F331019

General Info

Members Datasets Scaffolds Average Seq Length
219 131 438 170

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_12227234|Ga0111539_122272342
Length 169
Sequence MVDTLSFYIFALLVLGGGVMTITRRNAVHSALWLIVSLLGAAGLFLLRGAEFLFAVQIVLYIGGVVLLILYVVMLVNLDETAKGKQFNKQWLVALVCVVVVGAELAFVLKRGLASLELPAAASNAAAGVGNTERVADLMFRDYLLPFEVASLLLLVAVVGAVVMAKKRI

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_12227234 3300009094 Unclassified 636
2 Ga0070676_10416432 3300005328 Bacteria 938
3 Ga0070683_100155834 3300005329 Bacteria 2166
4 Ga0070690_100764761 3300005330 Bacteria 747
5 Ga0068868_100243339 3300005338 Bacteria 1512
6 Ga0068868_100298938 3300005338 Bacteria 1367
7 Ga0070689_100820564 3300005340 Bacteria 819
8 Ga0070675_100361594 3300005354 Bacteria 1289
9 Ga0070671_100736028 3300005355 Bacteria 857
10 Ga0070673_100037452 3300005364 Bacteria 3696
11 Ga0070713_100246351 3300005436 Bacteria 1629
12 Ga0070711_100074316 3300005439 Bacteria 2404
13 Ga0070711_100351003 3300005439 Bacteria 1186
14 Ga0070705_100078338 3300005440 Bacteria 2021
15 Ga0070708_101198667 3300005445 Bacteria 710
16 Ga0070678_100593959 3300005456 Bacteria 988
17 Ga0070681_10002496 3300005458 Bacteria 16846
18 Ga0070699_100084914 3300005518 Bacteria 2763
19 Ga0070679_100077012 3300005530 Bacteria 3324
20 Ga0070684_100323079 3300005535 Bacteria 1418
21 Ga0070697_100376045 3300005536 Bacteria 1230
22 Ga0070672_101227537 3300005543 Bacteria 668
23 Ga0070695_100110541 3300005545 Bacteria 1864
24 Ga0070695_100111155 3300005545 Bacteria 1860
25 Ga0070696_100001830 3300005546 Bacteria 13961
26 Ga0070665_101049170 3300005548 Bacteria 827
27 Ga0070704_100918362 3300005549 Bacteria 788
28 Ga0068857_101437496 3300005577 Bacteria 671
29 Ga0068856_100950849 3300005614 Bacteria 878
30 Ga0068856_101267352 3300005614 Bacteria 753
31 Ga0068852_100818343 3300005616 Bacteria 946
32 Ga0068864_100118978 3300005618 Bacteria 2360
33 Ga0068864_100488610 3300005618 Bacteria 1183
34 Ga0068863_100008903 3300005841 Bacteria 9800
35 Ga0068863_100279770 3300005841 Bacteria 1616
36 Ga0068863_101705764 3300005841 Bacteria 639
37 Ga0068858_100460778 3300005842 Bacteria 1226
38 Ga0068858_101629280 3300005842 Bacteria 637
39 Ga0068860_100295797 3300005843 Bacteria 1585
40 Ga0068860_100825866 3300005843 Bacteria 941
41 Ga0068860_101520201 3300005843 Bacteria 691
42 Ga0070717_10132866 3300006028 Bacteria 2142
43 Ga0070717_10454902 3300006028 Bacteria 1154
44 Ga0070715_10153088 3300006163 Bacteria 1132
45 Ga0070716_100775123 3300006173 Unclassified 740
46 Ga0070716_100973758 3300006173 Bacteria 669
47 Ga0070716_101121500 3300006173 Bacteria 628
48 Ga0070712_100848288 3300006175 Bacteria 786
49 Ga0097621_100042999 3300006237 Bacteria 3641
50 Ga0097621_100342878 3300006237 Bacteria 1327
51 Ga0097621_100393811 3300006237 Unclassified 1239
52 Ga0097621_101628090 3300006237 Bacteria 614
53 Ga0068871_101472345 3300006358 Bacteria 643
54 Ga0075430_100185873 3300006846 Bacteria 1728
55 Ga0075435_101038240 3300007076 Bacteria 716
56 Ga0105240_10046926 3300009093 Bacteria 5469
57 Ga0105240_10209497 3300009093 Bacteria 2279
58 Ga0111539_11931359 3300009094 Bacteria 684
