F331533

General Info

Members Datasets Scaffolds Average Seq Length
219 65 438 133

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0055511|Ga0501039_0055511_77_523
Length 148
Sequence MVAATEQKQVYFEDVSEGQEIPALKITPSTQQLVHWAAGSGDFYQIHYDQDFAKSTGLQGIIVHGALKHALLGRMLWEWLRYDGKIKRYAVSYRGMDVPGQEMTCRGVVTKKRQENGENLVELDIWTENPQGQKTTPGTATVALPSRG

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
37 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
53 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
54 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
55 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
56 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
57 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
58 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
59 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
60 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
61 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
62 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
63 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
64 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
65 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.43
Metatranscriptomes 4.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 17.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0055511 3300049575 Unclassified 3068
2 Ga0058860_11484355 3300004801 Unclassified 517
3 Ga0070703_10004933 3300005406 Bacteria 3724
4 Ga0070703_10014905 3300005406 Bacteria 2219
5 Ga0070703_10113671 3300005406 Unclassified 972
6 Ga0070709_10150894 3300005434 Unclassified 1606
7 Ga0070714_100013690 3300005435 Bacteria 6505
8 Ga0070714_100286063 3300005435 Bacteria 1533
9 Ga0070714_100357980 3300005435 Bacteria 1372
10 Ga0070714_101807838 3300005435 Bacteria 597
11 Ga0070713_100681281 3300005436 Bacteria 981
12 Ga0070705_100001052 3300005440 Bacteria 15398
13 Ga0070705_100035308 3300005440 Bacteria 2802
14 Ga0070705_101577917 3300005440 Bacteria 552
15 Ga0070694_100941517 3300005444 Unclassified 715
16 Ga0070708_100000047 3300005445 Bacteria 80385
17 Ga0070708_100001508 3300005445 Bacteria 17776
18 Ga0070708_100020963 3300005445 Bacteria 5519
19 Ga0070708_100053869 3300005445 Bacteria 3572
20 Ga0070708_100151154 3300005445 Bacteria 2159
21 Ga0070708_100169391 3300005445 Bacteria 2038
22 Ga0070708_100238203 3300005445 Bacteria 1708
23 Ga0070708_100340745 3300005445 Unclassified 1413
24 Ga0070708_100447419 3300005445 Unclassified 1219
25 Ga0070708_100489286 3300005445 Bacteria 1160
26 Ga0070708_100538598 3300005445 Bacteria 1101
27 Ga0070708_100656130 3300005445 Bacteria 988
28 Ga0070708_100787751 3300005445 Unclassified 894
29 Ga0070708_100821745 3300005445 Unclassified 873
30 Ga0070708_100823386 3300005445 Unclassified 872
31 Ga0070708_101324047 3300005445 Unclassified 673
32 Ga0070708_101494357 3300005445 Bacteria 629
33 Ga0070681_10256619 3300005458 Bacteria 1660
34 Ga0070706_100000247 3300005467 Bacteria 66072
35 Ga0070706_100000276 3300005467 Bacteria 62402
36 Ga0070706_100000393 3300005467 Bacteria 52641
