F330793

General Info

Members Datasets Scaffolds Average Seq Length
219 146 219 173

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100908166|Ga0070694_1009081661
Length 189
Sequence MRAETDKAKLEAFMAALGKRVRGDGRIYLTGGATALLHGWRRMTIDIDLKPDPEPAGLFEAIAQLKEELDINVELASPDDFIPAVPGWRERSVFIARHGRLDFYHYDPYGQALSKLQRRHDRDLRDVRSMVRDGLIRADTLREMFGTIEAGLIRYPAIDPASFRASVEEFCRSVSQRSTNDPQPPHDSQ

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
126 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
129 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
130 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
136 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000099 3300000531 Bacteria 2674
2 CNAas_1000074 3300000532 Bacteria 7468
3 JGI24749J21850_1009515 3300002076 Bacteria 1357
4 JGI24751J29686_10000071 3300002459 Bacteria 58417
5 Ga0065714_10265641 3300005288 Bacteria 748
6 Ga0065712_10017720 3300005290 Bacteria 2240
7 Ga0065712_10113867 3300005290 Unclassified 1775
8 Ga0065715_10216614 3300005293 Bacteria 1290
9 Ga0065715_10460923 3300005293 Bacteria 816
10 Ga0070658_10285939 3300005327 Archaea 1404
11 Ga0070676_10070573 3300005328 Unclassified 2096
12 Ga0070670_100000070 3300005331 Bacteria 103166
13 Ga0070670_100019920 3300005331 Bacteria 5759
14 Ga0070670_100069176 3300005331 Bacteria 3031
15 Ga0070670_101432522 3300005331 Unclassified 634
16 Ga0070677_10092283 3300005333 Bacteria 1319
17 Ga0068869_100031116 3300005334 Bacteria 3753
18 Ga0068869_100869528 3300005334 Unclassified 779
19 Ga0070680_100001227 3300005336 Bacteria 18465
20 Ga0070680_100054670 3300005336 Bacteria 3260
21 Ga0070680_100455964 3300005336 Unclassified 1092
22 Ga0068868_100798302 3300005338 Unclassified 851
23 Ga0070689_100030569 3300005340 Bacteria 4089
24 Ga0070689_101316506 3300005340 Bacteria 651
25 Ga0070661_100815657 3300005344 Unclassified 766
26 Ga0070673_100104872 3300005364 Bacteria 2335
27 Ga0070694_100176131 3300005444 Unclassified 1579
28 Ga0070694_100908166 3300005444 Unclassified 727
29 Ga0070708_100183134 3300005445 Bacteria 1958
30 Ga0070662_100407152 3300005457 Bacteria 1123
31 Ga0070681_10000097 3300005458 Bacteria 65121
32 Ga0068867_100122779 3300005459 Bacteria 2009
33 Ga0070707_100023282 3300005468 Bacteria 5860
34 Ga0070698_100587818 3300005471 Bacteria 1053
35 Ga0070699_100007696 3300005518 Bacteria 9365
36 Ga0070699_100026382 3300005518 Bacteria 5011
37 Ga0070679_100000197 3300005530 Bacteria 49336
38 Ga0068853_101011402 3300005539 Unclassified 800
39 Ga0070686_100076850 3300005544 Unclassified 2200
40 Ga0070696_100632535 3300005546 Unclassified 866
41 Ga0070693_100120164 3300005547 Bacteria 1628
42 Ga0070704_100070952 3300005549 Unclassified 2529
43 Ga0070704_100465086 3300005549 Unclassified 1092
44 Ga0068857_100001181 3300005577 Bacteria 20397
45 Ga0070702_100097688 3300005615 Unclassified 1795
46 Ga0068852_101237234 3300005616 Unclassified 768
47 Ga0068859_100022741 3300005617 Bacteria 6286
48 Ga0068859_100049100 3300005617 Bacteria 4238
49 Ga0068859_100371458 3300005617 Bacteria 1526
50 Ga0068864_100015136 3300005618 Bacteria 6414
51 Ga0068864_100303169 3300005618 Unclassified 1496
52 Ga0068861_100327386 3300005719 Bacteria 1336