59 Ga0105245_10146919 3300009098 Bacteria 2225
60 Ga0105241_10597879 3300009174 Bacteria 996
61 Ga0105242_10489483 3300009176 Bacteria 1167
62 Ga0105248_10276656 3300009177 Bacteria 1890
63 Ga0105248_10297012 3300009177 Bacteria 1819
64 Ga0105248_10438747 3300009177 Bacteria 1471
65 Ga0105248_11492061 3300009177 Bacteria 765
66 Ga0105237_10019807 3300009545 Bacteria 6946
67 Ga0105238_10429562 3300009551 Bacteria 1316
68 Ga0105249_10812142 3300009553 Bacteria 999
69 Ga0105239_10156540 3300010375 Bacteria 2545
70 Ga0157370_10607228 3300013104 Unclassified 1001
71 Ga0157369_10446401 3300013105 Bacteria 1340
72 Ga0157374_10906874 3300013296 Unclassified 899
73 Ga0157374_11703959 3300013296 Bacteria 655
74 Ga0157378_10166500 3300013297 Unclassified 2065
75 Ga0157378_11671227 3300013297 Unclassified 683
76 Ga0163162_10675554 3300013306 Bacteria 1156
77 Ga0163162_11073874 3300013306 Bacteria 912
78 Ga0163162_11184519 3300013306 Bacteria 867
79 Ga0157372_10077276 3300013307 Bacteria 3759
80 Ga0157372_10083702 3300013307 Bacteria 3614
81 Ga0157375_10231837 3300013308 Bacteria 2005
82 Ga0157375_11318927 3300013308 Bacteria 849
83 Ga0163163_10119973 3300014325 Bacteria 2663
84 Ga0163163_10257970 3300014325 Bacteria 1794
85 Ga0163163_11500557 3300014325 Bacteria 735
86 Ga0157376_10012833 3300014969 Bacteria 6232
87 Ga0157376_10068559 3300014969 Bacteria 3004
88 Ga0157376_10251719 3300014969 Unclassified 1650
89 Ga0207680_10331515 3300025903 Bacteria 1066
90 Ga0207645_10233974 3300025907 Bacteria 1213
91 Ga0207654_10452543 3300025911 Bacteria 900
92 Ga0207707_10128996 3300025912 Bacteria 2212
93 Ga0207695_10095030 3300025913 Bacteria 2986
94 Ga0207695_10556221 3300025913 Bacteria 1029
95 Ga0207663_10608697 3300025916 Bacteria 859
96 Ga0207652_10045486 3300025921 Bacteria 3743
97 Ga0207650_10682681 3300025925 Bacteria 867
98 Ga0207650_11262576 3300025925 Bacteria 629
99 Ga0207687_10539027 3300025927 Bacteria 978
100 Ga0207686_10324541 3300025934 Bacteria 1151
101 Ga0207711_10524440 3300025941 Bacteria 1104
102 Ga0207711_11070732 3300025941 Bacteria 747
103 Ga0207711_11311467 3300025941 Unclassified 666
104 Ga0207661_10199896 3300025944 Bacteria 1757
105 Ga0207651_10019389 3300025960 Bacteria 4075
106 Ga0207677_10780373 3300026023 Bacteria 854
107 Ga0207703_10826112 3300026035 Bacteria 885
108 Ga0207641_10110754 3300026088 Bacteria 2434
109 Ga0207641_10264730 3300026088 Bacteria 1611
110 Ga0207676_10278089 3300026095 Bacteria 1519
111 Ga0207676_10935956 3300026095 Bacteria 851
112 Ga0207676_11933136 3300026095 Bacteria 589
113 Ga0207683_10082681 3300026121 Bacteria 2853
114 Ga0268266_10442271 3300028379 Bacteria 1235
115 Ga0268264_11216673 3300028381 Bacteria 763
116 Ga0265316_10005546 3300031344 Bacteria 12242
117 Ga0265316_10059692 3300031344 Bacteria 2965
118 Ga0265316_10155092 3300031344 Bacteria 1714
119 Ga0265314_10170481 3300031711 Bacteria 1314
120 Ga0265342_10110911 3300031712 Bacteria 1553
121 Ga0265342_10357982 3300031712 Bacteria 759
122 Ga0373934_0270371 3300035086 Bacteria 704
123 Ga0373945_0252196 3300035116 Bacteria 745
124 Ga0373953_0106240 3300035117 Bacteria 1185
125 Ga0373953_0288340 3300035117 Bacteria 716
