F330835

General Info

Members Datasets Scaffolds Average Seq Length
219 151 438 184

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100070982|Ga0070698_1000709823
Length 207
Sequence VDARAPHCPRHALTTLRLASVVVPEAELEQTEAGLVAASSGWFVMNARDARWFNRPGRGDSLPLTGFDEFEAETYFPMLGMSIQVIGPGEPNGTYHWETEQEDFLVLSGEGLLIVEGQERRLKQWDFVHCPPETRHVFVGVGEEPCVILAASSRQFQRDGPWGFYCVDETAARYNASPPEDTQDTELAYARFPPSQPVRYRDSLLPG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
76 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
77 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
78 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 8.22
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 14.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100070982 3300005471 Bacteria 3493
2 Ga0070660_100378372 3300005339 Bacteria 1169
3 Ga0070659_100020250 3300005366 Bacteria 5050
4 Ga0070659_100451918 3300005366 Unclassified 1090
5 Ga0070709_10105938 3300005434 Bacteria 1881
6 Ga0070709_10286186 3300005434 Bacteria 1199
7 Ga0070714_100441191 3300005435 Bacteria 1235
8 Ga0070713_100945986 3300005436 Unclassified 830
9 Ga0070710_10122680 3300005437 Bacteria 1574
10 Ga0070711_100008173 3300005439 Bacteria 6398
11 Ga0070705_100077205 3300005440 Unclassified 2033
12 Ga0070708_100419955 3300005445 Bacteria 1261
13 Ga0070708_100784283 3300005445 Bacteria 896
14 Ga0070678_100752886 3300005456 Bacteria 881
15 Ga0070681_10327523 3300005458 Bacteria 1441
16 Ga0070706_100159657 3300005467 Bacteria 2105
17 Ga0070698_100090940 3300005471 Bacteria 3035
18 Ga0070699_100031477 3300005518 Bacteria 4580
19 Ga0070699_100104933 3300005518 Bacteria 2479
20 Ga0070679_100141627 3300005530 Bacteria 2384
21 Ga0070697_100327781 3300005536 Bacteria 1319
22 Ga0070697_100580438 3300005536 Bacteria 984
23 Ga0068853_100021000 3300005539 Bacteria 5435
24 Ga0070672_100451501 3300005543 Bacteria 1107
25 Ga0070686_100799954 3300005544 Unclassified 760
26 Ga0070686_100922609 3300005544 Bacteria 712
27 Ga0070696_100204211 3300005546 Bacteria 1476
28 Ga0070693_100080310 3300005547 Bacteria 1943
29 Ga0070704_100006852 3300005549 Bacteria 6748
30 Ga0070664_100032410 3300005564 Bacteria 4370
31 Ga0068857_100025475 3300005577 Bacteria 5208
32 Ga0068854_100215688 3300005578 Bacteria 1516
33 Ga0070702_100236664 3300005615 Bacteria 1230
34 Ga0070702_100379689 3300005615 Bacteria 1004
35 Ga0068852_100044772 3300005616 Bacteria 3762
36 Ga0068866_10035670 3300005718 Bacteria 2431
37 Ga0068866_10403605 3300005718 Bacteria 882
38 Ga0068851_10156292 3300005834 Bacteria 1250
39 Ga0081455_10059226 3300005937 Bacteria 3235
40 Ga0081538_10012297 3300005981 Bacteria 6871
41 Ga0081539_10113438 3300005985 Bacteria 1359
42 Ga0075363_100181800 3300006048 Unclassified 1197
43 Ga0075364_10169821 3300006051 Bacteria 1474
44 Ga0075432_10114314 3300006058 Bacteria 1008
45 Ga0070715_10005066 3300006163 Bacteria 4371
46 Ga0070716_100206527 3300006173 Bacteria 1309
