F331157

General Info

Members Datasets Scaffolds Average Seq Length
219 136 438 451

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10086373|Ga0207699_100863732
Length 505
Sequence MILGPPNARKPRKTRNRAVCFAAIAALLLAGAVVGAHDIPNDVTIQTFLKPEGQRLRLVVRVPLQAMRDMDYPKPRGTTRADLMDLSRADPTLRDASTLWISDFLDLYENDVRLPKPDVVAVRASLPSDRSFTSYEDAVAHVTGPPLAPDAEFVWSQGLLDVLFEYPIQSERSNFSIEPRLARLGIRTLTVMRFLPPGGAVRAFEFYGDPGLVRLDPSWRQAAWQFVKLGFFHILDGTDHLLFLGCLVIPFRRFRPLVAIVTAFTVAHSITLIASAYNLAPDALWFPPLIETLIATSIVYMALENIVFAAEKQPQSAQSFVTHVDLQPGRDAHIDRKDSAVSASSAAAFSSALKRRWLVTFGFGLVHGFGFSFALRQTLQFAGSHLLASLLSFNIGVELGQLLVLAALMPALAFLFRFVVAERLGTIILSAIVAHTAWHWMADRYAVLRQFRFEWPVIDAAFLASLMRWAMLAVIAGALYWLVFGVLRAGRRGARDGVRDVHDAA