37 Ga0070706_100001107 3300005467 Bacteria 29199
38 Ga0070706_100001220 3300005467 Bacteria 27537
39 Ga0070706_100029803 3300005467 Bacteria 5027
40 Ga0070706_100082453 3300005467 Bacteria 2979
41 Ga0070706_100135816 3300005467 Bacteria 2296
42 Ga0070706_100499351 3300005467 Unclassified 1132
43 Ga0070706_100672894 3300005467 Bacteria 960
44 Ga0070706_101043924 3300005467 Unclassified 753
45 Ga0070706_101871828 3300005467 Unclassified 545
46 Ga0070707_100000094 3300005468 Bacteria 80385
47 Ga0070707_100004552 3300005468 Bacteria 12987
48 Ga0070707_100009268 3300005468 Bacteria 9136
49 Ga0070707_100024247 3300005468 Bacteria 5743
50 Ga0070707_100036337 3300005468 Bacteria 4700
51 Ga0070707_100036804 3300005468 Bacteria 4671
52 Ga0070707_100049133 3300005468 Bacteria 4043
53 Ga0070707_100052158 3300005468 Bacteria 3921
54 Ga0070707_100057140 3300005468 Bacteria 3743
55 Ga0070707_100088412 3300005468 Bacteria 2997
56 Ga0070707_100190955 3300005468 Unclassified 1997
57 Ga0070707_100257688 3300005468 Bacteria 1697
58 Ga0070707_100261283 3300005468 Bacteria 1684
59 Ga0070707_100348007 3300005468 Bacteria 1439
60 Ga0070707_100437984 3300005468 Unclassified 1267
61 Ga0070707_100546861 3300005468 Unclassified 1120
62 Ga0070707_101480946 3300005468 Unclassified 645
63 Ga0070698_100009211 3300005471 Bacteria 10595
64 Ga0070698_100022334 3300005471 Bacteria 6619
65 Ga0070698_100023014 3300005471 Bacteria 6514
66 Ga0070698_100028304 3300005471 Bacteria 5822
67 Ga0070698_100036141 3300005471 Bacteria 5106
68 Ga0070698_100086435 3300005471 Unclassified 3122
69 Ga0070698_100116659 3300005471 Bacteria 2632
70 Ga0070698_100157343 3300005471 Bacteria 2217
71 Ga0070698_100161297 3300005471 Bacteria 2186
72 Ga0070698_100187802 3300005471 Bacteria 2004
73 Ga0070698_100246701 3300005471 Bacteria 1718
74 Ga0070698_100595875 3300005471 Bacteria 1045
75 Ga0070698_100596913 3300005471 Bacteria 1044
76 Ga0070698_101725877 3300005471 Unclassified 579
77 Ga0070699_100000060 3300005518 Bacteria 103777
78 Ga0070699_100000187 3300005518 Bacteria 60402
79 Ga0070699_100000426 3300005518 Bacteria 40531
80 Ga0070699_100002224 3300005518 Bacteria 17522
81 Ga0070699_100003386 3300005518 Bacteria 14106
82 Ga0070699_100004770 3300005518 Bacteria 11988
83 Ga0070699_100045564 3300005518 Bacteria 3795
84 Ga0070699_100221075 3300005518 Bacteria 1688
85 Ga0070699_100350742 3300005518 Unclassified 1329
86 Ga0070699_100374571 3300005518 Unclassified 1285
87 Ga0070699_100752087 3300005518 Bacteria 891
88 Ga0070699_100778287 3300005518 Unclassified 875
89 Ga0070699_100788323 3300005518 Bacteria 869
90 Ga0070699_100893950 3300005518 Unclassified 813
91 Ga0070699_101304205 3300005518 Bacteria 666
92 Ga0070699_101547193 3300005518 Bacteria 608
93 Ga0070697_100000066 3300005536 Bacteria 83881
94 Ga0070697_100006679 3300005536 Bacteria 8950
95 Ga0070697_100020421 3300005536 Bacteria 5239
96 Ga0070697_100120705 3300005536 Bacteria 2192
97 Ga0070697_100158434 3300005536 Bacteria 1912
98 Ga0070697_100181813 3300005536 Bacteria 1782
99 Ga0070697_100247202 3300005536 Bacteria 1525
