F331575

General Info

Members Datasets Scaffolds Average Seq Length
219 146 438 147

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0000237|Ga0501035_0000237_48913_49443
Length 176
Sequence MAFSPWLLDGEGLDGVSCGLEELDMPVNTGVNKMSVVTKDSGGVTSAFPDVCKTPSPAGPVXXXYPNIAQSSDTDKGTKKVSVAGNPVCVKDSNFKTSTGDEAGTAGGGVVSSKTKGKAEFVNFSFDVKFEGKNVARAFDLMLHNDKNTPPFPVMQGPVIAMGGSADDHPCPCCGE

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
135 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
136 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
139 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
146 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0000237 3300049822 Bacteria 65935
2 rootH1_10005401 3300003323 Bacteria 1741
3 rootH1_10188801 3300003323 Bacteria 1394
4 Ga0065715_10806550 3300005293 Bacteria 608
5 Ga0070658_10006569 3300005327 Bacteria 9431
6 Ga0070670_100061408 3300005331 Bacteria 3226
7 Ga0070677_10616635 3300005333 Bacteria 602
8 Ga0070666_10006807 3300005335 Bacteria 7043
9 Ga0070666_10042425 3300005335 Bacteria 3044
10 Ga0070680_100005366 3300005336 Bacteria 9700
11 Ga0070682_100028285 3300005337 Bacteria 3370
12 Ga0070660_100294625 3300005339 Bacteria 1329
13 Ga0070689_100000004 3300005340 Bacteria 497771
14 Ga0070668_100158127 3300005347 Bacteria 1837
15 Ga0070669_100500913 3300005353 Bacteria 1007
16 Ga0070669_100507110 3300005353 Bacteria 1001
17 Ga0070675_100171678 3300005354 Bacteria 1870
18 Ga0070671_100100777 3300005355 Unclassified 2423
19 Ga0070674_100111909 3300005356 Bacteria 2006
20 Ga0070674_100869612 3300005356 Bacteria 783
21 Ga0070688_100085886 3300005365 Bacteria 2046
22 Ga0070688_100153037 3300005365 Bacteria 1578
23 Ga0070688_100194608 3300005365 Unclassified 1415
24 Ga0070667_100143699 3300005367 Unclassified 2091
25 Ga0070705_100020689 3300005440 Bacteria 3487
26 Ga0070694_100058999 3300005444 Bacteria 2612
27 Ga0070678_100605987 3300005456 Bacteria 978
28 Ga0070678_101520129 3300005456 Bacteria 627
29 Ga0070681_10187408 3300005458 Bacteria 1989
30 Ga0068867_101539276 3300005459 Bacteria 620
31 Ga0070707_100004165 3300005468 Bacteria 13549
32 Ga0070698_100231226 3300005471 Bacteria 1782
33 Ga0070698_101251184 3300005471 Bacteria 692
34 Ga0070699_100205477 3300005518 Bacteria 1752
35 Ga0070679_100001249 3300005530 Bacteria 22406
36 Ga0070679_100150823 3300005530 Bacteria 2301
37 Ga0070672_100059296 3300005543 Bacteria 3011
38 Ga0070672_100149417 3300005543 Bacteria 1932
39 Ga0070672_100498372 3300005543 Bacteria 1053
40 Ga0070686_100762750 3300005544 Bacteria 777
41 Ga0070695_100002702 3300005545 Bacteria 10277
42 Ga0070695_100264967 3300005545 Bacteria 1256
43 Ga0070696_100003375 3300005546 Bacteria 10653
44 Ga0070693_100771101 3300005547 Bacteria 710
45 Ga0070665_100002915 3300005548 Bacteria 18484
46 Ga0068855_100014151 3300005563 Bacteria 9611
47 Ga0068855_100103076 3300005563 Bacteria 3283
48 Ga0068857_100016872 3300005577 Bacteria 6398
49 Ga0068852_100220827 3300005616 Bacteria 1802
50 Ga0068852_100550395 3300005616 Bacteria 1154
51 Ga0068859_100047967 3300005617 Bacteria 4291
52 Ga0068859_101617676 3300005617 Bacteria 715
53 Ga0068861_101215509 3300005719 Unclassified 729
54 Ga0068863_100632645 3300005841 Bacteria 1060
55 Ga0068858_100018891 3300005842 Bacteria 6449