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.65
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10086373 3300025906 Bacteria 1959
2 JGI25406J46586_10001567 3300003203 Bacteria 10783
3 Ga0065712_10076574 3300005290 Bacteria 3637
4 Ga0065715_10034917 3300005293 Unclassified 1636
5 Ga0065715_10138269 3300005293 Unclassified 1894
6 Ga0065707_10008116 3300005295 Bacteria 3519
7 Ga0070676_10000655 3300005328 Bacteria 16861
8 Ga0070670_100012001 3300005331 Bacteria 7411
9 Ga0070670_100193618 3300005331 Unclassified 1766
10 Ga0070680_100129382 3300005336 Bacteria 2111
11 Ga0068868_100078442 3300005338 Bacteria 2644
12 Ga0070660_100027675 3300005339 Bacteria 4233
13 Ga0070689_100034228 3300005340 Bacteria 3876
14 Ga0070689_100081920 3300005340 Bacteria 2534
15 Ga0070668_100013890 3300005347 Bacteria 6021
16 Ga0070668_100222102 3300005347 Bacteria 1559
17 Ga0070669_100024222 3300005353 Bacteria 4351
18 Ga0070669_100044939 3300005353 Bacteria 3218
19 Ga0070669_100071101 3300005353 Bacteria 2573
20 Ga0070675_100003943 3300005354 Bacteria 11247
21 Ga0070675_100218878 3300005354 Unclassified 1658
22 Ga0070671_100031001 3300005355 Bacteria 4414
23 Ga0070674_100031401 3300005356 Bacteria 3520
24 Ga0070673_100002471 3300005364 Bacteria 11282
25 Ga0070673_100007118 3300005364 Bacteria 7349
26 Ga0070688_100016681 3300005365 Bacteria 4203
27 Ga0070688_100023549 3300005365 Bacteria 3622
28 Ga0070659_100007006 3300005366 Bacteria 8163
29 Ga0070711_100086425 3300005439 Bacteria 2249
30 Ga0070711_100113614 3300005439 Bacteria 1992
31 Ga0070705_100011124 3300005440 Bacteria 4528
32 Ga0070700_100001007 3300005441 Bacteria 13922
33 Ga0070700_100030949 3300005441 Bacteria 3202
34 Ga0070694_100037023 3300005444 Bacteria 3235
35 Ga0070694_100041827 3300005444 Bacteria 3059
36 Ga0070694_100109778 3300005444 Bacteria 1964
37 Ga0070681_10106295 3300005458 Bacteria 2748
38 Ga0070681_10139764 3300005458 Bacteria 2352
39 Ga0070698_100077056 3300005471 Bacteria 3335
40 Ga0070698_100123207 3300005471 Bacteria 2550
41 Ga0070699_100032831 3300005518 Bacteria 4484
42 Ga0070699_100093374 3300005518 Bacteria 2633
43 Ga0070679_100079057 3300005530 Bacteria 3278
44 Ga0070679_100079901 3300005530 Unclassified 3260
45 Ga0070697_100046250 3300005536 Bacteria 3527
46 Ga0070695_100004379 3300005545 Bacteria 8283
47 Ga0070695_100021093 3300005545 Bacteria 3983
48 Ga0070695_100047683 3300005545 Bacteria 2737
49 Ga0070696_100125512 3300005546 Unclassified 1862
50 Ga0070665_100004148 3300005548 Bacteria 15245
51 Ga0070665_100011998 3300005548 Bacteria 8746
52 Ga0068855_100032640 3300005563 Bacteria 6216
53 Ga0070702_100005268 3300005615 Bacteria 6005
54 Ga0068859_100022593 3300005617 Bacteria 6307
55 Ga0068864_100058981 3300005618 Unclassified 3319
56 Ga0068861_100077016 3300005719 Bacteria 2600
57 Ga0068863_100132593 3300005841 Unclassified 2379
58 Ga0068863_100144269 3300005841 Bacteria 2277
59 Ga0068858_100006634 3300005842 Bacteria 11256
60 Ga0068858_100009615 3300005842 Bacteria 9217
61 Ga0068858_100186406 3300005842 Bacteria 1960
62 Ga0068860_100004193 3300005843 Bacteria 14775
63 Ga0068860_100059562 3300005843 Bacteria 3629
64 Ga0068860_100078693 3300005843 Bacteria 3135
65 Ga0068862_100010732 3300005844 Bacteria 7564
66 Ga0068862_100034063 3300005844 Bacteria 4307
67 Ga0081539_10000012 3300005985 Bacteria 440369
68 Ga0081539_10000277 3300005985 Bacteria 117060
69 Ga0081539_10007743 3300005985 Bacteria 9626
70 Ga0097621_100001151 3300006237 Bacteria 18371
71 Ga0097621_100025733 3300006237 Bacteria 4607
72 Ga0068871_100018772 3300006358 Bacteria 5266
73 Ga0068871_100233247 3300006358 Unclassified 1598
74 Ga0075428_100077401 3300006844 Bacteria 3630
75 Ga0075428_100079678 3300006844 Bacteria 3575
76 Ga0075428_100125513 3300006844 Bacteria 2793
77 Ga0075430_100037804 3300006846 Unclassified 4091
78 Ga0075430_100054957 3300006846 Bacteria 3349
79 Ga0075430_100145377 3300006846 Bacteria 1975
80 Ga0075431_100176243 3300006847 Bacteria 2196