100 Ga0070695_100091856 3300005545 Bacteria 2028
101 Ga0070695_100109005 3300005545 Bacteria 1876
102 Ga0070695_100328616 3300005545 Bacteria 1139
103 Ga0070695_101506587 3300005545 Bacteria 560
104 Ga0070696_100201302 3300005546 Bacteria 1487
105 Ga0070693_101125386 3300005547 Bacteria 600
106 Ga0070704_100053144 3300005549 Bacteria 2862
107 Ga0070704_100233068 3300005549 Bacteria 1503
108 Ga0070717_10000043 3300006028 Bacteria 109696
109 Ga0070717_10000949 3300006028 Bacteria 19307
110 Ga0070717_10002978 3300006028 Bacteria 12053
111 Ga0070717_10218154 3300006028 Bacteria 1676
112 Ga0075432_10061287 3300006058 Bacteria 1340
113 Ga0070716_100003544 3300006173 Bacteria 7366
114 Ga0075430_100026667 3300006846 Bacteria 4914
115 Ga0075431_100048879 3300006847 Bacteria 4362
116 Ga0075433_10010010 3300006852 Bacteria 7599
117 Ga0075433_10078016 3300006852 Bacteria 2918
118 Ga0075433_10477906 3300006852 Bacteria 1098
119 Ga0075434_100062180 3300006871 Bacteria 3716
120 Ga0075434_100567068 3300006871 Bacteria 1155
121 Ga0075429_100176744 3300006880 Bacteria 1870
122 Ga0075436_100009780 3300006914 Bacteria 6557
123 Ga0075436_100021846 3300006914 Bacteria 4393
124 Ga0075436_100029930 3300006914 Bacteria 3746
125 Ga0075436_100131464 3300006914 Bacteria 1755
126 Ga0075436_100150014 3300006914 Bacteria 1640
127 Ga0075436_100234695 3300006914 Bacteria 1303
128 Ga0075436_100301307 3300006914 Bacteria 1149
129 Ga0075436_100309471 3300006914 Bacteria 1133
130 Ga0075435_100065970 3300007076 Bacteria 2943
131 Ga0075435_100555445 3300007076 Unclassified 994
132 Ga0075435_101375413 3300007076 Unclassified 618
133 Ga0075435_101453953 3300007076 Bacteria 601
134 Ga0099794_10000094 3300007265 Bacteria 32899
135 Ga0099794_10026139 3300007265 Bacteria 2696
136 Ga0099794_10109421 3300007265 Unclassified 1384
137 Ga0099794_10305007 3300007265 Bacteria 825
138 Ga0114129_10097205 3300009147 Bacteria 4076
139 Ga0114129_10521969 3300009147 Unclassified 1548
140 Ga0099796_10061940 3300010159 Unclassified 1329
141 Ga0105239_10853516 3300010375 Bacteria 1044
142 Ga0197907_10220700 3300020069 Bacteria 1154
143 Ga0206356_11205086 3300020070 Bacteria 1178
144 Ga0206355_1373854 3300020076 Bacteria 1003
145 Ga0206351_11009347 3300020077 Bacteria 618
146 Ga0206352_10381983 3300020078 Bacteria 626
147 Ga0206350_10957430 3300020080 Bacteria 1147
148 Ga0206354_10855609 3300020081 Bacteria 941
149 Ga0206353_11900666 3300020082 Bacteria 1085
150 Ga0224712_10099244 3300022467 Bacteria 1232
151 Ga0207653_10000518 3300025885 Bacteria 14698
152 Ga0207653_10005371 3300025885 Bacteria 4005
153 Ga0207653_10042449 3300025885 Bacteria 1496
154 Ga0207699_10136772 3300025906 Unclassified 1606
155 Ga0207699_10610374 3300025906 Bacteria 795
156 Ga0207684_10000005 3300025910 Bacteria 736617
157 Ga0207684_10000014 3300025910 Bacteria 440027
158 Ga0207684_10000027 3300025910 Bacteria 313272
159 Ga0207684_10000107 3300025910 Bacteria 157396
160 Ga0207684_10000246 3300025910 Bacteria 81541
161 Ga0207684_10007000 3300025910 Bacteria 10200
162 Ga0207684_10009615 3300025910 Bacteria 8528