126 Ga0373954_0090435 3300035118 Bacteria 1470
127 Ga0373946_0412767 3300035171 Bacteria 683
128 Ga0373935_0056681 3300035692 Bacteria 2499
129 Ga0373935_0128124 3300035692 Bacteria 1703
130 Ga0373927_0000360 3300035695 Bacteria 35294
131 Ga0373927_0331816 3300035695 Bacteria 1002
132 Ga0373927_0480467 3300035695 Bacteria 821
133 Ga0373947_0007179 3300035725 Bacteria 6458
134 Ga0373947_0389724 3300035725 Unclassified 939
135 Ga0373937_0495392 3300036401 Bacteria 1161
136 Ga0373937_1245865 3300036401 Bacteria 692
137 Ga0373937_1537897 3300036401 Unclassified 613
138 Ga0373925_0000378 3300037068 Bacteria 46198
139 Ga0373925_0102782 3300037068 Bacteria 2199
140 Ga0373925_0116304 3300037068 Bacteria 2071
141 Ga0373925_0657380 3300037068 Bacteria 864
142 Ga0451577_0371062 3300042876 Bacteria 1298
143 Ga0453683_0069433 3300044673 Bacteria 2203
144 Ga0466963_0426987 3300044694 Bacteria 935
145 Ga0453684_0214549 3300044712 Bacteria 2234
146 Ga0453684_1013392 3300044712 Bacteria 882
147 Ga0451576_0071732 3300045051 Bacteria 3605
148 Ga0451576_0303458 3300045051 Bacteria 1670
149 Ga0451576_0439534 3300045051 Bacteria 1369
150 Ga0451576_0445496 3300045051 Bacteria 1359
151 Ga0451576_0905015 3300045051 Bacteria 926
152 Ga0451576_0922919 3300045051 Bacteria 916
153 Ga0495592_0017175 3300046454 Bacteria 5495
154 Ga0495651_0060627 3300046462 Bacteria 2897
155 Ga0495651_0154342 3300046462 Bacteria 1651
156 Ga0495653_0105439 3300046463 Bacteria 2035
157 Ga0495580_0015616 3300046472 Bacteria 5721
158 Ga0495580_0072213 3300046472 Bacteria 2410
159 Ga0495580_0111745 3300046472 Bacteria 1898
160 Ga0495580_0253982 3300046472 Bacteria 1203
161 Ga0495580_0410835 3300046472 Bacteria 912
162 Ga0495582_0116088 3300046473 Bacteria 1506
163 Ga0495662_0045776 3300046476 Bacteria 2112
164 Ga0495664_0040849 3300046477 Bacteria 2743
165 Ga0495664_0248042 3300046477 Bacteria 1077
166 Ga0495594_0361069 3300046499 Bacteria 827
167 Ga0495608_0066978 3300046511 Bacteria 2350
168 Ga0495618_0235681 3300046514 Bacteria 1151
169 Ga0495628_0087084 3300046516 Bacteria 2422
170 Ga0495628_0169768 3300046516 Bacteria 1654
171 Ga0495630_0253506 3300046517 Bacteria 1344
172 Ga0495630_0351723 3300046517 Bacteria 1128
173 Ga0495652_0039502 3300046529 Bacteria 4080
174 Ga0495652_0223459 3300046529 Bacteria 1414
175 Ga0495640_0048268 3300046533 Bacteria 2943
176 Ga0495587_0065450 3300046536 Bacteria 2122
177 Ga0495645_0110281 3300046543 Bacteria 1948
178 Ga0495645_0111176 3300046543 Bacteria 1938
179 Ga0495645_0306401 3300046543 Bacteria 1036
180 Ga0495645_0685989 3300046543 Unclassified 623
181 Ga0495667_0087125 3300046559 Unclassified 2025
182 Ga0495667_0105631 3300046559 Bacteria 1820
183 Ga0495667_0215960 3300046559 Bacteria 1225
184 Ga0495634_0026952 3300046642 Bacteria 4005
185 Ga0495635_0485611 3300046663 Bacteria 814
186 Ga0495657_0150559 3300046675 Bacteria 1445
187 Ga0495599_0179241 3300046678 Bacteria 1306
188 Ga0495599_0222162 3300046678 Bacteria 1155
189 Ga0495623_0014816 3300046679 Bacteria 5042
190 Ga0495623_0054732 3300046679 Bacteria 2517
191 Ga0495623_0121359 3300046679 Bacteria 1573
192 Ga0495623_0315148 3300046679 Bacteria 860