81 Ga0075434_100019512 3300006871 Bacteria 6563
82 Ga0075434_100036116 3300006871 Bacteria 4887
83 Ga0075429_100044894 3300006880 Bacteria 3844
84 Ga0075429_100098576 3300006880 Unclassified 2550
85 Ga0068865_100087217 3300006881 Bacteria 2255
86 Ga0075436_100000920 3300006914 Bacteria 19615
87 Ga0075436_100089570 3300006914 Bacteria 2138
88 Ga0097620_100022594 3300006931 Bacteria 6307
89 Ga0075435_100000723 3300007076 Bacteria 20481
90 Ga0075435_100004407 3300007076 Bacteria 9662
91 Ga0075435_100048979 3300007076 Bacteria 3396
92 Ga0111539_10010269 3300009094 Bacteria 11791
93 Ga0111539_10058818 3300009094 Bacteria 4559
94 Ga0111539_10062227 3300009094 Bacteria 4419
95 Ga0105245_10007901 3300009098 Bacteria 9304
96 Ga0114129_10011610 3300009147 Bacteria 12541
97 Ga0114129_10066562 3300009147 Bacteria 5026
98 Ga0114129_10071829 3300009147 Unclassified 4825
99 Ga0114129_10141540 3300009147 Bacteria 3296
100 Ga0114129_10159162 3300009147 Bacteria 3087
101 Ga0114129_10287043 3300009147 Bacteria 2197
102 Ga0114129_10365354 3300009147 Unclassified 1909
103 Ga0105243_10021851 3300009148 Bacteria 4859
104 Ga0105242_10057871 3300009176 Archaea 3176
105 Ga0105242_10059590 3300009176 Bacteria 3133
106 Ga0105242_10065497 3300009176 Bacteria 2998
107 Ga0105242_10284288 3300009176 Unclassified 1504
108 Ga0105248_10012222 3300009177 Bacteria 9468
109 Ga0105248_10078212 3300009177 Bacteria 3719
110 Ga0105237_10094779 3300009545 Unclassified 2974
111 Ga0105239_10239984 3300010375 Bacteria 2034
112 Ga0105239_10473755 3300010375 Unclassified 1422
113 Ga0163162_10002399 3300013306 Bacteria 17616
114 Ga0163162_10148562 3300013306 Bacteria 2460
115 Ga0157375_10086012 3300013308 Bacteria 3194
116 Ga0163163_10034495 3300014325 Bacteria 4901
117 Ga0157380_10113903 3300014326 Bacteria 2278
118 Ga0157377_10066691 3300014745 Bacteria 2070
119 Ga0157379_10135342 3300014968 Unclassified 2220
120 Ga0157376_10048718 3300014969 Bacteria 3506
121 Ga0157376_10304499 3300014969 Bacteria 1510
122 Ga0207697_10065103 3300025315 Bacteria 1521
123 Ga0207680_10043904 3300025903 Bacteria 2625
124 Ga0207705_10204407 3300025909 Bacteria 1497
125 Ga0207707_10094688 3300025912 Bacteria 2610
126 Ga0207695_10027454 3300025913 Bacteria 6338
127 Ga0207663_10050453 3300025916 Bacteria 2586
128 Ga0207662_10034553 3300025918 Bacteria 2950
129 Ga0207657_10038366 3300025919 Bacteria 4265
130 Ga0207652_10201409 3300025921 Unclassified 1791
131 Ga0207659_10000240 3300025926 Bacteria 33289
132 Ga0207706_10023829 3300025933 Bacteria 5491
133 Ga0207706_10053159 3300025933 Bacteria 3575
134 Ga0207686_10046763 3300025934 Bacteria 2672
135 Ga0207670_10002781 3300025936 Bacteria 9216
136 Ga0207670_10082939 3300025936 Bacteria 2247
137 Ga0207691_10023924 3300025940 Bacteria 5748
138 Ga0207691_10031952 3300025940 Bacteria 4912
139 Ga0207691_10033821 3300025940 Bacteria 4759
140 Ga0207711_10012687 3300025941 Bacteria 6999
141 Ga0207711_10020960 3300025941 Bacteria 5457
142 Ga0207651_10018627 3300025960 Bacteria 4138
143 Ga0207668_10008269 3300025972 Bacteria 6199
144 Ga0207668_10082207 3300025972 Bacteria 2339
145 Ga0207703_10097586 3300026035 Bacteria 2483
146 Ga0207703_10111785 3300026035 Unclassified 2333
147 Ga0207708_10017550 3300026075 Bacteria 5387
148 Ga0207641_10032814 3300026088 Bacteria 4312
149 Ga0207648_10035077 3300026089 Bacteria 4422
150 Ga0207648_10035506 3300026089 Bacteria 4391
151 Ga0207676_10064104 3300026095 Bacteria 2920
152 Ga0207675_100010701 3300026118 Bacteria 8592
153 Ga0207675_100046493 3300026118 Bacteria 4055
154 Ga0207683_10002758 3300026121 Bacteria 15344
155 Ga0207683_10086753 3300026121 Bacteria 2783
156 Ga0207683_10192342 3300026121 Bacteria 1853
157 Ga0207428_10146383 3300027907 Bacteria 1800
158 Ga0268264_10012373 3300028381 Bacteria 7024
159 Ga0268264_10030521 3300028381 Bacteria 4418
160 Ga0265316_10015020 3300031344 Bacteria 6789
161 Ga0307410_10010803 3300031852 Bacteria 5194
162 Ga0307409_100029208 3300031995 Bacteria 3942
163 Ga0373939_0000591 3300035114 Bacteria 9042