163 Ga0207684_10085066 3300025910 Bacteria 2694
164 Ga0207684_10101224 3300025910 Unclassified 2463
165 Ga0207684_10102449 3300025910 Bacteria 2448
166 Ga0207684_10133080 3300025910 Bacteria 2134
167 Ga0207684_10276236 3300025910 Bacteria 1449
168 Ga0207684_11313353 3300025910 Unclassified 595
169 Ga0207707_10090445 3300025912 Bacteria 2675
170 Ga0207646_10000089 3300025922 Bacteria 123558
171 Ga0207646_10000204 3300025922 Bacteria 80399
172 Ga0207646_10000719 3300025922 Bacteria 43035
173 Ga0207646_10001020 3300025922 Bacteria 35818
174 Ga0207646_10001513 3300025922 Bacteria 28623
175 Ga0207646_10003286 3300025922 Bacteria 18410
176 Ga0207646_10010107 3300025922 Bacteria 9247
177 Ga0207646_10011967 3300025922 Bacteria 8364
178 Ga0207646_10012205 3300025922 Bacteria 8267
179 Ga0207646_10016552 3300025922 Bacteria 6918
180 Ga0207646_10033123 3300025922 Bacteria 4675
181 Ga0207646_10107150 3300025922 Bacteria 2507
182 Ga0207646_10110776 3300025922 Bacteria 2463
183 Ga0207646_10457068 3300025922 Unclassified 1152
184 Ga0207646_11170770 3300025922 Bacteria 675
185 Ga0207664_10050075 3300025929 Bacteria 3292
186 Ga0207664_10067148 3300025929 Bacteria 2877
187 Ga0207664_10255678 3300025929 Bacteria 1530
188 Ga0207664_10287247 3300025929 Bacteria 1445
189 Ga0207664_10291292 3300025929 Bacteria 1434
190 Ga0207664_11905619 3300025929 Unclassified 517
191 Ga0207665_10008765 3300025939 Bacteria 6654
192 Ga0209588_1000144 3300027671 Bacteria 20577
193 Ga0209588_1150581 3300027671 Bacteria 737
194 Ga0373935_0938612 3300035692 Bacteria 642
195 Ga0373947_0043876 3300035725 Bacteria 2672
196 Ga0495584_0410076 3300046491 Bacteria 689
197 Ga0501072_0232898 3300049588 Unclassified 1467
198 Ga0501045_0595286 3300049824 Bacteria 819
199 nmdc:mga05p37_86220_c1 3300050507 Bacteria 3870
200 nmdc:mga09592_83120_c1 3300050508 Bacteria 2729
201 nmdc:mga0qj67_198862_c1 3300050509 Unclassified 1629
202 nmdc:mga06r32_64222_c1 3300050510 Bacteria 3540
203 nmdc:mga0n895_110451_c1 3300050512 Bacteria 2765
204 nmdc:mga0n895_477002_c1 3300050512 Bacteria 1258
205 nmdc:mga0n895_68823_c1 3300050512 Bacteria 3507
206 nmdc:mga0n895_846692_c1 3300050512 Bacteria 903
207 nmdc:mga08x19_107476_c1 3300050514 Bacteria 1858
208 nmdc:mga08x19_149034_c1 3300050514 Bacteria 1583
209 nmdc:mga08x19_203484_c1 3300050514 Bacteria 1358
210 nmdc:mga08x19_219958_c1 3300050514 Unclassified 1305
211 nmdc:mga08x19_262015_c1 3300050514 Bacteria 1195
212 nmdc:mga08x19_266188_c1 3300050514 Bacteria 1186
213 nmdc:mga08x19_33001_c1 3300050514 Bacteria 3266
214 nmdc:mga08x19_91827_c1 3300050514 Bacteria 2005
215 nmdc:mga0a205_34505_c1 3300050515 Bacteria 4853
216 nmdc:mga0a205_49314_c1 3300050515 Bacteria 4064
217 Ga0495601_0309291 3300053077 Unclassified 1029
218 Ga0495619_0010179 3300053085 Bacteria 5924
219 Ga0501084_1230545 3300054114 Bacteria 628
220 Ga0501039_0055511
221 Ga0058860_11484355
222 Ga0070703_10004933
223 Ga0070703_10014905
224 Ga0070703_10113671
225 Ga0070709_10150894
226 Ga0070714_100013690
227 Ga0070714_100286063
228 Ga0070714_100357980
229 Ga0070714_101807838
