F331118

General Info

Members Datasets Scaffolds Average Seq Length
219 137 438 399

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10037257|Ga0157379_100372573
Length 417
Sequence VSKPSKDTKEEVGVKVLIADSFEQSGVTGLIAAGCEVVYKPELKDEALAAAIRETAADVLVVRGTAVTGPMLERGSLSLIVRAGAGYNTIDVAAASRRGIYVSNCPGKNAIAVAELAFALLLAVDRRVPDEVADLRAGTWNKKEYSKARGLFGRTIGLLGYGSIGQEMARRAHAFGMPIVVWSRRFATGRDDVANQAVPMQLASSPADAASRCDVLSVHLALNAETKGLVNATVLDRLKPGSYFINTARGEVVDYDALARAVRERDIRVGLDVFAAEPTTATGEFTDAIVALKNVYGTHHVGASTDQAQEAIAAETVRIITSYQDTGKVPNVVNLAKKTPATHLLVVRHRDRPGVLAHVFDRLRSGQINVQETENIIFEGAEAAVARINLDGAPPPALLKQIQEGNSDILDLHLVAI

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.2
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10037257 3300014968 Bacteria 4336
2 Ga0065715_10008022 3300005293 Unclassified 2915
3 Ga0070658_10027465 3300005327 Bacteria 4567
4 Ga0070683_100103327 3300005329 Bacteria 2685
5 Ga0070670_100041796 3300005331 Bacteria 3939
6 Ga0070680_100128557 3300005336 Bacteria 2118
7 Ga0068868_100001378 3300005338 Bacteria 16752
8 Ga0068868_100003340 3300005338 Bacteria 11164
9 Ga0070660_100003964 3300005339 Bacteria 10225
10 Ga0070660_100089321 3300005339 Unclassified 2428
11 Ga0070691_10003931 3300005341 Bacteria 6722
12 Ga0070691_10057077 3300005341 Bacteria 1873
13 Ga0070687_100004326 3300005343 Bacteria 5651
14 Ga0070675_100168611 3300005354 Bacteria 1887
15 Ga0070671_100008102 3300005355 Bacteria 8415
16 Ga0070674_100005495 3300005356 Bacteria 7325
17 Ga0070673_100157801 3300005364 Bacteria 1927
18 Ga0070659_100184254 3300005366 Bacteria 1714
19 Ga0070714_100011784 3300005435 Bacteria 6948
20 Ga0070705_100000093 3300005440 Bacteria 49846
21 Ga0070700_100006696 3300005441 Bacteria 6171
22 Ga0070700_100020128 3300005441 Bacteria 3860
23 Ga0070700_100037046 3300005441 Bacteria 2963
24 Ga0070700_100152946 3300005441 Bacteria 1580
25 Ga0070662_100037744 3300005457 Bacteria 3427
26 Ga0070681_10000481 3300005458 Bacteria 32558
27 Ga0070681_10033552 3300005458 Bacteria 5152
28 Ga0068867_100013662 3300005459 Bacteria 5750
29 Ga0070707_100014941 3300005468 Bacteria 7285
30 Ga0070707_100114414 3300005468 Bacteria 2618
31 Ga0070698_100018952 3300005471 Bacteria 7239
32 Ga0070698_100108737 3300005471 Bacteria 2739
33 Ga0070699_100005421 3300005518 Bacteria 11185
34 Ga0070699_100045198 3300005518 Bacteria 3812
35 Ga0070699_100063498 3300005518 Bacteria 3202
36 Ga0070679_100082309 3300005530 Bacteria 3208
37 Ga0070679_100131384 3300005530 Bacteria 2485
38 Ga0070697_100014778 3300005536 Bacteria 6127
39 Ga0070697_100069910 3300005536 Bacteria 2877
40 Ga0070686_100143893 3300005544 Bacteria 1663
41 Ga0070695_100000038 3300005545 Bacteria 49915
42 Ga0070696_100000723 3300005546 Bacteria 21142
43 Ga0070696_100007098 3300005546 Bacteria 7480
44 Ga0070696_100134288 3300005546 Bacteria 1803
45 Ga0070665_100002140 3300005548 Bacteria 22043
46 Ga0068857_100203128 3300005577 Bacteria 1807
47 Ga0068854_100005937 3300005578 Bacteria 7735
48 Ga0068854_100060020 3300005578 Bacteria 2749