47 Ga0070712_100112346 3300006175 Bacteria 2035
48 Ga0068871_100430980 3300006358 Bacteria 1179
49 Ga0068871_100436199 3300006358 Bacteria 1172
50 Ga0075428_100339614 3300006844 Bacteria 1613
51 Ga0075428_100606848 3300006844 Bacteria 1169
52 Ga0075431_100444044 3300006847 Bacteria 1294
53 Ga0075433_10001360 3300006852 Bacteria 17933
54 Ga0075434_100016054 3300006871 Bacteria 7195
55 Ga0075434_100033548 3300006871 Bacteria 5067
56 Ga0075434_100041542 3300006871 Bacteria 4556
57 Ga0075436_100011849 3300006914 Bacteria 5982
58 Ga0075436_100013769 3300006914 Bacteria 5538
59 Ga0075436_100076274 3300006914 Bacteria 2321
60 Ga0075435_100001081 3300007076 Bacteria 17333
61 Ga0075435_100001916 3300007076 Bacteria 13546
62 Ga0075435_100111109 3300007076 Bacteria 2280
63 Ga0111539_10270523 3300009094 Bacteria 1978
64 Ga0105245_10397659 3300009098 Unclassified 1376
65 Ga0105245_10736342 3300009098 Bacteria 1021
66 Ga0114129_10015549 3300009147 Bacteria 10819
67 Ga0114129_10089292 3300009147 Unclassified 4272
68 Ga0114129_10141213 3300009147 Bacteria 3301
69 Ga0114129_11244045 3300009147 Bacteria 925
70 Ga0114129_11776882 3300009147 Bacteria 750
71 Ga0105243_10303224 3300009148 Bacteria 1449
72 Ga0105243_10560088 3300009148 Bacteria 1094
73 Ga0105241_10489948 3300009174 Bacteria 1094
74 Ga0105239_11013283 3300010375 Bacteria 955
75 Ga0157378_10488903 3300013297 Bacteria 1227
76 Ga0157372_10390648 3300013307 Bacteria 1621
77 Ga0157375_11069322 3300013308 Bacteria 944
78 Ga0163163_11079348 3300014325 Unclassified 866
79 Ga0207692_10069937 3300025898 Bacteria 1846
80 Ga0207705_10353615 3300025909 Bacteria 1132
81 Ga0207693_10046469 3300025915 Unclassified 3410
82 Ga0207693_10058082 3300025915 Bacteria 3031
83 Ga0207663_10014174 3300025916 Bacteria 4357
84 Ga0207657_10028290 3300025919 Bacteria 5116
85 Ga0207652_10219570 3300025921 Unclassified 1713
86 Ga0207700_10632219 3300025928 Bacteria 954
87 Ga0207700_11070697 3300025928 Bacteria 721
88 Ga0207664_10121409 3300025929 Bacteria 2187
89 Ga0207690_10022886 3300025932 Bacteria 3892
90 Ga0207665_10102450 3300025939 Bacteria 2000
91 Ga0207679_10464713 3300025945 Unclassified 1124
92 Ga0207712_10380042 3300025961 Bacteria 1182
93 Ga0207668_10378443 3300025972 Bacteria 1191
94 Ga0207648_10196436 3300026089 Bacteria 1789
95 Ga0207683_10309210 3300026121 Bacteria 1446
96 Ga0207698_10185492 3300026142 Unclassified 1847
97 Ga0207428_10396242 3300027907 Unclassified 1011
98 Ga0207428_10400795 3300027907 Bacteria 1004
99 Ga0307410_10014122 3300031852 Bacteria 4686
100 Ga0307409_100101169 3300031995 Bacteria 2391
101 Ga0373930_0007911 3300034816 Bacteria 1845
102 Ga0373948_0006480 3300034817 Bacteria 1937
103 Ga0373950_0006727 3300034818 Bacteria 1764
104 Ga0373928_0009091 3300035084 Bacteria 1939
105 Ga0373940_0043589 3300035088 Bacteria 1240
106 Ga0373949_0183078 3300035090 Bacteria 621
107 Ga0373932_0003076 3300035112 Bacteria 4070