56 Ga0068860_100021747 3300005843 Bacteria 6207
57 Ga0068860_100041676 3300005843 Bacteria 4386
58 Ga0068860_100048150 3300005843 Bacteria 4063
59 Ga0068860_100532706 3300005843 Bacteria 1175
60 Ga0068860_100651515 3300005843 Bacteria 1061
61 Ga0068862_100480355 3300005844 Bacteria 1176
62 Ga0081455_10185706 3300005937 Bacteria 1570
63 Ga0075430_100027344 3300006846 Bacteria 4847
64 Ga0075431_100240405 3300006847 Bacteria 1842
65 Ga0075431_101898076 3300006847 Unclassified 551
66 Ga0068865_101624649 3300006881 Bacteria 581
67 Ga0097620_100047967 3300006931 Bacteria 4291
68 Ga0097620_101617770 3300006931 Bacteria 715
69 Ga0105240_10003440 3300009093 Bacteria 24572
70 Ga0111539_10644767 3300009094 Bacteria 1233
71 Ga0105245_10286839 3300009098 Bacteria 1611
72 Ga0114129_12283640 3300009147 Bacteria 650
73 Ga0105242_10007359 3300009176 Bacteria 8477
74 Ga0105242_10010189 3300009176 Bacteria 7202
75 Ga0105242_10062604 3300009176 Bacteria 3062
76 Ga0105248_10239011 3300009177 Archaea 2045
77 Ga0105237_10000074 3300009545 Bacteria 134565
78 Ga0105237_10135594 3300009545 Bacteria 2456
79 Ga0105237_12374976 3300009545 Bacteria 540
80 Ga0105238_10005380 3300009551 Bacteria 12653
81 Ga0105238_10006073 3300009551 Bacteria 11978
82 Ga0105249_10293167 3300009553 Bacteria 1629
83 Ga0105249_11442696 3300009553 Bacteria 760
84 Ga0157374_10191141 3300013296 Bacteria 2002
85 Ga0157375_11433232 3300013308 Bacteria 814
86 Ga0163163_10031407 3300014325 Bacteria 5125
87 Ga0163163_10351122 3300014325 Unclassified 1531
88 Ga0163163_12575597 3300014325 Bacteria 566
89 Ga0157379_10071168 3300014968 Bacteria 3112
90 Ga0157379_10796313 3300014968 Unclassified 892
91 Ga0157376_10573647 3300014969 Unclassified 1119
92 Ga0207680_10058122 3300025903 Bacteria 2343
93 Ga0207705_10003133 3300025909 Bacteria 12594
94 Ga0207707_10201164 3300025912 Bacteria 1737
95 Ga0207695_10000941 3300025913 Bacteria 51894
96 Ga0207671_10001561 3300025914 Bacteria 26201
97 Ga0207660_10023957 3300025917 Bacteria 4127
98 Ga0207657_10197753 3300025919 Bacteria 1619
99 Ga0207652_10001662 3300025921 Bacteria 19478
100 Ga0207652_10092991 3300025921 Bacteria 2653
101 Ga0207646_10004593 3300025922 Bacteria 14931
102 Ga0207681_10211267 3300025923 Bacteria 1496
103 Ga0207694_10002273 3300025924 Bacteria 15715
104 Ga0207694_10018202 3300025924 Bacteria 5311
105 Ga0207650_10098834 3300025925 Bacteria 2243
106 Ga0207687_10106100 3300025927 Bacteria 2076
107 Ga0207687_11344998 3300025927 Bacteria 614
108 Ga0207644_10079240 3300025931 Unclassified 2423
109 Ga0207690_10061483 3300025932 Bacteria 2554
110 Ga0207686_10005114 3300025934 Bacteria 7052
111 Ga0207686_10015009 3300025934 Bacteria 4324
112 Ga0207670_10000286 3300025936 Bacteria 31038
113 Ga0207669_10227238 3300025937 Bacteria 1374
114 Ga0207669_11594921 3300025937 Bacteria 557
115 Ga0207704_10367104 3300025938 Bacteria 1126
116 Ga0207704_10631786 3300025938 Bacteria 880
117 Ga0207691_10087722 3300025940 Bacteria 2791
118 Ga0207691_10441085 3300025940 Bacteria 1108
119 Ga0207667_10147275 3300025949 Bacteria 2423
120 Ga0207667_10431733 3300025949 Bacteria 1340
121 Ga0207712_10621520 3300025961 Unclassified 936
122 Ga0207668_10138837 3300025972 Bacteria 1866
123 Ga0207658_10116338 3300025986 Unclassified 2123