49 Ga0070702_100073294 3300005615 Bacteria 2028
50 Ga0068859_100027516 3300005617 Bacteria 5703
51 Ga0068859_100275247 3300005617 Bacteria 1776
52 Ga0068864_100004064 3300005618 Bacteria 12023
53 Ga0068864_100006077 3300005618 Bacteria 9909
54 Ga0068866_10013829 3300005718 Bacteria 3549
55 Ga0068861_100031683 3300005719 Bacteria 3886
56 Ga0068851_10010035 3300005834 Bacteria 4411
57 Ga0068863_100026230 3300005841 Bacteria 5561
58 Ga0068858_100005269 3300005842 Bacteria 12666
59 Ga0068858_100005466 3300005842 Bacteria 12439
60 Ga0068858_100100401 3300005842 Bacteria 2699
61 Ga0068858_100170254 3300005842 Bacteria 2054
62 Ga0068860_100243663 3300005843 Bacteria 1749
63 Ga0068862_100001890 3300005844 Bacteria 18988
64 Ga0081455_10081195 3300005937 Bacteria 2656
65 Ga0081539_10008359 3300005985 Bacteria 9043
66 Ga0075432_10037984 3300006058 Bacteria 1677
67 Ga0097621_100010325 3300006237 Bacteria 6826
68 Ga0097621_100090690 3300006237 Bacteria 2558
69 Ga0068871_100114224 3300006358 Bacteria 2275
70 Ga0075433_10017898 3300006852 Bacteria 5878
71 Ga0075433_10054982 3300006852 Bacteria 3474
72 Ga0075433_10055440 3300006852 Bacteria 3460
73 Ga0075433_10316704 3300006852 Bacteria 1380
74 Ga0075434_100010633 3300006871 Bacteria 8636
75 Ga0075434_100013110 3300006871 Bacteria 7872
76 Ga0075434_100022077 3300006871 Bacteria 6197
77 Ga0075434_100063759 3300006871 Bacteria 3668
78 Ga0075434_100098754 3300006871 Bacteria 2925
79 Ga0068865_100110862 3300006881 Bacteria 2024
80 Ga0075436_100000300 3300006914 Bacteria 31581
81 Ga0075436_100018510 3300006914 Bacteria 4767
82 Ga0075436_100042205 3300006914 Bacteria 3146
83 Ga0097620_100027515 3300006931 Bacteria 5703
84 Ga0097620_100275243 3300006931 Bacteria 1776
85 Ga0075435_100000109 3300007076 Bacteria 45253
86 Ga0075435_100002288 3300007076 Bacteria 12651
87 Ga0075435_100021728 3300007076 Bacteria 4942
88 Ga0075435_100059170 3300007076 Bacteria 3106
89 Ga0105240_10016546 3300009093 Bacteria 9982
90 Ga0111539_10392828 3300009094 Bacteria 1615
91 Ga0105245_10010149 3300009098 Bacteria 8201
92 Ga0105245_10125398 3300009098 Bacteria 2403
93 Ga0105247_10113964 3300009101 Bacteria 1743
94 Ga0105247_10120770 3300009101 Unclassified 1697
95 Ga0114129_10000382 3300009147 Bacteria 51464
96 Ga0114129_10008812 3300009147 Bacteria 14392
97 Ga0114129_10017759 3300009147 Bacteria 10130
98 Ga0114129_10173251 3300009147 Bacteria 2940
99 Ga0114129_10452473 3300009147 Bacteria 1684
100 Ga0105243_10020911 3300009148 Bacteria 4966
101 Ga0105242_10005479 3300009176 Bacteria 9803
102 Ga0105248_10034415 3300009177 Bacteria 5664
103 Ga0105248_10094403 3300009177 Bacteria 3368
104 Ga0105248_10480567 3300009177 Bacteria 1400
105 Ga0105238_10041952 3300009551 Bacteria 4634
106 Ga0105249_10307154 3300009553 Bacteria 1593
107 Ga0157374_10009988 3300013296 Bacteria 8150
108 Ga0163162_10036364 3300013306 Bacteria 4907
109 Ga0163162_10102597 3300013306 Bacteria 2954
110 Ga0157375_10061612 3300013308 Bacteria 3726
111 Ga0157375_10210151 3300013308 Bacteria 2103