230 Ga0070713_100681281
231 Ga0070705_100001052
232 Ga0070705_100035308
233 Ga0070705_101577917
234 Ga0070694_100941517
235 Ga0070708_100000047
236 Ga0070708_100001508
237 Ga0070708_100020963
238 Ga0070708_100053869
239 Ga0070708_100151154
240 Ga0070708_100169391
241 Ga0070708_100238203
242 Ga0070708_100340745
243 Ga0070708_100447419
244 Ga0070708_100489286
245 Ga0070708_100538598
246 Ga0070708_100656130
247 Ga0070708_100787751
248 Ga0070708_100821745
249 Ga0070708_100823386
250 Ga0070708_101324047
251 Ga0070708_101494357
252 Ga0070681_10256619
253 Ga0070706_100000247
254 Ga0070706_100000276
255 Ga0070706_100000393
256 Ga0070706_100001107
257 Ga0070706_100001220
258 Ga0070706_100029803
259 Ga0070706_100082453
260 Ga0070706_100135816
261 Ga0070706_100499351
262 Ga0070706_100672894
263 Ga0070706_101043924
264 Ga0070706_101871828
265 Ga0070707_100000094
266 Ga0070707_100004552
267 Ga0070707_100009268
268 Ga0070707_100024247
269 Ga0070707_100036337
270 Ga0070707_100036804
271 Ga0070707_100049133
272 Ga0070707_100052158
273 Ga0070707_100057140
274 Ga0070707_100088412
275 Ga0070707_100190955
276 Ga0070707_100257688
277 Ga0070707_100261283
278 Ga0070707_100348007
279 Ga0070707_100437984
280 Ga0070707_100546861
281 Ga0070707_101480946
282 Ga0070698_100009211
283 Ga0070698_100022334
284 Ga0070698_100023014
285 Ga0070698_100028304
286 Ga0070698_100036141
287 Ga0070698_100086435
288 Ga0070698_100116659
289 Ga0070698_100157343
290 Ga0070698_100161297
291 Ga0070698_100187802
292 Ga0070698_100246701
293 Ga0070698_100595875
294 Ga0070698_100596913
295 Ga0070698_101725877
296 Ga0070699_100000060
297 Ga0070699_100000187
298 Ga0070699_100000426
299 Ga0070699_100002224
300 Ga0070699_100003386
301 Ga0070699_100004770
302 Ga0070699_100045564
303 Ga0070699_100221075
304 Ga0070699_100350742
305 Ga0070699_100374571
306 Ga0070699_100752087
307 Ga0070699_100778287
308 Ga0070699_100788323
309 Ga0070699_100893950
310 Ga0070699_101304205
311 Ga0070699_101547193
312 Ga0070697_100000066
313 Ga0070697_100006679
314 Ga0070697_100020421
315 Ga0070697_100120705
316 Ga0070697_100158434
317 Ga0070697_100181813
318 Ga0070697_100247202
319 Ga0070695_100091856
320 Ga0070695_100109005
321 Ga0070695_100328616
322 Ga0070695_101506587
323 Ga0070696_100201302
324 Ga0070693_101125386
325 Ga0070704_100053144
326 Ga0070704_100233068
327 Ga0070717_10000043
328 Ga0070717_10000949
329 Ga0070717_10002978
330 Ga0070717_10218154
331 Ga0075432_10061287
332 Ga0070716_100003544
333 Ga0075430_100026667
334 Ga0075431_100048879
335 Ga0075433_10010010
336 Ga0075433_10078016
337 Ga0075433_10477906
338 Ga0075434_100062180
339 Ga0075434_100567068
340 Ga0075429_100176744
341 Ga0075436_100009780
342 Ga0075436_100021846
343 Ga0075436_100029930
344 Ga0075436_100131464
345 Ga0075436_100150014
346 Ga0075436_100234695
347 Ga0075436_100301307
348 Ga0075436_100309471
349 Ga0075435_100065970
350 Ga0075435_100555445
351 Ga0075435_101375413
352 Ga0075435_101453953
353 Ga0099794_10000094
354 Ga0099794_10026139
355 Ga0099794_10109421
356 Ga0099794_10305007
357 Ga0114129_10097205
358 Ga0114129_10521969