108 Ga0373941_0081158 3300035115 Bacteria 1095
109 Ga0373942_0013738 3300035207 Bacteria 1951
110 Ga0373962_0010403 3300035242 Bacteria 2319
111 Ga0373931_0019400 3300035691 Unclassified 3393
112 Ga0373937_0829745 3300036401 Bacteria 873
113 Ga0373937_1132474 3300036401 Unclassified 731
114 Ga0395899_0007526 3300037312 Bacteria 8416
115 Ga0395900_0005387 3300037418 Bacteria 13404
116 Ga0395900_0347589 3300037418 Bacteria 1457
117 Ga0395900_0404885 3300037418 Bacteria 1328
118 Ga0395900_0464197 3300037418 Bacteria 1220
119 Ga0395900_0637281 3300037418 Bacteria 1003
120 Ga0395898_0012536 3300037466 Bacteria 8767
121 Ga0395898_0015001 3300037466 Bacteria 7954
122 Ga0395898_0294994 3300037466 Bacteria 1547
123 Ga0395898_0518281 3300037466 Bacteria 1133
124 Ga0395905_0001912 3300037471 Bacteria 23920
125 Ga0395905_0021773 3300037471 Bacteria 6063
126 Ga0395905_0172323 3300037471 Bacteria 2033
127 Ga0395905_0526720 3300037471 Bacteria 1082
128 Ga0395905_0625840 3300037471 Unclassified 978
129 Ga0395905_0785004 3300037471 Bacteria 855
130 Ga0395901_0001057 3300038443 Bacteria 29607
131 Ga0395901_0005580 3300038443 Bacteria 12735
132 Ga0395901_0394969 3300038443 Bacteria 1421
133 Ga0395901_0676551 3300038443 Bacteria 1032
134 Ga0395901_1140449 3300038443 Unclassified 748
135 Ga0439461_0025837 3300041410 Unclassified 1195
136 Ga0451853_2470588 3300041512 Unclassified 626
137 Ga0439445_0093137 3300042004 Unclassified 850
138 Ga0439446_0131946 3300042156 Unclassified 811
139 Ga0466963_0021994 3300044694 Bacteria 4032
140 Ga0466964_0389659 3300044706 Unclassified 725
141 Ga0466957_0174827 3300044842 Bacteria 1400
142 Ga0466960_0177852 3300044901 Unclassified 1152
143 Ga0466958_0002124 3300045836 Bacteria 9850
144 Ga0466967_0006913 3300045976 Bacteria 8108
145 Ga0466967_0064280 3300045976 Bacteria 3263
146 Ga0466967_0075879 3300045976 Unclassified 3022
147 Ga0466967_0080201 3300045976 Bacteria 2944
148 Ga0466967_0154937 3300045976 Bacteria 2145
149 Ga0466967_0190433 3300045976 Bacteria 1938
150 Ga0466967_0358626 3300045976 Bacteria 1412
151 Ga0466967_0451286 3300045976 Bacteria 1257
152 Ga0466967_0687703 3300045976 Bacteria 1013
153 Ga0495651_0122091 3300046462 Bacteria 1912
154 Ga0495653_0157402 3300046463 Bacteria 1581
155 Ga0495639_0183309 3300046475 Bacteria 1020
156 Ga0495662_0093238 3300046476 Bacteria 1470
157 Ga0495664_0465785 3300046477 Bacteria 756
158 Ga0495630_0284377 3300046517 Bacteria 1264
159 Ga0495652_0124168 3300046529 Bacteria 2054
160 Ga0495640_0017237 3300046533 Bacteria 5386
161 Ga0495587_0364558 3300046536 Bacteria 804
162 Ga0495667_0002980 3300046559 Bacteria 11357
163 Ga0495634_0172135 3300046642 Bacteria 1360
164 Ga0495599_0478184 3300046678 Bacteria 735
165 Ga0495646_0180380 3300046680 Bacteria 1159
166 Ga0495624_0234645 3300046690 Bacteria 1111
167 Ga0495600_0262797 3300046809 Bacteria 1096
168 Ga0495680_0008672 3300047322 Bacteria 9226