112 Ga0157375_10314622 3300013308 Unclassified 1730
113 Ga0163163_10003833 3300014325 Bacteria 12802
114 Ga0157380_10003182 3300014326 Bacteria 11208
115 Ga0157380_10046332 3300014326 Bacteria 3414
116 Ga0157379_10006919 3300014968 Bacteria 9807
117 Ga0157376_10028878 3300014969 Bacteria 4413
118 Ga0157376_10057595 3300014969 Bacteria 3251
119 Ga0157376_10281869 3300014969 Bacteria 1565
120 Ga0207656_10056984 3300025321 Bacteria 1704
121 Ga0207710_10031822 3300025900 Bacteria 2309
122 Ga0207645_10002243 3300025907 Bacteria 15389
123 Ga0207654_10084382 3300025911 Bacteria 1920
124 Ga0207695_10125924 3300025913 Bacteria 2524
125 Ga0207695_10304587 3300025913 Bacteria 1484
126 Ga0207660_10044443 3300025917 Bacteria 3125
127 Ga0207657_10069852 3300025919 Unclassified 2978
128 Ga0207652_10286417 3300025921 Bacteria 1486
129 Ga0207646_10026768 3300025922 Bacteria 5261
130 Ga0207650_10030935 3300025925 Bacteria 3862
131 Ga0207687_10022704 3300025927 Bacteria 4178
132 Ga0207706_10099277 3300025933 Bacteria 2561
133 Ga0207706_10107302 3300025933 Bacteria 2457
134 Ga0207686_10006600 3300025934 Bacteria 6253
135 Ga0207669_10076314 3300025937 Bacteria 2127
136 Ga0207704_10014980 3300025938 Bacteria 3937
137 Ga0207665_10064320 3300025939 Bacteria 2493
138 Ga0207691_10250173 3300025940 Bacteria 1530
139 Ga0207711_10088813 3300025941 Bacteria 2714
140 Ga0207689_10098026 3300025942 Bacteria 2408
141 Ga0207689_10166888 3300025942 Bacteria 1814
142 Ga0207667_10058931 3300025949 Bacteria 4025
143 Ga0207667_10088037 3300025949 Bacteria 3212
144 Ga0207668_10165770 3300025972 Bacteria 1727
145 Ga0207640_10041465 3300025981 Bacteria 2928
146 Ga0207677_10001851 3300026023 Bacteria 11187
147 Ga0207677_10009382 3300026023 Bacteria 5508
148 Ga0207703_10006403 3300026035 Bacteria 9411
149 Ga0207703_10006772 3300026035 Bacteria 9138
150 Ga0207703_10150570 3300026035 Bacteria 2028
151 Ga0207708_10002553 3300026075 Bacteria 13395
152 Ga0207708_10058062 3300026075 Bacteria 2953
153 Ga0207641_10000334 3300026088 Bacteria 57516
154 Ga0207648_10020740 3300026089 Bacteria 5916
155 Ga0207648_10100163 3300026089 Bacteria 2538
156 Ga0207648_10121060 3300026089 Bacteria 2301
157 Ga0207648_10150017 3300026089 Bacteria 2057
158 Ga0207676_10005748 3300026095 Bacteria 8774
159 Ga0207676_10007086 3300026095 Bacteria 7947
160 Ga0207675_100000540 3300026118 Bacteria 36892
161 Ga0207675_100163369 3300026118 Bacteria 2126
162 Ga0209971_1007369 3300027682 Bacteria 2609
163 Ga0207428_10028454 3300027907 Bacteria 4644
164 Ga0207428_10067082 3300027907 Bacteria 2826
165 Ga0268266_10008105 3300028379 Bacteria 9379
166 Ga0265338_10002402 3300028800 Bacteria 28169
167 Ga0307408_100199311 3300031548 Bacteria 1619
168 Ga0307409_100122616 3300031995 Archaea 2204
169 Ga0307416_100101971 3300032002 Bacteria 2501
170 Ga0307414_10087461 3300032004 Archaea 2303
171 Ga0373941_0019636 3300035115 Bacteria 1884
172 Ga0373955_0048767 3300035172 Bacteria 2298
173 Ga0373935_0126370 3300035692 Bacteria 1714
