516143018 Ensifer sp. BR816 Isolate Nodule
8 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
9 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
10 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
11 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
12 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
15 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
16 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
17 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
18 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
19 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
20 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
21 2643221558 Rhizobium sp. Root149 Isolate Unclassified
22 2643221568 Rhizobium sp. Root564 Isolate Unclassified
23 2643221582 Rhizobium sp. Root651 Isolate Unclassified
24 2643221599 Rhizobium sp. Root708 Isolate Unclassified
25 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
26 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
27 2643221693 Rhizobium sp. Root491 Isolate Unclassified
28 2643221718 Rhizobium sp. Root268 Isolate Unclassified
29 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
30 2738541293 Rhizobium sp. GV031 Isolate Unclassified
31 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
32 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
33 2791355256 Rhizobium sp. M10 Isolate Nodule
34 2791355262 Rhizobium sp. M1 Isolate Nodule
35 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
36 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
37 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
38 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
39 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
40 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
41 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
42 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
43 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
44 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
45 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
46 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
47 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
48 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
49 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
50 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
51 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
52 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
53 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
54 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
55 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
56 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
57 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
58 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
59 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
62 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
63 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
64 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
65 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
66 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
67 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
70 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
71 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
72 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
73 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
74 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
75 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
76 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
77 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
78 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
79 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
80 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
81 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
82 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
83 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
84 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
85 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
86 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
87 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
88 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
89 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
90 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
91 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
92 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
93 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
97 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
100 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
177 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
184 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
185 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
186 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
187 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
188 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
189 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
190 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
191 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.88
Metatranscriptomes 0
Isolates 46.12