359 Ga0099796_10061940
360 Ga0105239_10853516
361 Ga0197907_10220700
362 Ga0206356_11205086
363 Ga0206355_1373854
364 Ga0206351_11009347
365 Ga0206352_10381983
366 Ga0206350_10957430
367 Ga0206354_10855609
368 Ga0206353_11900666
369 Ga0224712_10099244
370 Ga0207653_10000518
371 Ga0207653_10005371
372 Ga0207653_10042449
373 Ga0207699_10136772
374 Ga0207699_10610374
375 Ga0207684_10000005
376 Ga0207684_10000014
377 Ga0207684_10000027
378 Ga0207684_10000107
379 Ga0207684_10000246
380 Ga0207684_10007000
381 Ga0207684_10009615
382 Ga0207684_10085066
383 Ga0207684_10101224
384 Ga0207684_10102449
385 Ga0207684_10133080
386 Ga0207684_10276236
387 Ga0207684_11313353
388 Ga0207707_10090445
389 Ga0207646_10000089
390 Ga0207646_10000204
391 Ga0207646_10000719
392 Ga0207646_10001020
393 Ga0207646_10001513
394 Ga0207646_10003286
395 Ga0207646_10010107
396 Ga0207646_10011967
397 Ga0207646_10012205
398 Ga0207646_10016552
399 Ga0207646_10033123
400 Ga0207646_10107150
401 Ga0207646_10110776
402 Ga0207646_10457068
403 Ga0207646_11170770
404 Ga0207664_10050075
405 Ga0207664_10067148
406 Ga0207664_10255678
407 Ga0207664_10287247
408 Ga0207664_10291292
409 Ga0207664_11905619
410 Ga0207665_10008765
411 Ga0209588_1000144
412 Ga0209588_1150581
413 Ga0373935_0938612
414 Ga0373947_0043876
415 Ga0495584_0410076
416 Ga0501072_0232898
417 Ga0501045_0595286
418 nmdc:mga05p37_86220_c1
419 nmdc:mga09592_83120_c1
420 nmdc:mga0qj67_198862_c1
421 nmdc:mga06r32_64222_c1
422 nmdc:mga0n895_110451_c1
423 nmdc:mga0n895_477002_c1
424 nmdc:mga0n895_68823_c1
425 nmdc:mga0n895_846692_c1
426 nmdc:mga08x19_107476_c1
427 nmdc:mga08x19_149034_c1
428 nmdc:mga08x19_203484_c1
429 nmdc:mga08x19_219958_c1
430 nmdc:mga08x19_262015_c1
431 nmdc:mga08x19_266188_c1
432 nmdc:mga08x19_33001_c1
433 nmdc:mga08x19_91827_c1
434 nmdc:mga0a205_34505_c1
435 nmdc:mga0a205_49314_c1
436 Ga0495601_0309291
437 Ga0495619_0010179
438 Ga0501084_1230545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

12

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8211 11 146
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.812 14 144
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.801 15 146
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.7975 64 143
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.7958 14 144
ID Description Score Start End Superfamily
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8818 85 142 2.40.160.210
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8211 11 146 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.812 14 144 3.10.129.10
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8079 83 146 3.10.129.10
3ir3B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.801 15 146 3.10.129.10
ID Description Score Start End GO Terms
AF-X1CCT3-F1-model_v4 MaoC-like domain-containing protein 0.9028 53 144
AF-A0A7Y4U532-F1-model_v4 Acyl dehydratase 0.8812 7 146 GO:0019171
AF-A0A521Y4N0-F1-model_v4 MaoC-like domain-containing protein 0.8799 9 146
AF-A0A2E7S7J4-F1-model_v4 Dehydratase 0.878 6 146
AF-A0A3D1LZU4-F1-model_v4 Dehydratase 0.8774 8 146

Map