174 Ga0373937_0017981 3300036401 Bacteria 6306
175 Ga0450895_004189 3300042132 Bacteria 1133
176 Ga0439460_0034397 3300042461 Unclassified 1461
177 Ga0451577_0283627 3300042876 Bacteria 1501
178 Ga0495651_0129366 3300046462 Bacteria 1845
179 Ga0495621_0013678 3300046539 Bacteria 2554
180 Ga0495645_0000296 3300046543 Bacteria 36239
181 Ga0495658_0018181 3300046683 Bacteria 3649
182 Ga0495674_0258002 3300047319 Bacteria 1433
183 Ga0496102_0022492 3300048905 Bacteria 5587
184 Ga0496105_0117432 3300048908 Unclassified 2194
185 Ga0496106_0120095 3300048909 Bacteria 2054
186 Ga0496108_0004275 3300048911 Bacteria 11498
187 Ga0496112_0010516 3300048915 Bacteria 8398
188 Ga0496112_0100384 3300048915 Bacteria 2863
189 Ga0496113_0089350 3300048916 Bacteria 2371
190 Ga0501041_0053599 3300049577 Bacteria 2460
191 Ga0501047_0335519 3300049581 Bacteria 1350
192 Ga0501073_0000137 3300049589 Bacteria 47762
193 Ga0501081_0038457 3300049743 Bacteria 3269
194 nmdc:mga05p37_135683_c1 3300050507 Bacteria 3018
195 nmdc:mga05p37_28946_c1 3300050507 Bacteria 6759
196 nmdc:mga05p37_4217_c1 3300050507 Bacteria 16790
197 nmdc:mga05p37_53629_c1 3300050507 Bacteria 4959
198 nmdc:mga05p37_9064_c1 3300050507 Bacteria 11762
199 nmdc:mga05p37_9569_c1 3300050507 Bacteria 11478
200 nmdc:mga08y16_128889_c1 3300050511 Bacteria 2632
201 nmdc:mga08y16_3195_c1 3300050511 Bacteria 16957
202 nmdc:mga0n895_104876_c1 3300050512 Bacteria 2839
203 nmdc:mga0n895_2019_c1 3300050512 Bacteria 15602
204 nmdc:mga0n895_210684_c1 3300050512 Bacteria 1974
205 nmdc:mga0n895_32655_c1 3300050512 Bacteria 4997
206 nmdc:mga0n895_61657_c1 3300050512 Bacteria 3704
207 nmdc:mga0rr50_20999_c1 3300050513 Bacteria 4449
208 nmdc:mga0rr50_54434_c1 3300050513 Bacteria 2981
209 nmdc:mga0rr50_67_c1 3300050513 Bacteria 62768
210 nmdc:mga08x19_10307_c1 3300050514 Bacteria 5611
211 nmdc:mga08x19_18722_c1 3300050514 Bacteria 4244
212 nmdc:mga08x19_4494_c1 3300050514 Bacteria 8267
213 nmdc:mga08x19_648_c1 3300050514 Bacteria 22484
214 nmdc:mga0a205_190851_c1 3300050515 Bacteria 1941
215 nmdc:mga0a205_47049_c1 3300050515 Bacteria 3694
216 nmdc:mga0a205_93904_c1 3300050515 Bacteria 2898
217 Ga0495595_0021693 3300053084 Bacteria 2809
218 Ga0500556_0004009 3300053104 Bacteria 4242
219 Ga0590071_006068 3300059421 Bacteria 2887
220 Ga0157379_10037257
221 Ga0065715_10008022
222 Ga0070658_10027465
223 Ga0070683_100103327
224 Ga0070670_100041796
225 Ga0070680_100128557
226 Ga0068868_100001378
227 Ga0068868_100003340
228 Ga0070660_100003964
229 Ga0070660_100089321
230 Ga0070691_10003931
231 Ga0070691_10057077
232 Ga0070687_100004326
233 Ga0070675_100168611
234 Ga0070671_100008102
235 Ga0070674_100005495
236 Ga0070673_100157801
237 Ga0070659_100184254
238 Ga0070714_100011784
239 Ga0070705_100000093
240 Ga0070700_100006696
241 Ga0070700_100020128
242 Ga0070700_100037046
243 Ga0070700_100152946
244 Ga0070662_100037744
245 Ga0070681_10000481
246 Ga0070681_10033552
247 Ga0068867_100013662
248 Ga0070707_100014941
249 Ga0070707_100114414
250 Ga0070698_100018952