124 Ga0207703_10246680 3300026035 Bacteria 1608
125 Ga0207648_11550886 3300026089 Bacteria 623
126 Ga0207676_11391760 3300026095 Bacteria 697
127 Ga0207674_10024325 3300026116 Bacteria 6475
128 Ga0207675_100938208 3300026118 Unclassified 882
129 Ga0207683_10604582 3300026121 Bacteria 1015
130 Ga0207698_10825481 3300026142 Bacteria 931
131 Ga0268266_10008305 3300028379 Bacteria 9245
132 Ga0268266_10131662 3300028379 Bacteria 2237
133 Ga0268264_10003885 3300028381 Bacteria 12811
134 Ga0268264_10071088 3300028381 Bacteria 2947
135 Ga0268264_10088311 3300028381 Bacteria 2668
136 Ga0268264_10627150 3300028381 Bacteria 1062
137 Ga0265326_10040387 3300028558 Bacteria 1325
138 Ga0265318_10000010 3300028577 Bacteria 240629
139 Ga0265323_10009385 3300028653 Bacteria 4002
140 Ga0265322_10031041 3300028654 Bacteria 1525
141 Ga0265338_10543065 3300028800 Bacteria 814
142 Ga0265324_10001089 3300029957 Bacteria 16334
143 Ga0265324_10052471 3300029957 Bacteria 1400
144 Ga0265760_10047079 3300031090 Bacteria 1294
145 Ga0265330_10000060 3300031235 Bacteria 96980
146 Ga0265330_10019091 3300031235 Bacteria 3145
147 Ga0265332_10001978 3300031238 Bacteria 10787
148 Ga0265328_10000380 3300031239 Bacteria 20725
149 Ga0265320_10000013 3300031240 Bacteria 240784
150 Ga0265325_10069599 3300031241 Bacteria 1769
151 Ga0265325_10201415 3300031241 Bacteria 918
152 Ga0265329_10003621 3300031242 Bacteria 6671
153 Ga0265329_10011533 3300031242 Bacteria 3209
154 Ga0265339_10000022 3300031249 Bacteria 171562
155 Ga0265339_10050220 3300031249 Bacteria 2281
156 Ga0265331_10000251 3300031250 Bacteria 63574
157 Ga0265316_10000102 3300031344 Bacteria 92202
158 Ga0265316_10003373 3300031344 Bacteria 16180
159 Ga0265316_10005853 3300031344 Bacteria 11851
160 Ga0307408_100089536 3300031548 Bacteria 2320
161 Ga0265313_10000375 3300031595 Bacteria 48069
162 Ga0265313_10021764 3300031595 Bacteria 3498
163 Ga0265313_10167405 3300031595 Bacteria 930
164 Ga0265314_10000061 3300031711 Bacteria 159519
165 Ga0265314_10015712 3300031711 Bacteria 5998
166 Ga0265314_10060657 3300031711 Bacteria 2581
167 Ga0265342_10000618 3300031712 Bacteria 37365
168 Ga0265342_10003787 3300031712 Bacteria 12198
169 Ga0265342_10020869 3300031712 Unclassified 4191
170 Ga0265342_10021513 3300031712 Bacteria 4116
171 Ga0265342_10034476 3300031712 Bacteria 3105
172 Ga0307413_10877986 3300031824 Bacteria 760
173 Ga0307412_10069094 3300031911 Bacteria 2404
174 Ga0307412_10724280 3300031911 Bacteria 856
175 Ga0307416_100010827 3300032002 Bacteria 6045
176 Ga0307416_100151081 3300032002 Bacteria 2130
177 Ga0307416_100670153 3300032002 Bacteria 1124
178 Ga0307411_10375336 3300032005 Bacteria 1168
179 Ga0307415_100650892 3300032126 Bacteria 945
180 Ga0373956_0657348 3300035119 Bacteria 500
181 Ga0373947_0444079 3300035725 Bacteria 878
182 Ga0373947_1191877 3300035725 Bacteria 519
183 Ga0373925_0012515 3300037068 Bacteria 6146
184 Ga0451802_1918179 3300041460 Bacteria 680
185 Ga0451807_0691625 3300041486 Bacteria 1083
186 Ga0439434_0272780 3300042435 Bacteria 581
187 Ga0451577_0035212 3300042876 Bacteria 4510
188 Ga0451577_0042646 3300042876 Bacteria 4068
189 Ga0453683_0172929 3300044673 Bacteria 1368
190 Ga0453683_0202199 3300044673 Bacteria 1261
191 Ga0453684_0000067 3300044712 Bacteria 461903