53 Ga0068861_101089990 3300005719 Unclassified 767
54 Ga0068870_10334274 3300005840 Unclassified 967
55 Ga0068858_100079007 3300005842 Bacteria 3057
56 Ga0068860_100025934 3300005843 Bacteria 5656
57 Ga0068860_100077958 3300005843 Bacteria 3152
58 Ga0068862_100157900 3300005844 Bacteria 2023
59 Ga0068862_101042217 3300005844 Unclassified 811
60 Ga0068862_101636240 3300005844 Bacteria 651
61 Ga0081539_10003279 3300005985 Bacteria 20298
62 Ga0070715_10000002 3300006163 Bacteria 389554
63 Ga0070716_100592911 3300006173 Bacteria 832
64 Ga0075428_100019391 3300006844 Bacteria 7528
65 Ga0075428_100595271 3300006844 Bacteria 1181
66 Ga0075428_100746195 3300006844 Bacteria 1042
67 Ga0075430_100065024 3300006846 Bacteria 3065
68 Ga0075430_100295457 3300006846 Bacteria 1340
69 Ga0075431_100132221 3300006847 Bacteria 2573
70 Ga0075433_10198266 3300006852 Bacteria 1785
71 Ga0075433_10780759 3300006852 Unclassified 835
72 Ga0075434_100071066 3300006871 Bacteria 3471
73 Ga0075434_101109068 3300006871 Bacteria 804
74 Ga0075429_100035503 3300006880 Bacteria 4336
75 Ga0075429_100556923 3300006880 Unclassified 1005
76 Ga0068865_100522015 3300006881 Unclassified 993
77 Ga0075436_100055708 3300006914 Bacteria 2731
78 Ga0075436_100385632 3300006914 Unclassified 1014
79 Ga0097620_100022741 3300006931 Bacteria 6286
80 Ga0097620_100049105 3300006931 Bacteria 4238
81 Ga0097620_100371449 3300006931 Bacteria 1526
82 Ga0075435_100768844 3300007076 Bacteria 838
83 Ga0075435_101018593 3300007076 Unclassified 723
84 Ga0105240_10480694 3300009093 Bacteria 1385
85 Ga0111539_10059474 3300009094 Bacteria 4531
86 Ga0111539_10074737 3300009094 Bacteria 3993
87 Ga0111539_10082558 3300009094 Bacteria 3780
88 Ga0114129_10061485 3300009147 Bacteria 5248
89 Ga0114129_10177723 3300009147 Bacteria 2898
90 Ga0114129_10523621 3300009147 Bacteria 1545
91 Ga0114129_10549277 3300009147 Unclassified 1502
92 Ga0114129_11039181 3300009147 Bacteria 1029
93 Ga0114129_11845267 3300009147 Unclassified 734
94 Ga0105243_11070219 3300009148 Bacteria 813
95 Ga0105241_10352864 3300009174 Bacteria 1278
96 Ga0105248_10032824 3300009177 Bacteria 5800
97 Ga0105248_10062508 3300009177 Bacteria 4180
98 Ga0105248_10089842 3300009177 Bacteria 3458
99 Ga0105248_10121312 3300009177 Bacteria 2949
100 Ga0105238_10045381 3300009551 Unclassified 4439
101 Ga0157369_10756941 3300013105 Bacteria 999
102 Ga0157378_10206869 3300013297 Unclassified 1859
103 Ga0157375_10167909 3300013308 Bacteria 2340
104 Ga0157375_10669174 3300013308 Unclassified 1193
105 Ga0157375_11499798 3300013308 Unclassified 796
106 Ga0163163_10000072 3300014325 Bacteria 112281
107 Ga0163163_10000223 3300014325 Bacteria 58398
108 Ga0163163_10399141 3300014325 Bacteria 1433
109 Ga0157380_10191710 3300014326 Bacteria 1805
110 Ga0157380_10350646 3300014326 Bacteria 1381
111 Ga0213876_10021313 3300021384 Bacteria 3428
112 Ga0207647_10002354 3300025904 Bacteria 14365
113 Ga0207685_10000002 3300025905 Bacteria 438088
114 Ga0207645_10033595 3300025907 Bacteria 3296
115 Ga0207643_10310004 3300025908 Bacteria 984
116 Ga0207705_10208348 3300025909 Unclassified 1483
117 Ga0207707_10000013 3300025912 Bacteria 264517
118 Ga0207660_10000926 3300025917 Bacteria 19371