164 Ga0373939_0024944 3300035114 Bacteria 1671
165 Ga0373955_0014308 3300035172 Bacteria 3857
166 Ga0373942_0001908 3300035207 Bacteria 5232
167 Ga0373924_0069621 3300035410 Bacteria 1483
168 Ga0373931_0041303 3300035691 Bacteria 2422
169 Ga0373935_0042050 3300035692 Bacteria 2873
170 Ga0373927_0197022 3300035695 Bacteria 1322
171 Ga0373933_0047303 3300035724 Bacteria 2558
172 Ga0373937_0018213 3300036401 Bacteria 6268
173 Ga0373937_0030883 3300036401 Bacteria 4852
174 Ga0373937_0078554 3300036401 Bacteria 3050
175 Ga0373925_0037975 3300037068 Bacteria 3558
176 Ga0436365_1911074 3300039437 Bacteria 2219
177 Ga0495580_0027280 3300046472 Unclassified 4156
178 Ga0495645_0006613 3300046543 Bacteria 8054
179 Ga0495645_0171188 3300046543 Bacteria 1495
180 Ga0495613_0031292 3300046689 Bacteria 3952
181 Ga0495674_0024425 3300047319 Bacteria 5554
182 Ga0496100_0008243 3300048903 Bacteria 5806
183 Ga0496101_0001951 3300048904 Bacteria 12499
184 Ga0496104_0013373 3300048907 Bacteria 7395
185 Ga0496107_0214682 3300048910 Bacteria 1431
186 Ga0496108_0015007 3300048911 Bacteria 6324
187 Ga0496112_0088236 3300048915 Bacteria 3069
188 Ga0496113_0005129 3300048916 Bacteria 8141
189 Ga0496114_0006131 3300048917 Bacteria 9457
190 Ga0501039_0099155 3300049575 Bacteria 2273
191 Ga0501040_0039114 3300049576 Bacteria 3226
192 Ga0501041_0007533 3300049577 Bacteria 6390
193 Ga0501042_0012190 3300049578 Bacteria 5818
194 Ga0501072_0006907 3300049588 Bacteria 8617
195 Ga0501074_0062109 3300049590 Unclassified 2691
196 Ga0501075_0035962 3300049591 Bacteria 3694
197 Ga0501076_0054573 3300049592 Bacteria 3167
198 Ga0501079_0055430 3300049741 Bacteria 3059
199 nmdc:mga05p37_114865_c1 3300050507 Bacteria 3309
200 nmdc:mga05p37_132060_c1 3300050507 Bacteria 3063
201 nmdc:mga05p37_249886_c1 3300050507 Bacteria 2128
202 nmdc:mga05p37_38968_c1 3300050507 Bacteria 5830
203 nmdc:mga05p37_56901_c1 3300050507 Bacteria 4815
204 nmdc:mga05p37_66602_c1 3300050507 Unclassified 4430
205 nmdc:mga0qj67_32147_c1 3300050509 Bacteria 4092
206 nmdc:mga06r32_188669_c1 3300050510 Bacteria 2049
207 nmdc:mga0n895_11500_c1 3300050512 Bacteria 7900
208 nmdc:mga0n895_177_c1 3300050512 Bacteria 39316
209 nmdc:mga0n895_37772_c1 3300050512 Bacteria 4674
210 nmdc:mga0n895_73624_c1 3300050512 Bacteria 3392
211 nmdc:mga0rr50_110147_c1 3300050513 Bacteria 2178
212 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
213 nmdc:mga0rr50_4970_c1 3300050513 Bacteria 7874
214 nmdc:mga08x19_135859_c1 3300050514 Bacteria 1658
215 nmdc:mga08x19_567_c1 3300050514 Bacteria 24222
216 nmdc:mga0a205_116987_c1 3300050515 Bacteria 2564
217 nmdc:mga0a205_32823_c1 3300050515 Bacteria 4977
218 Ga0530510_0001943 3300061734 Bacteria 14142
219 Ga0530510_0061754 3300061734 Bacteria 2713
220 Ga0207699_10086373
221 JGI25406J46586_10001567
222 Ga0065712_10076574
223 Ga0065715_10034917
224 Ga0065715_10138269
225 Ga0065707_10008116
226 Ga0070676_10000655
227 Ga0070670_100012001
228 Ga0070670_100193618
229 Ga0070680_100129382
230 Ga0068868_100078442
231 Ga0070660_100027675
232 Ga0070689_100034228
233 Ga0070689_100081920
234 Ga0070668_100013890
235 Ga0070668_100222102
236 Ga0070669_100024222
237 Ga0070669_100044939
238 Ga0070669_100071101
239 Ga0070675_100003943
240 Ga0070675_100218878
241 Ga0070671_100031001
242 Ga0070674_100031401
243 Ga0070673_100002471
244 Ga0070673_100007118
245 Ga0070688_100016681
246 Ga0070688_100023549
247 Ga0070659_100007006
248 Ga0070711_100086425
249 Ga0070711_100113614
250 Ga0070705_100011124
251 Ga0070700_100001007
252 Ga0070700_100030949
253 Ga0070694_100037023
254 Ga0070694_100041827
255 Ga0070694_100109778
256 Ga0070681_10106295
257 Ga0070681_10139764
258 Ga0070698_100077056
259 Ga0070698_100123207
260 Ga0070699_100032831
261 Ga0070699_100093374
262 Ga0070679_100079057
263 Ga0070679_100079901
264 Ga0070697_100046250
265 Ga0070695_100004379
266 Ga0070695_100021093
267 Ga0070695_100047683
268 Ga0070696_100125512
269 Ga0070665_100004148
270 Ga0070665_100011998