251 Ga0070698_100108737
252 Ga0070699_100005421
253 Ga0070699_100045198
254 Ga0070699_100063498
255 Ga0070679_100082309
256 Ga0070679_100131384
257 Ga0070697_100014778
258 Ga0070697_100069910
259 Ga0070686_100143893
260 Ga0070695_100000038
261 Ga0070696_100000723
262 Ga0070696_100007098
263 Ga0070696_100134288
264 Ga0070665_100002140
265 Ga0068857_100203128
266 Ga0068854_100005937
267 Ga0068854_100060020
268 Ga0070702_100073294
269 Ga0068859_100027516
270 Ga0068859_100275247
271 Ga0068864_100004064
272 Ga0068864_100006077
273 Ga0068866_10013829
274 Ga0068861_100031683
275 Ga0068851_10010035
276 Ga0068863_100026230
277 Ga0068858_100005269
278 Ga0068858_100005466
279 Ga0068858_100100401
280 Ga0068858_100170254
281 Ga0068860_100243663
282 Ga0068862_100001890
283 Ga0081455_10081195
284 Ga0081539_10008359
285 Ga0075432_10037984
286 Ga0097621_100010325
287 Ga0097621_100090690
288 Ga0068871_100114224
289 Ga0075433_10017898
290 Ga0075433_10054982
291 Ga0075433_10055440
292 Ga0075433_10316704
293 Ga0075434_100010633
294 Ga0075434_100013110
295 Ga0075434_100022077
296 Ga0075434_100063759
297 Ga0075434_100098754
298 Ga0068865_100110862
299 Ga0075436_100000300
300 Ga0075436_100018510
301 Ga0075436_100042205
302 Ga0097620_100027515
303 Ga0097620_100275243
304 Ga0075435_100000109
305 Ga0075435_100002288
306 Ga0075435_100021728
307 Ga0075435_100059170
308 Ga0105240_10016546
309 Ga0111539_10392828
310 Ga0105245_10010149
311 Ga0105245_10125398
312 Ga0105247_10113964
313 Ga0105247_10120770
314 Ga0114129_10000382
315 Ga0114129_10008812
316 Ga0114129_10017759
317 Ga0114129_10173251
318 Ga0114129_10452473
319 Ga0105243_10020911
320 Ga0105242_10005479
321 Ga0105248_10034415
322 Ga0105248_10094403
323 Ga0105248_10480567
324 Ga0105238_10041952
325 Ga0105249_10307154
326 Ga0157374_10009988
327 Ga0163162_10036364
328 Ga0163162_10102597
329 Ga0157375_10061612
330 Ga0157375_10210151
331 Ga0157375_10314622
332 Ga0163163_10003833
333 Ga0157380_10003182
334 Ga0157380_10046332
335 Ga0157379_10006919
336 Ga0157376_10028878
337 Ga0157376_10057595
338 Ga0157376_10281869
339 Ga0207656_10056984
340 Ga0207710_10031822
341 Ga0207645_10002243
342 Ga0207654_10084382
343 Ga0207695_10125924
344 Ga0207695_10304587
345 Ga0207660_10044443
346 Ga0207657_10069852
347 Ga0207652_10286417
348 Ga0207646_10026768
349 Ga0207650_10030935
350 Ga0207687_10022704
351 Ga0207706_10099277
352 Ga0207706_10107302
353 Ga0207686_10006600
354 Ga0207669_10076314
355 Ga0207704_10014980
356 Ga0207665_10064320
357 Ga0207691_10250173
358 Ga0207711_10088813
359 Ga0207689_10098026
360 Ga0207689_10166888
361 Ga0207667_10058931
362 Ga0207667_10088037
363 Ga0207668_10165770
364 Ga0207640_10041465
365 Ga0207677_10001851
366 Ga0207677_10009382
367 Ga0207703_10006403
368 Ga0207703_10006772
369 Ga0207703_10150570
370 Ga0207708_10002553
371 Ga0207708_10058062
372 Ga0207641_10000334
373 Ga0207648_10020740
374 Ga0207648_10100163
375 Ga0207648_10121060
376 Ga0207648_10150017
377 Ga0207676_10005748
378 Ga0207676_10007086
379 Ga0207675_100000540