119 Ga0207660_10079928 3300025917 Bacteria 2399
120 Ga0207660_10145433 3300025917 Bacteria 1816
121 Ga0207652_10000071 3300025921 Bacteria 109636
122 Ga0207646_10223397 3300025922 Unclassified 1701
123 Ga0207646_10235850 3300025922 Bacteria 1653
124 Ga0207694_10034216 3300025924 Unclassified 3896
125 Ga0207650_10000017 3300025925 Bacteria 354674
126 Ga0207650_10229398 3300025925 Unclassified 1497
127 Ga0207650_11140315 3300025925 Unclassified 664
128 Ga0207706_10052924 3300025933 Unclassified 3584
129 Ga0207704_10403019 3300025938 Unclassified 1080
130 Ga0207711_10016288 3300025941 Bacteria 6175
131 Ga0207711_10530815 3300025941 Unclassified 1097
132 Ga0207711_10770885 3300025941 Unclassified 896
133 Ga0207711_11063786 3300025941 Bacteria 749
134 Ga0207689_10050739 3300025942 Bacteria 3420
135 Ga0207651_10365016 3300025960 Bacteria 1220
136 Ga0207651_11165789 3300025960 Unclassified 691
137 Ga0207640_11142300 3300025981 Unclassified 691
138 Ga0207703_10193018 3300026035 Bacteria 1805
139 Ga0207648_10031731 3300026089 Bacteria 4669
140 Ga0207648_10535164 3300026089 Bacteria 1075
141 Ga0207676_10092225 3300026095 Bacteria 2490
142 Ga0207676_10302351 3300026095 Unclassified 1461
143 Ga0207674_10005940 3300026116 Bacteria 14439
144 Ga0207674_10232554 3300026116 Unclassified 1791
145 Ga0207675_100106318 3300026118 Unclassified 2646
146 Ga0207675_101087373 3300026118 Unclassified 819
147 Ga0207683_10072785 3300026121 Unclassified 3040
148 Ga0207698_11249924 3300026142 Unclassified 757
149 Ga0268265_10052038 3300028380 Bacteria 3095
150 Ga0268265_10115224 3300028380 Unclassified 2203
151 Ga0268265_11609893 3300028380 Bacteria 654
152 Ga0268264_10035737 3300028381 Bacteria 4090
153 Ga0265337_1019758 3300028556 Bacteria 2119
154 Ga0307408_100146728 3300031548 Bacteria 1858
155 Ga0307408_100300560 3300031548 Unclassified 1344
156 Ga0307413_10045683 3300031824 Bacteria 2599
157 Ga0307409_100224539 3300031995 Unclassified 1698
158 Ga0307409_100236510 3300031995 Unclassified 1660
159 Ga0307416_100206168 3300032002 Bacteria 1870
160 Ga0307411_10090057 3300032005 Bacteria 2139
161 Ga0307411_10478243 3300032005 Bacteria 1048
162 Ga0307415_100080888 3300032126 Unclassified 2319
163 Ga0373941_0353334 3300035115 Unclassified 598
164 Ga0395899_0136987 3300037312 Unclassified 1745
165 Ga0395900_0197404 3300037418 Bacteria 2038
166 Ga0395898_0208095 3300037466 Unclassified 1867
167 Ga0395905_0289339 3300037471 Bacteria 1525
168 Ga0436365_0978066 3300039437 Bacteria 5986
169 Ga0436363_1350349 3300039450 Bacteria 2113
170 Ga0451800_0377706 3300041459 Bacteria 567
171 Ga0439458_0007002 3300042157 Bacteria 2513
172 Ga0439435_0127831 3300042436 Bacteria 801
173 Ga0451576_0254692 3300045051 Bacteria 1835
174 Ga0495592_0269794 3300046454 Bacteria 1117
175 Ga0495674_0776834 3300047319 Unclassified 747
176 Ga0496106_0858073 3300048909 Unclassified 718
177 Ga0496112_0112728 3300048915 Bacteria 2690
178 Ga0496112_1308933 3300048915 Bacteria 640
179 Ga0501292_016386 3300049515 Unclassified 1165
180 Ga0501299_048525 3300049522 Unclassified 871
181 Ga0501038_0000426 3300049574 Bacteria 36732
182 Ga0501043_0001330 3300049579 Bacteria 21624
183 Ga0501046_0000007 3300049580 Bacteria 356002