271 Ga0068855_100032640
272 Ga0070702_100005268
273 Ga0068859_100022593
274 Ga0068864_100058981
275 Ga0068861_100077016
276 Ga0068863_100132593
277 Ga0068863_100144269
278 Ga0068858_100006634
279 Ga0068858_100009615
280 Ga0068858_100186406
281 Ga0068860_100004193
282 Ga0068860_100059562
283 Ga0068860_100078693
284 Ga0068862_100010732
285 Ga0068862_100034063
286 Ga0081539_10000012
287 Ga0081539_10000277
288 Ga0081539_10007743
289 Ga0097621_100001151
290 Ga0097621_100025733
291 Ga0068871_100018772
292 Ga0068871_100233247
293 Ga0075428_100077401
294 Ga0075428_100079678
295 Ga0075428_100125513
296 Ga0075430_100037804
297 Ga0075430_100054957
298 Ga0075430_100145377
299 Ga0075431_100176243
300 Ga0075434_100019512
301 Ga0075434_100036116
302 Ga0075429_100044894
303 Ga0075429_100098576
304 Ga0068865_100087217
305 Ga0075436_100000920
306 Ga0075436_100089570
307 Ga0097620_100022594
308 Ga0075435_100000723
309 Ga0075435_100004407
310 Ga0075435_100048979
311 Ga0111539_10010269
312 Ga0111539_10058818
313 Ga0111539_10062227
314 Ga0105245_10007901
315 Ga0114129_10011610
316 Ga0114129_10066562
317 Ga0114129_10071829
318 Ga0114129_10141540
319 Ga0114129_10159162
320 Ga0114129_10287043
321 Ga0114129_10365354
322 Ga0105243_10021851
323 Ga0105242_10057871
324 Ga0105242_10059590
325 Ga0105242_10065497
326 Ga0105242_10284288
327 Ga0105248_10012222
328 Ga0105248_10078212
329 Ga0105237_10094779
330 Ga0105239_10239984
331 Ga0105239_10473755
332 Ga0163162_10002399
333 Ga0163162_10148562
334 Ga0157375_10086012
335 Ga0163163_10034495
336 Ga0157380_10113903
337 Ga0157377_10066691
338 Ga0157379_10135342
339 Ga0157376_10048718
340 Ga0157376_10304499
341 Ga0207697_10065103
342 Ga0207680_10043904
343 Ga0207705_10204407
344 Ga0207707_10094688
345 Ga0207695_10027454
346 Ga0207663_10050453
347 Ga0207662_10034553
348 Ga0207657_10038366
349 Ga0207652_10201409
350 Ga0207659_10000240
351 Ga0207706_10023829
352 Ga0207706_10053159
353 Ga0207686_10046763
354 Ga0207670_10002781
355 Ga0207670_10082939
356 Ga0207691_10023924
357 Ga0207691_10031952
358 Ga0207691_10033821
359 Ga0207711_10012687
360 Ga0207711_10020960
361 Ga0207651_10018627
362 Ga0207668_10008269
363 Ga0207668_10082207
364 Ga0207703_10097586
365 Ga0207703_10111785
366 Ga0207708_10017550
367 Ga0207641_10032814
368 Ga0207648_10035077
369 Ga0207648_10035506
370 Ga0207676_10064104
371 Ga0207675_100010701
372 Ga0207675_100046493
373 Ga0207683_10002758
374 Ga0207683_10086753
375 Ga0207683_10192342
376 Ga0207428_10146383
377 Ga0268264_10012373
378 Ga0268264_10030521
379 Ga0265316_10015020
380 Ga0307410_10010803
381 Ga0307409_100029208
382 Ga0373939_0000591
383 Ga0373939_0024944
384 Ga0373955_0014308
385 Ga0373942_0001908
386 Ga0373924_0069621
387 Ga0373931_0041303
388 Ga0373935_0042050
389 Ga0373927_0197022
390 Ga0373933_0047303
391 Ga0373937_0018213
392 Ga0373937_0030883
393 Ga0373937_0078554
394 Ga0373925_0037975
395 Ga0436365_1911074
396 Ga0495580_0027280
397 Ga0495645_0006613
398 Ga0495645_0171188
399 Ga0495613_0031292
400 Ga0495674_0024425
401 Ga0496100_0008243
402 Ga0496101_0001951
403 Ga0496104_0013373
404 Ga0496107_0214682
405 Ga0496108_0015007
406 Ga0496112_0088236
407 Ga0496113_0005129
408 Ga0496114_0006131
409 Ga0501039_0099155
410 Ga0501040_0039114
411 Ga0501041_0007533
412 Ga0501042_0012190
413 Ga0501072_0006907
414 Ga0501074_0062109
415 Ga0501075_0035962
416 Ga0501076_0054573
417 Ga0501079_0055430
418 nmdc:mga05p37_114865_c1
419 nmdc:mga05p37_132060_c1
420 nmdc:mga05p37_249886_c1
421 nmdc:mga05p37_38968_c1
422 nmdc:mga05p37_56901_c1
423 nmdc:mga05p37_66602_c1
424 nmdc:mga0qj67_32147_c1
425 nmdc:mga06r32_188669_c1
426 nmdc:mga0n895_11500_c1
427 nmdc:mga0n895_177_c1
428 nmdc:mga0n895_37772_c1
429 nmdc:mga0n895_73624_c1
430 nmdc:mga0rr50_110147_c1
431 nmdc:mga0rr50_36_c1
432 nmdc:mga0rr50_4970_c1
433 nmdc:mga08x19_135859_c1
434 nmdc:mga08x19_567_c1
435 nmdc:mga0a205_116987_c1
436 nmdc:mga0a205_32823_c1
437 Ga0530510_0001943
438 Ga0530510_0061754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13795