193 Ga0495646_0322798 3300046680 Bacteria 813
194 Ga0495613_0100828 3300046689 Bacteria 2085
195 Ga0495624_0132897 3300046690 Bacteria 1526
196 Ga0495600_0023450 3300046809 Bacteria 3970
197 Ga0495600_0166429 3300046809 Bacteria 1424
198 Ga0495604_0050445 3300047317 Bacteria 3231
199 Ga0495604_0096804 3300047317 Bacteria 2177
200 Ga0495604_0110904 3300047317 Bacteria 2001
201 Ga0495604_0146175 3300047317 Bacteria 1684
202 Ga0495674_0115343 3300047319 Bacteria 2273
203 Ga0495674_0314743 3300047319 Bacteria 1276
204 Ga0495674_0462497 3300047319 Bacteria 1018
205 Ga0495674_0555175 3300047319 Bacteria 914
206 Ga0495674_0757994 3300047319 Bacteria 758
207 Ga0495680_0011036 3300047322 Bacteria 8026
208 Ga0495675_0043936 3300047444 Bacteria 2846
209 Ga0495675_0083302 3300047444 Bacteria 2013
210 Ga0495675_0468869 3300047444 Bacteria 726
211 Ga0495684_0167654 3300047471 Bacteria 1635
212 Ga0495684_0225991 3300047471 Bacteria 1370
213 Ga0495684_0234398 3300047471 Bacteria 1341
214 Ga0495684_0284619 3300047471 Bacteria 1192
215 Ga0495602_0137343 3300048088 Bacteria 1940
216 Ga0496105_0839864 3300048908 Bacteria 696
217 Ga0496112_0405881 3300048915 Bacteria 1302
218 Ga0496115_0113762 3300048918 Bacteria 2224
219 Ga0501082_0001062 3300060353 Bacteria 24342
220 Ga0111539_12227234
221 Ga0070676_10416432
222 Ga0070683_100155834
223 Ga0070690_100764761
224 Ga0068868_100243339
225 Ga0068868_100298938
226 Ga0070689_100820564
227 Ga0070675_100361594
228 Ga0070671_100736028
229 Ga0070673_100037452
230 Ga0070713_100246351
231 Ga0070711_100074316
232 Ga0070711_100351003
233 Ga0070705_100078338
234 Ga0070708_101198667
235 Ga0070678_100593959
236 Ga0070681_10002496
237 Ga0070699_100084914
238 Ga0070679_100077012
239 Ga0070684_100323079
240 Ga0070697_100376045
241 Ga0070672_101227537
242 Ga0070695_100110541
243 Ga0070695_100111155
244 Ga0070696_100001830
245 Ga0070665_101049170
246 Ga0070704_100918362
247 Ga0068857_101437496
248 Ga0068856_100950849
249 Ga0068856_101267352
250 Ga0068852_100818343
251 Ga0068864_100118978
252 Ga0068864_100488610
253 Ga0068863_100008903
254 Ga0068863_100279770
255 Ga0068863_101705764
256 Ga0068858_100460778
257 Ga0068858_101629280
258 Ga0068860_100295797
259 Ga0068860_100825866
260 Ga0068860_101520201
261 Ga0070717_10132866
262 Ga0070717_10454902
263 Ga0070715_10153088
264 Ga0070716_100775123
265 Ga0070716_100973758
266 Ga0070716_101121500
267 Ga0070712_100848288
268 Ga0097621_100042999
269 Ga0097621_100342878
270 Ga0097621_100393811
271 Ga0097621_101628090
272 Ga0068871_101472345
273 Ga0075430_100185873
274 Ga0075435_101038240
275 Ga0105240_10046926
276 Ga0105240_10209497
277 Ga0111539_11931359
278 Ga0105245_10146919
279 Ga0105241_10597879
280 Ga0105242_10489483
281 Ga0105248_10276656
282 Ga0105248_10297012
283 Ga0105248_10438747
284 Ga0105248_11492061
285 Ga0105237_10019807
286 Ga0105238_10429562
287 Ga0105249_10812142
288 Ga0105239_10156540
289 Ga0157370_10607228
290 Ga0157369_10446401
291 Ga0157374_10906874
292 Ga0157374_11703959
293 Ga0157378_10166500
294 Ga0157378_11671227
295 Ga0163162_10675554
296 Ga0163162_11073874
297 Ga0163162_11184519
298 Ga0157372_10077276
299 Ga0157372_10083702