Biome Distribution

Category Percentage (%)
Aerial Root 2.28
Bulb 0
Endosphere 13.24
Nodule 16.89
Rhizoplane 2.28
Rhizosphere 33.79
Stem 0
Stem Tuber 0
Unclassified 31.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000001 3300002773 Bacteria 224104
2 JGI25150J39212_1000007 3300002774 Bacteria 253635
3 JGI25151J46595_10000013 3300003187 Bacteria 253635
4 JGI25153J46596_10000640 3300003215 Bacteria 21401
5 rootL2_10072356 3300003322 Bacteria 6901
6 rootH1_10108122 3300003323 Bacteria 3291
7 Ga0055536_1003699 3300003781 Bacteria 8117
8 Ga0055540_1001450 3300003792 Bacteria 14122
9 Ga0055531_10006386 3300003794 Bacteria 6703
10 Ga0070710_10000720 3300005437 Bacteria 15782
11 Ga0070711_100035488 3300005439 Bacteria 3335
12 Ga0068855_100046197 3300005563 Bacteria 5148
13 Ga0068854_100004431 3300005578 Bacteria 8857
14 Ga0068852_100035889 3300005616 Bacteria 4142
15 Ga0068860_100000277 3300005843 Bacteria 73951
16 Ga0099826_10000154 3300006948 Bacteria 28638
17 Ga0105251_10000210 3300009011 Bacteria 59171
18 Ga0105240_10006708 3300009093 Bacteria 16865
19 Ga0105241_10019280 3300009174 Bacteria 5031
20 Ga0105237_10001856 3300009545 Bacteria 27034
21 Ga0105237_10017942 3300009545 Bacteria 7333
22 Ga0105238_10000006 3300009551 Bacteria 346249
23 Ga0105249_10083081 3300009553 Bacteria 2981
24 Ga0105239_10023402 3300010375 Bacteria 6803
25 Ga0157371_10009423 3300013102 Bacteria 7685
26 Ga0182008_10000519 3300014497 Bacteria 28961
27 Ga0182008_10034776 3300014497 Bacteria 2526
28 Ga0182006_1000052 3300015261 Bacteria 182886
29 Ga0182007_10000032 3300015262 Bacteria 145577
30 Ga0182005_1000002 3300015265 Bacteria 908499
31 Ga0213876_10008786 3300021384 Bacteria 5455
32 Ga0207425_1000032 3300025245 Bacteria 253689
33 Ga0209148_1000316 3300025254 Bacteria 68104
34 Ga0209129_1000056 3300025258 Bacteria 253689
35 Ga0209025_1000090 3300025294 Bacteria 253689
36 Ga0209758_1000084 3300025297 Bacteria 256346
37 Ga0209758_1001250 3300025297 Bacteria 31516
38 Ga0209050_1001525 3300025298 Bacteria 24412
39 Ga0209051_1000489 3300025303 Bacteria 51077
40 Ga0209051_1001462 3300025303 Bacteria 20029
41 Ga0209257_1001831 3300025304 Bacteria 23241
42 Ga0207655_1004256 3300025728 Bacteria 10244
43 Ga0207713_1000602 3300025735 Bacteria 35452
44 Ga0207692_10001974 3300025898 Bacteria 7833
45 Ga0207699_10000916 3300025906 Bacteria 14108
46 Ga0207695_10001247 3300025913 Bacteria 43478
47 Ga0207695_10001505 3300025913 Bacteria 38722
48 Ga0207671_10002862 3300025914 Bacteria 17908
49 Ga0207671_10004003 3300025914 Bacteria 14317
50 Ga0207671_10067001 3300025914 Bacteria 2673
51 Ga0207694_10000207 3300025924 Bacteria 58059
52 Ga0207687_10071252 3300025927 Bacteria 2483
53 Ga0207664_10033877 3300025929 Bacteria 3930
54 Ga0207667_10006468 3300025949 Bacteria 14175
55 Ga0207667_10013188 3300025949 Bacteria 9474
56 Ga0209371_1000012 3300027312 Bacteria 748304
57 Ga0209371_1000811 3300027312 Bacteria 25762
58 Ga0209282_1000255 3300027666 Bacteria 26849
59 Ga0268264_10000158 3300028381 Bacteria 153433
60 Ga0268256_1000013 3300030500 Bacteria 752103
61 Ga0268256_1004872 3300030500 Bacteria 5429
62 Ga0307516_10004133 3300031730 Bacteria 18097
63 Ga0307405_10003069 3300031731 Bacteria 7572
64 Ga0395905_0000017 3300037471 Bacteria 376619
65 Ga0436364_0432065 3300037853 Bacteria 8874
66 Ga0237819_00178 3300038705 Bacteria 23421
67 Ga0436365_0144654 3300039437 Bacteria 13758
68 Ga0466972_0005750 3300044658 Bacteria 6210
69 Ga0466960_0015798 3300044901 Bacteria 3262
70 Ga0495653_0013377 3300046463 Bacteria 6688