169 Ga0495684_0080185 3300047471 Bacteria 2478
170 Ga0496101_0040146 3300048904 Bacteria 3333
171 Ga0496102_0001216 3300048905 Bacteria 23348
172 Ga0496102_0671185 3300048905 Bacteria 959
173 Ga0496103_0021736 3300048906 Unclassified 3861
174 Ga0496103_0176782 3300048906 Bacteria 1371
175 Ga0496106_0140227 3300048909 Bacteria 1901
176 Ga0496107_0383853 3300048910 Bacteria 1045
177 Ga0496108_0481197 3300048911 Bacteria 1084
178 Ga0496109_0182478 3300048912 Unclassified 1971
179 Ga0496110_0042593 3300048913 Bacteria 3963
180 Ga0496111_0017470 3300048914 Bacteria 4961
181 Ga0496111_0042849 3300048914 Unclassified 3251
182 Ga0496111_0141646 3300048914 Bacteria 1781
183 Ga0496112_0337789 3300048915 Bacteria 1450
184 Ga0496112_0831284 3300048915 Bacteria 847
185 Ga0496112_1050031 3300048915 Bacteria 734
186 Ga0496112_1063537 3300048915 Unclassified 728
187 Ga0496114_0070395 3300048917 Bacteria 2938
188 Ga0501036_0380457 3300049572 Bacteria 1178
189 Ga0501038_0207872 3300049574 Bacteria 1568
190 Ga0501039_0425647 3300049575 Bacteria 1043
191 Ga0501041_0203925 3300049577 Bacteria 1240
192 Ga0501042_0089166 3300049578 Bacteria 2213
193 Ga0501048_0048158 3300049582 Bacteria 3041
194 Ga0501048_1024117 3300049582 Bacteria 594
195 Ga0501067_0098559 3300049583 Bacteria 1623
196 Ga0501071_0132839 3300049587 Bacteria 1850
197 Ga0501072_0310561 3300049588 Bacteria 1253
198 Ga0501075_0015529 3300049591 Bacteria 5465
199 Ga0501081_0285249 3300049743 Bacteria 1209
200 nmdc:mga05p37_12727_c1 3300050507 Bacteria 10058
201 nmdc:mga05p37_136526_c1 3300050507 Bacteria 3007
202 nmdc:mga05p37_153424_c1 3300050507 Bacteria 1430
203 nmdc:mga05p37_82168_c1 3300050507 Unclassified 3969
204 nmdc:mga0qj67_990257_c1 3300050509 Unclassified 660
205 nmdc:mga06r32_25913_c1 3300050510 Bacteria 5460
206 nmdc:mga0rr50_108110_c1 3300050513 Bacteria 2197
207 nmdc:mga0rr50_678215_c1 3300050513 Bacteria 879
208 nmdc:mga0rr50_940_c1 3300050513 Bacteria 15761
209 nmdc:mga08x19_34593_c1 3300050514 Bacteria 3195
210 nmdc:mga08x19_38756_c1 3300050514 Bacteria 3028
211 nmdc:mga08x19_61271_c1 3300050514 Unclassified 2438
212 nmdc:mga0a205_17708_c1 3300050515 Bacteria 6685
213 nmdc:mga0a205_88869_c1 3300050515 Bacteria 2987
214 nmdc:mga0a205_95814_c1 3300050515 Bacteria 2867
215 Ga0495601_0081519 3300053077 Bacteria 2077
216 Ga0495655_0099811 3300053083 Bacteria 858
217 Ga0495595_0067748 3300053084 Bacteria 1683
218 Ga0495619_0152337 3300053085 Bacteria 1595
219 Ga0501084_0188603 3300054114 Bacteria 1740
220 Ga0070698_100070982
221 Ga0070660_100378372
222 Ga0070659_100020250
223 Ga0070659_100451918
224 Ga0070709_10105938
225 Ga0070709_10286186
226 Ga0070714_100441191
227 Ga0070713_100945986
228 Ga0070710_10122680
229 Ga0070711_100008173
230 Ga0070705_100077205
231 Ga0070708_100419955
232 Ga0070708_100784283
233 Ga0070678_100752886
234 Ga0070681_10327523
235 Ga0070706_100159657
236 Ga0070698_100090940