HupE_UreJ_2

HupE / UreJ protein

339

419

0.88

PF13795

HupE_UreJ_2

HupE / UreJ protein

226

325

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f1b-assembly4.cif.gz_D structure of zinc-bound zrga deletion 124-184 from vibrio cholerae 0.5748 29 195
8ezw-assembly6.cif.gz_F structure of apo zrga deletion 124-184 from vibrio cholerae 0.5716 30 195
8ezw-assembly4.cif.gz_D structure of apo zrga deletion 124-184 from vibrio cholerae 0.5665 30 195
8ezw-assembly6.cif.gz_F structure of apo zrga deletion 124-184 from vibrio cholerae 0.5647 30 195
8ezw-assembly4.cif.gz_D structure of apo zrga deletion 124-184 from vibrio cholerae 0.56 30 195
ID Description Score Start End Superfamily
af_Q564R0_10_102_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.74 27 47 3.40.1000.30
af_A4HZ15_1_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.6533 167 198 3.40.140.10
af_A0A0R0GPJ1_84_203_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5783 26 48 3.30.420.40
af_Q0D5J2_1_233_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5579 202 409 1.20.1250.20
af_Q69S28_20_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5421 202 408 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V8C1K8-F1-model_v4 Uncharacterized protein 0.9641 20 144
AF-A0A661FWN5-F1-model_v4 Uncharacterized protein 0.9518 19 199
AF-A0A537TJ02-F1-model_v4 Uncharacterized protein 0.9423 19 180
AF-A0A7C2NM29-F1-model_v4 HupE/UreJ family protein 0.9402 20 423 GO:0016020
AF-A0A7C2NM29-F1-model_v4 HupE/UreJ family protein 0.9149 20 423 GO:0016020

Map