71 Ga0495606_0000032 3300046507 Bacteria 248690
72 Ga0495632_0009649 3300046519 Bacteria 5795
73 Ga0495637_0000034 3300046520 Bacteria 127356
74 Ga0495622_0000267 3300046557 Bacteria 39587
75 Ga0495633_0013802 3300046558 Bacteria 4243
76 Ga0495633_0014607 3300046558 Bacteria 4097
77 Ga0495681_0001780 3300047470 Bacteria 15875
78 Ga0495686_0000245 3300047472 Bacteria 97784
79 Ga0496116_0000042 3300048919 Bacteria 330516
80 Ga0496117_0000001 3300048920 Bacteria 2526244
81 Ga0496117_0000016 3300048920 Bacteria 523642
82 Ga0496117_0077725 3300048920 Bacteria 2195
83 Ga0496118_0000002 3300048921 Bacteria 1690764
84 Ga0496118_0003253 3300048921 Bacteria 20710
85 Ga0496118_0027524 3300048921 Bacteria 4809
86 Ga0496120_0000056 3300048923 Bacteria 180367
87 Ga0496121_0000226 3300048924 Bacteria 121831
88 Ga0496121_0001520 3300048924 Bacteria 38932
89 Ga0496121_0002785 3300048924 Bacteria 25928
90 Ga0496121_0052112 3300048924 Bacteria 3440
91 Ga0496122_0000002 3300048925 Bacteria 905834
92 Ga0496122_0000260 3300048925 Bacteria 118852
93 Ga0496122_0006437 3300048925 Bacteria 13481
94 Ga0496122_0039257 3300048925 Bacteria 3778
95 Ga0496123_0000002 3300048926 Bacteria 1811682
96 Ga0496123_0000037 3300048926 Bacteria 262238
97 Ga0496123_0005508 3300048926 Bacteria 12717
98 Ga0496124_0000080 3300048927 Bacteria 210439
99 Ga0496124_0033902 3300048927 Bacteria 4487
100 Ga0496125_0013056 3300048928 Bacteria 8191
101 Ga0496125_0020036 3300048928 Bacteria 6288
102 Ga0496126_0000053 3300048929 Bacteria 311989
103 Ga0496126_0028984 3300048929 Bacteria 5265
104 Ga0495678_000008 3300049459 Bacteria 445926
105 Ga0501035_0044146 3300049822 Bacteria 4014
106 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
107 nmdc:mga06z11_41592_c1 3300050494 Bacteria 2301
108 nmdc:mga0sz30_247_c1 3300050516 Bacteria 20853
109 Ga0500643_014653 3300053087 Bacteria 2715
110 Ga0500583_0001907 3300053092 Bacteria 6105
111 Ga0500560_000057 3300053107 Bacteria 10717
112 Ga0500561_0000037 3300053137 Bacteria 27689
113 Ga0500616_0000164 3300053153 Bacteria 110715
114 Ga0500622_0003920 3300053156 Bacteria 9629
115 Ga0500624_000355 3300053157 Bacteria 14857
116 Ga0500634_0052254 3300053161 Bacteria 2195
117 Ga0500636_0000007 3300053177 Bacteria 171404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427634 2586002031 620
2 3300003781 Ga0055536_1003699 Ga0055536_10036995 624
3 3300053092 Ga0500583_0001907 Ga0500583_0001907_3756_5660 626
4 3300053156 Ga0500622_0003920 Ga0500622_0003920_875_2779 626
5 iso_pu_bacteria 8018150411 8018153753 630
6 3300003322 rootL2_10072356 rootL2_100723563 648
7 3300053153 Ga0500616_0000164 Ga0500616_0000164_105540_107531 648
8 3300005843 Ga0068860_100000277 Ga0068860_10000027731 651
9 3300028381 Ga0268264_10000158 Ga0268264_1000015819 651
10 3300005578 Ga0068854_100004431 Ga0068854_1000044317 653
11 3300031730 Ga0307516_10004133 Ga0307516_1000413322 654
12 3300037853 Ga0436364_0432065 Ga0436364_0432065_1595_3598 655
13 3300003794 Ga0055531_10006386 Ga0055531_100063861 658
14 3300025297 Ga0209758_1001250 Ga0209758_100125023 658
15 3300025298 Ga0209050_1001525 Ga0209050_100152517 658
16 3300025303 Ga0209051_1001462 Ga0209051_10014627 658
17 3300025304 Ga0209257_1001831 Ga0209257_100183110 658
18 3300053087 Ga0500643_014653 Ga0500643_014653_211_2202 658
19 iso_pu_bacteria 2818991461 2819688720 658
20 3300025949 Ga0207667_10006468 Ga0207667_100064682 659
21 iso_pu_bacteria 2508501050 2508729181 659
22 iso_pu_bacteria 2508501114 2509075673 659
23 iso_pu_bacteria 2510917026 2511168695 659