237 Ga0070699_100031477
238 Ga0070699_100104933
239 Ga0070679_100141627
240 Ga0070697_100327781
241 Ga0070697_100580438
242 Ga0068853_100021000
243 Ga0070672_100451501
244 Ga0070686_100799954
245 Ga0070686_100922609
246 Ga0070696_100204211
247 Ga0070693_100080310
248 Ga0070704_100006852
249 Ga0070664_100032410
250 Ga0068857_100025475
251 Ga0068854_100215688
252 Ga0070702_100236664
253 Ga0070702_100379689
254 Ga0068852_100044772
255 Ga0068866_10035670
256 Ga0068866_10403605
257 Ga0068851_10156292
258 Ga0081455_10059226
259 Ga0081538_10012297
260 Ga0081539_10113438
261 Ga0075363_100181800
262 Ga0075364_10169821
263 Ga0075432_10114314
264 Ga0070715_10005066
265 Ga0070716_100206527
266 Ga0070712_100112346
267 Ga0068871_100430980
268 Ga0068871_100436199
269 Ga0075428_100339614
270 Ga0075428_100606848
271 Ga0075431_100444044
272 Ga0075433_10001360
273 Ga0075434_100016054
274 Ga0075434_100033548
275 Ga0075434_100041542
276 Ga0075436_100011849
277 Ga0075436_100013769
278 Ga0075436_100076274
279 Ga0075435_100001081
280 Ga0075435_100001916
281 Ga0075435_100111109
282 Ga0111539_10270523
283 Ga0105245_10397659
284 Ga0105245_10736342
285 Ga0114129_10015549
286 Ga0114129_10089292
287 Ga0114129_10141213
288 Ga0114129_11244045
289 Ga0114129_11776882
290 Ga0105243_10303224
291 Ga0105243_10560088
292 Ga0105241_10489948
293 Ga0105239_11013283
294 Ga0157378_10488903
295 Ga0157372_10390648
296 Ga0157375_11069322
297 Ga0163163_11079348
298 Ga0207692_10069937
299 Ga0207705_10353615
300 Ga0207693_10046469
301 Ga0207693_10058082
302 Ga0207663_10014174
303 Ga0207657_10028290
304 Ga0207652_10219570
305 Ga0207700_10632219
306 Ga0207700_11070697
307 Ga0207664_10121409
308 Ga0207690_10022886
309 Ga0207665_10102450
310 Ga0207679_10464713
311 Ga0207712_10380042
312 Ga0207668_10378443
313 Ga0207648_10196436
314 Ga0207683_10309210
315 Ga0207698_10185492
316 Ga0207428_10396242
317 Ga0207428_10400795
318 Ga0307410_10014122
319 Ga0307409_100101169
320 Ga0373930_0007911
321 Ga0373948_0006480
322 Ga0373950_0006727
323 Ga0373928_0009091
324 Ga0373940_0043589
325 Ga0373949_0183078
326 Ga0373932_0003076
327 Ga0373941_0081158
328 Ga0373942_0013738
329 Ga0373962_0010403
330 Ga0373931_0019400
331 Ga0373937_0829745
332 Ga0373937_1132474
333 Ga0395899_0007526
334 Ga0395900_0005387
335 Ga0395900_0347589
336 Ga0395900_0404885
337 Ga0395900_0464197
338 Ga0395900_0637281
339 Ga0395898_0012536
340 Ga0395898_0015001
341 Ga0395898_0294994
342 Ga0395898_0518281
343 Ga0395905_0001912
344 Ga0395905_0021773
345 Ga0395905_0172323
346 Ga0395905_0526720
347 Ga0395905_0625840
348 Ga0395905_0785004
349 Ga0395901_0001057
350 Ga0395901_0005580
351 Ga0395901_0394969
352 Ga0395901_0676551
353 Ga0395901_1140449
354 Ga0439461_0025837
355 Ga0451853_2470588
356 Ga0439445_0093137
357 Ga0439446_0131946
358 Ga0466963_0021994
359 Ga0466964_0389659
360 Ga0466957_0174827
361 Ga0466960_0177852
362 Ga0466958_0002124
363 Ga0466967_0006913
364 Ga0466967_0064280