192 Ga0453684_0005634 3300044712 Bacteria 24617
193 Ga0453684_0010957 3300044712 Bacteria 15326
194 Ga0453684_0022116 3300044712 Bacteria 9456
195 Ga0453684_0114267 3300044712 Bacteria 3273
196 Ga0453684_0533674 3300044712 Bacteria 1295
197 Ga0451576_0265637 3300045051 Bacteria 1794
198 Ga0495603_0222203 3300046455 Bacteria 1090
199 Ga0495658_0351517 3300046683 Bacteria 937
200 Ga0495615_0000464 3300048090 Bacteria 5865
201 Ga0496110_0514530 3300048913 Bacteria 1089
202 Ga0501293_014839 3300049516 Bacteria 711
203 Ga0501299_008515 3300049522 Bacteria 1669
204 Ga0501225_0165607 3300049705 Bacteria 682
205 Ga0501225_0202668 3300049705 Bacteria 630
206 Ga0501080_1871630 3300049742 Bacteria 503
207 Ga0501263_001182 3300049760 Bacteria 2378
208 Ga0501270_012394 3300049767 Bacteria 1163
209 Ga0501035_0000042 3300049822 Bacteria 152455
210 Ga0501035_0000106 3300049822 Bacteria 104085
211 nmdc:mga0qj67_725100_c1 3300050509 Bacteria 790
212 nmdc:mga0qj67_825007_c1 3300050509 Bacteria 733
213 nmdc:mga0qj67_91897_c1 3300050509 Bacteria 2439
214 nmdc:mga06r32_228485_c1 3300050510 Bacteria 1849
215 nmdc:mga08y16_1801419_c1 3300050511 Bacteria 565
216 nmdc:mga0rr50_591131_c1 3300050513 Bacteria 946
217 Ga0500568_0010194 3300053139 Bacteria 4415
218 Ga0500619_000037 3300053154 Bacteria 41109
219 Ga0587077_014082 3300059493 Bacteria 1310
220 Ga0501035_0000237
221 rootH1_10005401
222 rootH1_10188801
223 Ga0065715_10806550
224 Ga0070658_10006569
225 Ga0070670_100061408
226 Ga0070677_10616635
227 Ga0070666_10006807
228 Ga0070666_10042425
229 Ga0070680_100005366
230 Ga0070682_100028285
231 Ga0070660_100294625
232 Ga0070689_100000004
233 Ga0070668_100158127
234 Ga0070669_100500913
235 Ga0070669_100507110
236 Ga0070675_100171678
237 Ga0070671_100100777
238 Ga0070674_100111909
239 Ga0070674_100869612
240 Ga0070688_100085886
241 Ga0070688_100153037
242 Ga0070688_100194608
243 Ga0070667_100143699
244 Ga0070705_100020689
245 Ga0070694_100058999
246 Ga0070678_100605987
247 Ga0070678_101520129
248 Ga0070681_10187408
249 Ga0068867_101539276
250 Ga0070707_100004165
251 Ga0070698_100231226
252 Ga0070698_101251184
253 Ga0070699_100205477
254 Ga0070679_100001249
255 Ga0070679_100150823
256 Ga0070672_100059296
257 Ga0070672_100149417
258 Ga0070672_100498372
259 Ga0070686_100762750
260 Ga0070695_100002702
261 Ga0070695_100264967
262 Ga0070696_100003375
263 Ga0070693_100771101
264 Ga0070665_100002915
265 Ga0068855_100014151
266 Ga0068855_100103076
267 Ga0068857_100016872
268 Ga0068852_100220827
269 Ga0068852_100550395
270 Ga0068859_100047967
271 Ga0068859_101617676
272 Ga0068861_101215509
273 Ga0068863_100632645
274 Ga0068858_100018891
275 Ga0068860_100021747
276 Ga0068860_100041676
277 Ga0068860_100048150
278 Ga0068860_100532706
279 Ga0068860_100651515
280 Ga0068862_100480355
281 Ga0081455_10185706
282 Ga0075430_100027344
283 Ga0075431_100240405
284 Ga0075431_101898076
285 Ga0068865_101624649
286 Ga0097620_100047967
287 Ga0097620_101617770
288 Ga0105240_10003440
289 Ga0111539_10644767
290 Ga0105245_10286839
291 Ga0114129_12283640
292 Ga0105242_10007359
293 Ga0105242_10010189
294 Ga0105242_10062604
295 Ga0105248_10239011
296 Ga0105237_10000074
297 Ga0105237_10135594
298 Ga0105237_12374976
299 Ga0105238_10005380
300 Ga0105238_10006073
301 Ga0105249_10293167