24 iso_pu_bacteria 2513237166 2514049909 659
25 iso_pu_bacteria 2516143018 2516207237 659
26 iso_pu_bacteria 2517287029 2517409741 659
27 iso_pu_bacteria 2537561587 2537873204 659
28 iso_pu_bacteria 2554235003 2554245615 659
29 iso_pu_bacteria 2558860242 2559296555 659
30 iso_pu_bacteria 2582581294 2585203877 659
31 iso_pu_bacteria 2585427633 2585997425 659
32 iso_pu_bacteria 2599185210 2599602951 659
33 iso_pu_bacteria 2600255279 2601610576 659
34 iso_pu_bacteria 2600255308 2601747094 659
35 iso_pu_bacteria 2643221558 2643814113 659
36 iso_pu_bacteria 2643221568 2643856949 659
37 iso_pu_bacteria 2643221582 2643922317 659
38 iso_pu_bacteria 2643221599 2644003605 659
39 iso_pu_bacteria 2643221637 2644207019 659
40 iso_pu_bacteria 2643221693 2644520683 659
41 iso_pu_bacteria 2643221718 2644650667 659
42 iso_pu_bacteria 2724679232 2725945854 659
43 iso_pu_bacteria 2775506901 2776262519 659
44 iso_pu_bacteria 2775506901 2776263208 659
45 iso_pu_bacteria 2791355091 2792623478 659
46 iso_pu_bacteria 2808606387 2808987007 659
47 iso_pu_bacteria 2818991439 2819560696 659
48 iso_pu_bacteria 2830075706 2830077279 659
49 iso_pu_bacteria 2835312727 2835316073 659
50 iso_pu_bacteria 2838675328 2838677819 659
51 iso_pu_bacteria 2838714209 2838717276 659
52 iso_pu_bacteria 2838719591 2838722115 659
53 iso_pu_bacteria 2838724970 2838728025 659
54 iso_pu_bacteria 2841846520 2841849686 659
55 iso_pu_bacteria 2841859092 2841861278 659
56 iso_pu_bacteria 2842124991 2842127566 659
57 iso_pu_bacteria 2842130223 2842132712 659
58 iso_pu_bacteria 2842152218 2842154706 659
59 iso_pu_bacteria 2842170452 2842173204 659
60 iso_pu_bacteria 2842175837 2842178326 659
61 iso_pu_bacteria 2842187318 2842190383 659
62 iso_pu_bacteria 2842211629 2842214697 659
63 iso_pu_bacteria 2842224351 2842227417 659
64 iso_pu_bacteria 2842395702 2842401791 659
65 iso_pu_bacteria 2842515876 2842518455 659
66 iso_pu_bacteria 2884298095 2884298153 659
67 iso_pu_bacteria 2899792073 2899793559 659
68 iso_pu_bacteria 2899845264 2899848349 659
69 iso_pu_bacteria 2904439833 2904443207 659
70 iso_pu_bacteria 2919114240 2919117534 659
71 iso_pu_bacteria 2919166419 2919170065 659
72 iso_pu_bacteria 2919171160 2919173721 659
73 iso_pu_bacteria 2926754445 2926758979 659
74 iso_pu_bacteria 2926760298 2926763505 659
75 iso_pu_bacteria 2933006813 2933009911 659
76 iso_pu_bacteria 2933011516 2933014081 659
77 iso_pu_bacteria 2933594066 2933595886 659
78 iso_pu_bacteria 2978969890 2978970254 659
79 iso_pu_bacteria 2979089926 2979091459 659
80 iso_pu_bacteria 2979095461 2979096980 659
81 iso_pu_bacteria 2979100975 2979101345 659
82 iso_pu_bacteria 2984509177 2984510703 659
83 iso_pu_bacteria 2984518228 2984518596 659
84 iso_pu_bacteria 2984537506 2984539053 659
85 iso_pu_bacteria 2984587000 2984587280 659
86 iso_pu_bacteria 2984601300 2984605748 659
87 iso_pu_bacteria 3003930520 3003935078 659
88 iso_pu_bacteria 3005452660 3005458370 659
89 iso_pu_bacteria 650716007 650842975 659
90 iso_pu_bacteria 8003570095 8003574311 659
91 iso_pu_bacteria 8005658619 8005662377 659
92 iso_pu_bacteria 8054460903 8054464920 659
93 iso_pu_bacteria 8055431914 8055432239 659
94 3300005563 Ga0068855_100046197 Ga0068855_1000461972 660
95 3300025949 Ga0207667_10013188 Ga0207667_100131882 660
96 iso_pu_bacteria 2510461069 2510843021 660
97 iso_pu_bacteria 2600255292 2601667964 660
98 iso_pu_bacteria 2854896431 2854902104 660
99 iso_pu_bacteria 2854916844 2854921320 660
100 iso_pu_bacteria 2857547612 2857549996 660
101 iso_pu_bacteria 2885080285 2885083292 660