380 Ga0207675_100163369
381 Ga0209971_1007369
382 Ga0207428_10028454
383 Ga0207428_10067082
384 Ga0268266_10008105
385 Ga0265338_10002402
386 Ga0307408_100199311
387 Ga0307409_100122616
388 Ga0307416_100101971
389 Ga0307414_10087461
390 Ga0373941_0019636
391 Ga0373955_0048767
392 Ga0373935_0126370
393 Ga0373937_0017981
394 Ga0450895_004189
395 Ga0439460_0034397
396 Ga0451577_0283627
397 Ga0495651_0129366
398 Ga0495621_0013678
399 Ga0495645_0000296
400 Ga0495658_0018181
401 Ga0495674_0258002
402 Ga0496102_0022492
403 Ga0496105_0117432
404 Ga0496106_0120095
405 Ga0496108_0004275
406 Ga0496112_0010516
407 Ga0496112_0100384
408 Ga0496113_0089350
409 Ga0501041_0053599
410 Ga0501047_0335519
411 Ga0501073_0000137
412 Ga0501081_0038457
413 nmdc:mga05p37_135683_c1
414 nmdc:mga05p37_28946_c1
415 nmdc:mga05p37_4217_c1
416 nmdc:mga05p37_53629_c1
417 nmdc:mga05p37_9064_c1
418 nmdc:mga05p37_9569_c1
419 nmdc:mga08y16_128889_c1
420 nmdc:mga08y16_3195_c1
421 nmdc:mga0n895_104876_c1
422 nmdc:mga0n895_2019_c1
423 nmdc:mga0n895_210684_c1
424 nmdc:mga0n895_32655_c1
425 nmdc:mga0n895_61657_c1
426 nmdc:mga0rr50_20999_c1
427 nmdc:mga0rr50_54434_c1
428 nmdc:mga0rr50_67_c1
429 nmdc:mga08x19_10307_c1
430 nmdc:mga08x19_18722_c1
431 nmdc:mga08x19_4494_c1
432 nmdc:mga08x19_648_c1
433 nmdc:mga0a205_190851_c1
434 nmdc:mga0a205_47049_c1
435 nmdc:mga0a205_93904_c1
436 Ga0495595_0021693
437 Ga0500556_0004009
438 Ga0590071_006068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

16

334

0.98

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

155

276

0.94

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

118

302

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrb-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution 0.8982 320 370
1y7p-assembly2.cif.gz_B 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator 0.8672 320 393
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.8622 88 285
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.8574 87 295
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.854 88 285
ID Description Score Start End Superfamily
af_Q58424_451_524_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9604 321 393 3.30.70.260
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.96 131 160 3.50.50.60
af_A0A1D6DW07_553_626_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9483 321 393 3.30.70.260
af_Q2FXK1_457_530_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9361 321 393 3.30.70.260
af_Q58424_451_524_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9354 321 393 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A117LIH5-F1-model_v4 deleted 0.9605 319 392
AF-A0A7X6A6N6-F1-model_v4 ACT domain-containing protein 0.951 317 393
AF-A0A662TGW4-F1-model_v4 L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta (EC 4.3.1.17) 0.9469 318 392 GO:0003941
GO:0006094
GO:0046872
GO:0051539
AF-A0A845S079-F1-model_v4 ACT domain-containing protein 0.9434 319 393
AF-A0A117LF12-F1-model_v4 D-3-phosphoglycerate dehydrogenase 0.9335 320 393

Map