302 Ga0105249_11442696
303 Ga0157374_10191141
304 Ga0157375_11433232
305 Ga0163163_10031407
306 Ga0163163_10351122
307 Ga0163163_12575597
308 Ga0157379_10071168
309 Ga0157379_10796313
310 Ga0157376_10573647
311 Ga0207680_10058122
312 Ga0207705_10003133
313 Ga0207707_10201164
314 Ga0207695_10000941
315 Ga0207671_10001561
316 Ga0207660_10023957
317 Ga0207657_10197753
318 Ga0207652_10001662
319 Ga0207652_10092991
320 Ga0207646_10004593
321 Ga0207681_10211267
322 Ga0207694_10002273
323 Ga0207694_10018202
324 Ga0207650_10098834
325 Ga0207687_10106100
326 Ga0207687_11344998
327 Ga0207644_10079240
328 Ga0207690_10061483
329 Ga0207686_10005114
330 Ga0207686_10015009
331 Ga0207670_10000286
332 Ga0207669_10227238
333 Ga0207669_11594921
334 Ga0207704_10367104
335 Ga0207704_10631786
336 Ga0207691_10087722
337 Ga0207691_10441085
338 Ga0207667_10147275
339 Ga0207667_10431733
340 Ga0207712_10621520
341 Ga0207668_10138837
342 Ga0207658_10116338
343 Ga0207703_10246680
344 Ga0207648_11550886
345 Ga0207676_11391760
346 Ga0207674_10024325
347 Ga0207675_100938208
348 Ga0207683_10604582
349 Ga0207698_10825481
350 Ga0268266_10008305
351 Ga0268266_10131662
352 Ga0268264_10003885
353 Ga0268264_10071088
354 Ga0268264_10088311
355 Ga0268264_10627150
356 Ga0265326_10040387
357 Ga0265318_10000010
358 Ga0265323_10009385
359 Ga0265322_10031041
360 Ga0265338_10543065
361 Ga0265324_10001089
362 Ga0265324_10052471
363 Ga0265760_10047079
364 Ga0265330_10000060
365 Ga0265330_10019091
366 Ga0265332_10001978
367 Ga0265328_10000380
368 Ga0265320_10000013
369 Ga0265325_10069599
370 Ga0265325_10201415
371 Ga0265329_10003621
372 Ga0265329_10011533
373 Ga0265339_10000022
374 Ga0265339_10050220
375 Ga0265331_10000251
376 Ga0265316_10000102
377 Ga0265316_10003373
378 Ga0265316_10005853
379 Ga0307408_100089536
380 Ga0265313_10000375
381 Ga0265313_10021764
382 Ga0265313_10167405
383 Ga0265314_10000061
384 Ga0265314_10015712
385 Ga0265314_10060657
386 Ga0265342_10000618
387 Ga0265342_10003787
388 Ga0265342_10020869
389 Ga0265342_10021513
390 Ga0265342_10034476
391 Ga0307413_10877986
392 Ga0307412_10069094
393 Ga0307412_10724280
394 Ga0307416_100010827
395 Ga0307416_100151081
396 Ga0307416_100670153
397 Ga0307411_10375336
398 Ga0307415_100650892
399 Ga0373956_0657348
400 Ga0373947_0444079
401 Ga0373947_1191877
402 Ga0373925_0012515
403 Ga0451802_1918179
404 Ga0451807_0691625
405 Ga0439434_0272780
406 Ga0451577_0035212
407 Ga0451577_0042646
408 Ga0453683_0172929
409 Ga0453683_0202199
410 Ga0453684_0000067
411 Ga0453684_0005634
412 Ga0453684_0010957
413 Ga0453684_0022116
414 Ga0453684_0114267
415 Ga0453684_0533674
416 Ga0451576_0265637
417 Ga0495603_0222203
418 Ga0495658_0351517
419 Ga0495615_0000464
420 Ga0496110_0514530
421 Ga0501293_014839
422 Ga0501299_008515
423 Ga0501225_0165607
424 Ga0501225_0202668
425 Ga0501080_1871630
426 Ga0501263_001182
427 Ga0501270_012394
428 Ga0501035_0000042
429 Ga0501035_0000106
430 nmdc:mga0qj67_725100_c1
431 nmdc:mga0qj67_825007_c1
432 nmdc:mga0qj67_91897_c1
433 nmdc:mga06r32_228485_c1
434 nmdc:mga08y16_1801419_c1
435 nmdc:mga0rr50_591131_c1
436 Ga0500568_0010194
437 Ga0500619_000037
438 Ga0587077_014082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13665

Tox-PAAR-like

Toxin PAAR-like domain

43

151

0.97

Map