365 Ga0466967_0075879
366 Ga0466967_0080201
367 Ga0466967_0154937
368 Ga0466967_0190433
369 Ga0466967_0358626
370 Ga0466967_0451286
371 Ga0466967_0687703
372 Ga0495651_0122091
373 Ga0495653_0157402
374 Ga0495639_0183309
375 Ga0495662_0093238
376 Ga0495664_0465785
377 Ga0495630_0284377
378 Ga0495652_0124168
379 Ga0495640_0017237
380 Ga0495587_0364558
381 Ga0495667_0002980
382 Ga0495634_0172135
383 Ga0495599_0478184
384 Ga0495646_0180380
385 Ga0495624_0234645
386 Ga0495600_0262797
387 Ga0495680_0008672
388 Ga0495684_0080185
389 Ga0496101_0040146
390 Ga0496102_0001216
391 Ga0496102_0671185
392 Ga0496103_0021736
393 Ga0496103_0176782
394 Ga0496106_0140227
395 Ga0496107_0383853
396 Ga0496108_0481197
397 Ga0496109_0182478
398 Ga0496110_0042593
399 Ga0496111_0017470
400 Ga0496111_0042849
401 Ga0496111_0141646
402 Ga0496112_0337789
403 Ga0496112_0831284
404 Ga0496112_1050031
405 Ga0496112_1063537
406 Ga0496114_0070395
407 Ga0501036_0380457
408 Ga0501038_0207872
409 Ga0501039_0425647
410 Ga0501041_0203925
411 Ga0501042_0089166
412 Ga0501048_0048158
413 Ga0501048_1024117
414 Ga0501067_0098559
415 Ga0501071_0132839
416 Ga0501072_0310561
417 Ga0501075_0015529
418 Ga0501081_0285249
419 nmdc:mga05p37_12727_c1
420 nmdc:mga05p37_136526_c1
421 nmdc:mga05p37_153424_c1
422 nmdc:mga05p37_82168_c1
423 nmdc:mga0qj67_990257_c1
424 nmdc:mga06r32_25913_c1
425 nmdc:mga0rr50_108110_c1
426 nmdc:mga0rr50_678215_c1
427 nmdc:mga0rr50_940_c1
428 nmdc:mga08x19_34593_c1
429 nmdc:mga08x19_38756_c1
430 nmdc:mga08x19_61271_c1
431 nmdc:mga0a205_17708_c1
432 nmdc:mga0a205_88869_c1
433 nmdc:mga0a205_95814_c1
434 Ga0495601_0081519
435 Ga0495655_0099811
436 Ga0495595_0067748
437 Ga0495619_0152337
438 Ga0501084_0188603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

82

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.934 41 123
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9162 39 115
3nl1-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate 0.9137 39 115
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9131 37 118
3nw4-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate 0.9016 36 115
ID Description Score Start End Superfamily
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9166 43 123 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9143 37 118 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8995 39 120 2.60.120.10
2vqaC01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8922 40 115 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8907 37 116 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537WP71-F1-model_v4 Cupin domain-containing protein 0.9825 2 170
AF-A0A7W0YU46-F1-model_v4 Cupin domain-containing protein 0.9825 8 170
AF-A0A538GVP9-F1-model_v4 Cupin domain-containing protein 0.9822 2 170
AF-A0A538ISC0-F1-model_v4 Cupin domain-containing protein 0.9819 2 170
AF-A0A538EJL5-F1-model_v4 Cupin domain-containing protein 0.9805 1 170

Map