300 Ga0157375_10231837
301 Ga0157375_11318927
302 Ga0163163_10119973
303 Ga0163163_10257970
304 Ga0163163_11500557
305 Ga0157376_10012833
306 Ga0157376_10068559
307 Ga0157376_10251719
308 Ga0207680_10331515
309 Ga0207645_10233974
310 Ga0207654_10452543
311 Ga0207707_10128996
312 Ga0207695_10095030
313 Ga0207695_10556221
314 Ga0207663_10608697
315 Ga0207652_10045486
316 Ga0207650_10682681
317 Ga0207650_11262576
318 Ga0207687_10539027
319 Ga0207686_10324541
320 Ga0207711_10524440
321 Ga0207711_11070732
322 Ga0207711_11311467
323 Ga0207661_10199896
324 Ga0207651_10019389
325 Ga0207677_10780373
326 Ga0207703_10826112
327 Ga0207641_10110754
328 Ga0207641_10264730
329 Ga0207676_10278089
330 Ga0207676_10935956
331 Ga0207676_11933136
332 Ga0207683_10082681
333 Ga0268266_10442271
334 Ga0268264_11216673
335 Ga0265316_10005546
336 Ga0265316_10059692
337 Ga0265316_10155092
338 Ga0265314_10170481
339 Ga0265342_10110911
340 Ga0265342_10357982
341 Ga0373934_0270371
342 Ga0373945_0252196
343 Ga0373953_0106240
344 Ga0373953_0288340
345 Ga0373954_0090435
346 Ga0373946_0412767
347 Ga0373935_0056681
348 Ga0373935_0128124
349 Ga0373927_0000360
350 Ga0373927_0331816
351 Ga0373927_0480467
352 Ga0373947_0007179
353 Ga0373947_0389724
354 Ga0373937_0495392
355 Ga0373937_1245865
356 Ga0373937_1537897
357 Ga0373925_0000378
358 Ga0373925_0102782
359 Ga0373925_0116304
360 Ga0373925_0657380
361 Ga0451577_0371062
362 Ga0453683_0069433
363 Ga0466963_0426987
364 Ga0453684_0214549
365 Ga0453684_1013392
366 Ga0451576_0071732
367 Ga0451576_0303458
368 Ga0451576_0439534
369 Ga0451576_0445496
370 Ga0451576_0905015
371 Ga0451576_0922919
372 Ga0495592_0017175
373 Ga0495651_0060627
374 Ga0495651_0154342
375 Ga0495653_0105439
376 Ga0495580_0015616
377 Ga0495580_0072213
378 Ga0495580_0111745
379 Ga0495580_0253982
380 Ga0495580_0410835
381 Ga0495582_0116088
382 Ga0495662_0045776
383 Ga0495664_0040849
384 Ga0495664_0248042
385 Ga0495594_0361069
386 Ga0495608_0066978
387 Ga0495618_0235681
388 Ga0495628_0087084
389 Ga0495628_0169768
390 Ga0495630_0253506
391 Ga0495630_0351723
392 Ga0495652_0039502
393 Ga0495652_0223459
394 Ga0495640_0048268
395 Ga0495587_0065450
396 Ga0495645_0110281
397 Ga0495645_0111176
398 Ga0495645_0306401
399 Ga0495645_0685989
400 Ga0495667_0087125
401 Ga0495667_0105631
402 Ga0495667_0215960
403 Ga0495634_0026952
404 Ga0495635_0485611
405 Ga0495657_0150559
406 Ga0495599_0179241
407 Ga0495599_0222162
408 Ga0495623_0014816
409 Ga0495623_0054732
410 Ga0495623_0121359
411 Ga0495623_0315148
412 Ga0495646_0322798
413 Ga0495613_0100828
414 Ga0495624_0132897
415 Ga0495600_0023450
416 Ga0495600_0166429
417 Ga0495604_0050445
418 Ga0495604_0096804
419 Ga0495604_0110904
420 Ga0495604_0146175
421 Ga0495674_0115343
422 Ga0495674_0314743
423 Ga0495674_0462497
424 Ga0495674_0555175
425 Ga0495674_0757994
426 Ga0495680_0011036
427 Ga0495675_0043936
428 Ga0495675_0083302
429 Ga0495675_0468869
430 Ga0495684_0167654
431 Ga0495684_0225991
432 Ga0495684_0234398
433 Ga0495684_0284619
434 Ga0495602_0137343
435 Ga0496105_0839864
436 Ga0496112_0405881
437 Ga0496115_0113762
438 Ga0501082_0001062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

17

164

0.9

Map