102 iso_pu_bacteria 2932410948 2932411665 660
103 iso_pu_bacteria 2932416698 2932418768 660
104 3300044658 Ga0466972_0005750 Ga0466972_0005750_854_2839 661
105 3300044901 Ga0466960_0015798 Ga0466960_0015798_796_2781 661
106 3300048924 Ga0496121_0000226 Ga0496121_0000226_11531_13552 661
107 iso_pu_bacteria 2558860983 2561467674 661
108 iso_pu_bacteria 2844315083 2844317120 661
109 iso_pu_bacteria 2903727486 2903735104 661
110 iso_pu_bacteria 2906602504 2906607159 661
111 iso_pu_bacteria 8056967851 8056972508 661
112 3300038705 Ga0237819_00178 Ga0237819_00178_18656_20659 662
113 3300003323 rootH1_10108122 rootH1_101081223 663
114 3300003792 Ga0055540_1001450 Ga0055540_100145011 663
115 3300006948 Ga0099826_10000154 Ga0099826_1000015421 663
116 3300009553 Ga0105249_10083081 Ga0105249_100830812 663
117 3300013102 Ga0157371_10009423 Ga0157371_100094234 663
118 3300025303 Ga0209051_1000489 Ga0209051_100048930 663
119 3300025913 Ga0207695_10001505 Ga0207695_100015057 663
120 3300025924 Ga0207694_10000207 Ga0207694_1000020726 663
121 3300027312 Ga0209371_1000012 Ga0209371_1000012247 663
122 3300027312 Ga0209371_1000811 Ga0209371_100081118 663
123 3300027666 Ga0209282_1000255 Ga0209282_10002557 663
124 3300030500 Ga0268256_1000013 Ga0268256_1000013247 663
125 3300030500 Ga0268256_1004872 Ga0268256_10048723 663
126 3300037471 Ga0395905_0000017 Ga0395905_0000017_17469_19499 663
127 3300046558 Ga0495633_0013802 Ga0495633_0013802_2227_4221 663
128 3300046558 Ga0495633_0014607 Ga0495633_0014607_2066_4060 663
129 3300047470 Ga0495681_0001780 Ga0495681_0001780_2602_4596 663
130 3300048919 Ga0496116_0000042 Ga0496116_0000042_249195_251186 663
131 3300048920 Ga0496117_0000016 Ga0496117_0000016_384099_386093 663
132 3300048920 Ga0496117_0077725 Ga0496117_0077725_167_2158 663
133 3300048921 Ga0496118_0003253 Ga0496118_0003253_4021_6015 663
134 3300048921 Ga0496118_0027524 Ga0496118_0027524_26_2020 663
135 3300048923 Ga0496120_0000056 Ga0496120_0000056_73076_75070 663
136 3300048925 Ga0496122_0000002 Ga0496122_0000002_384760_386754 663
137 3300048926 Ga0496123_0000002 Ga0496123_0000002_1424929_1426923 663
138 3300048926 Ga0496123_0000002 Ga0496123_0000002_384760_386754 663
139 3300048927 Ga0496124_0000080 Ga0496124_0000080_49566_51557 663
140 3300048928 Ga0496125_0013056 Ga0496125_0013056_1748_3742 663
141 3300048929 Ga0496126_0000053 Ga0496126_0000053_76015_78006 663
142 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_164094_166088 663
143 3300050494 nmdc:mga06z11_41592_c1 nmdc:mga06z11_41592_c1_150_2144 663
144 3300050516 nmdc:mga0sz30_247_c1 nmdc:mga0sz30_247_c1_12314_14308 663
145 3300053107 Ga0500560_000057 Ga0500560_000057_2960_4954 663
146 3300053137 Ga0500561_0000037 Ga0500561_0000037_19945_21939 663
147 3300053157 Ga0500624_000355 Ga0500624_000355_5670_7664 663
148 3300053161 Ga0500634_0052254 Ga0500634_0052254_64_2058 663
149 3300014497 Ga0182008_10000519 Ga0182008_1000051917 664
150 3300015261 Ga0182006_1000052 Ga0182006_100005272 664
151 3300015262 Ga0182007_10000032 Ga0182007_1000003264 664
152 3300015265 Ga0182005_1000002 Ga0182005_1000002217 664
153 3300048920 Ga0496117_0000001 Ga0496117_0000001_1107135_1109156 664
154 3300048921 Ga0496118_0000002 Ga0496118_0000002_1107135_1109156 664
155 3300048924 Ga0496121_0002785 Ga0496121_0002785_7294_9315 664
156 3300048925 Ga0496122_0039257 Ga0496122_0039257_517_2538 664
157 3300048926 Ga0496123_0005508 Ga0496123_0005508_4030_6051 664
158 3300048928 Ga0496125_0020036 Ga0496125_0020036_761_2782 664
159 3300049822 Ga0501035_0044146 Ga0501035_0044146_1725_3731 664
160 3300005437 Ga0070710_10000720 Ga0070710_1000072012 665
161 3300005439 Ga0070711_100035488 Ga0070711_1000354882 665
162 3300005616 Ga0068852_100035889 Ga0068852_1000358893 665
163 3300009174 Ga0105241_10019280 Ga0105241_100192805 665
164 3300010375 Ga0105239_10023402 Ga0105239_100234025 665
165 3300021384 Ga0213876_10008786 Ga0213876_100087862 665
166 3300025254 Ga0209148_1000316 Ga0209148_100031636 665
167 3300025898 Ga0207692_10001974 Ga0207692_100019747 665
168 3300025906 Ga0207699_10000916 Ga0207699_1000091610 665
169 3300025913 Ga0207695_10001247 Ga0207695_1000124734 665
170 3300025914 Ga0207671_10002862 Ga0207671_1000286211 665
171 3300025927 Ga0207687_10071252 Ga0207687_100712521 665
172 3300025929 Ga0207664_10033877 Ga0207664_100338772 665
173 3300039437 Ga0436365_0144654 Ga0436365_0144654_10077_12074 665
174 3300047472 Ga0495686_0000245 Ga0495686_0000245_94658_96664 665
175 3300046463 Ga0495653_0013377 Ga0495653_0013377_3488_5524 666
176 iso_pu_bacteria 2582581866 2585392012 667
177 iso_pu_bacteria 2643221686 2644484976 667
178 iso_pu_bacteria 2791355256 2793297550 667
179 iso_pu_bacteria 2791355262 2793334070 667
180 iso_pu_bacteria 2842285085 2842286557 667
181 iso_pu_bacteria 2842402390 2842403890 667
182 iso_pu_bacteria 2842409023 2842410407 667
183 iso_pu_bacteria 2842415677 2842417055 667
184 iso_pu_bacteria 8005695170 8005699562 667
185 3300009545 Ga0105237_10017942 Ga0105237_100179422 668
186 3300025914 Ga0207671_10067001 Ga0207671_100670012 668
187 3300025914 Ga0207671_10004003 Ga0207671_100040037 670
188 3300009011 Ga0105251_10000210 Ga0105251_1000021045 672
189 3300014497 Ga0182008_10034776 Ga0182008_100347762 672
190 3300025728 Ga0207655_1004256 Ga0207655_10042561 672
191 3300025735 Ga0207713_1000602 Ga0207713_10006025 672
192 3300046507 Ga0495606_0000032 Ga0495606_0000032_13052_15112 672
193 3300046520 Ga0495637_0000034 Ga0495637_0000034_20015_22075 672
194 3300048924 Ga0496121_0001520 Ga0496121_0001520_30643_32688 672
195 3300048925 Ga0496122_0000260 Ga0496122_0000260_104531_106576 672
196 3300048926 Ga0496123_0000037 Ga0496123_0000037_105846_107891 672
197 3300049459 Ga0495678_000008 Ga0495678_000008_199570_201630 672
198 3300053177 Ga0500636_0000007 Ga0500636_0000007_95807_97849 675
199 3300046557 Ga0495622_0000267 Ga0495622_0000267_17397_19505 681
200 iso_pu_bacteria 8057101203 8057103842 681
201 3300048924 Ga0496121_0052112 Ga0496121_0052112_913_2997 685
202 3300025245 Ga0207425_1000032 Ga0207425_100003268 687
203 3300025258 Ga0209129_1000056 Ga0209129_100005668 687
204 3300025294 Ga0209025_1000090 Ga0209025_100009068 687
205 3300025297 Ga0209758_1000084 Ga0209758_100008468 687
206 3300009093 Ga0105240_10006708 Ga0105240_100067088 690
207 3300009545 Ga0105237_10001856 Ga0105237_1000185610 690
208 3300009551 Ga0105238_10000006 Ga0105238_10000006107 690
209 3300003215 JGI25153J46596_10000640 JGI25153J46596_100006407 692
210 3300048925 Ga0496122_0006437 Ga0496122_0006437_9452_11530 692
211 3300048927 Ga0496124_0033902 Ga0496124_0033902_1258_3336 692
212 3300048929 Ga0496126_0028984 Ga0496126_0028984_887_2965 692
213 3300046519 Ga0495632_0009649 Ga0495632_0009649_1104_3185 693
214 iso_pu_bacteria 2509276021 2509392580 694
215 iso_pu_bacteria 2738541293 2738805062 694
216 3300002773 JGI25152J39213_1000001 JGI25152J39213_1000001163 698
217 3300002774 JGI25150J39212_1000007 JGI25150J39212_100000769 698
218 3300003187 JGI25151J46595_10000013 JGI25151J46595_1000001370 698
219 3300031731 Ga0307405_10003069 Ga0307405_100030692 698

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21365

Glyco_hydro_31_3rd

Glycosyl hydrolase family 31 C-terminal domain

605

691

0.96

PF01055

Glyco_hydro_31_2nd

Glycosyl hydrolases family 31 TIM-barrel domain

269

597

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ohy-assembly1.cif.gz_A a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.9696 37 698
7ofx-assembly1.cif.gz_B crystal structure of a gh31 family sulfoquinovosidase mutant d455n from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) 0.9687 37 697
5ohy-assembly2.cif.gz_B a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.9686 37 697
5ohy-assembly4.cif.gz_D a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.9681 44 697
5ohy-assembly3.cif.gz_C a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.9679 37 697
ID Description Score Start End Superfamily
2xvlA04 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9754 606 682 2.60.40.1180
af_P32138_231_615_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9686 249 633 3.20.20.80
af_P32138_231_615_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9662 249 633 3.20.20.80
af_B3DIZ3_680_779_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.9611 588 683 2.60.40.1180
af_K7VP34_672_770_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.958 588 684 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A549SW06-F1-model_v4 Alpha-glucosidase 0.989 37 141
AF-A0A0B6E5S5-F1-model_v4 deleted 0.9786 330 474
AF-A0A077ZGG9-F1-model_v4 Glyco hydro 31 domain containing protein 0.9762 223 698 GO:0004553
GO:0005975
AF-A0A8B6GTL1-F1-model_v4 Glycosyl hydrolase family 31 C-terminal domain-containing protein 0.9755 558 697
AF-A0A6N6XEX2-F1-model_v4 deleted 0.9749 313 460

Feature Viewer

pLDDT pTM Quality
84.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map