184 Ga0501047_0110222 3300049581 Bacteria 2635
185 Ga0501070_0132762 3300049586 Bacteria 2056
186 Ga0501070_0987183 3300049586 Bacteria 653
187 Ga0501073_0206312 3300049589 Bacteria 1358
188 Ga0501076_0376209 3300049592 Bacteria 1167
189 Ga0501202_013766 3300049652 Bacteria 1542
190 Ga0501217_033730 3300049661 Bacteria 1273
191 Ga0501227_022698 3300049665 Unclassified 1454
192 Ga0501233_009325 3300049668 Unclassified 1912
193 Ga0501243_040248 3300049675 Unclassified 820
194 Ga0501219_012414 3300049703 Unclassified 660
195 Ga0501225_0045974 3300049705 Unclassified 1209
196 Ga0501234_008952 3300049707 Unclassified 1561
197 Ga0501080_0327208 3300049742 Bacteria 1387
198 Ga0501080_0804571 3300049742 Unclassified 824
199 Ga0501083_0000046 3300049744 Bacteria 88934
200 Ga0501272_003587 3300049769 Unclassified 1584
201 Ga0501283_005529 3300049779 Unclassified 1741
202 Ga0501035_0451426 3300049822 Unclassified 1063
203 Ga0501044_0372538 3300049823 Bacteria 1344
204 Ga0501045_0128111 3300049824 Unclassified 1886
205 nmdc:mga05p37_162255_c1 3300050507 Bacteria 2729
206 nmdc:mga05p37_273191_c1 3300050507 Unclassified 2019
207 nmdc:mga05p37_365263_c1 3300050507 Bacteria 1696
208 nmdc:mga05p37_456107_c1 3300050507 Unclassified 1478
209 nmdc:mga05p37_976144_c1 3300050507 Bacteria 903
210 nmdc:mga09592_459849_c1 3300050508 Unclassified 1097
211 nmdc:mga09592_5709_c1 3300050508 Bacteria 7469
212 nmdc:mga0qj67_1039379_c1 3300050509 Unclassified 641
213 nmdc:mga0qj67_106813_c1 3300050509 Bacteria 2258
214 nmdc:mga08y16_1168600_c1 3300050511 Unclassified 742
215 nmdc:mga08y16_150444_c1 3300050511 Bacteria 2420
216 nmdc:mga0n895_771573_c1 3300050512 Unclassified 953
217 nmdc:mga0n895_814254_c1 3300050512 Bacteria 924
218 nmdc:mga0rr50_880305_c1 3300050513 Unclassified 764
219 nmdc:mga08x19_60154_c1 3300050514 Unclassified 2460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0804571 Ga0501080_0804571_14_436 140
2 3300025941 Ga0207711_10770885 Ga0207711_107708852 151
3 3300039450 Ga0436363_1350349 Ga0436363_1350349_417_884 151
4 3300046454 Ga0495592_0269794 Ga0495592_0269794_246_794 151
5 3300005615 Ga0070702_100097688 Ga0070702_1000976882 159
6 3300025981 Ga0207640_11142300 Ga0207640_111423002 159
7 3300005331 Ga0070670_100019920 Ga0070670_1000199205 161
8 3300005547 Ga0070693_100120164 Ga0070693_1001201643 161
9 3300005617 Ga0068859_100049100 Ga0068859_1000491005 161
10 3300006931 Ga0097620_100049105 Ga0097620_1000491052 161
11 3300025917 Ga0207660_10145433 Ga0207660_101454331 161
12 3300025925 Ga0207650_10229398 Ga0207650_102293984 161
13 3300031548 Ga0307408_100300560 Ga0307408_1003005602 161
14 3300050509 nmdc:mga0qj67_1039379_c1 nmdc:mga0qj67_1039379_c1_16_501 161
15 3300002459 JGI24751J29686_10000071 JGI24751J29686_1000007141 162
16 3300005459 Ga0068867_100122779 Ga0068867_1001227793 162
17 3300028556 Ga0265337_1019758 Ga0265337_10197584 162
18 3300048909 Ga0496106_0858073 Ga0496106_0858073_124_648 162
19 3300049586 Ga0501070_0132762 Ga0501070_0132762_135_623 162
20 3300049586 Ga0501070_0987183 Ga0501070_0987183_31_519 162
21 3300050512 nmdc:mga0n895_771573_c1 nmdc:mga0n895_771573_c1_284_772 162
22 3300005577 Ga0068857_100001181 Ga0068857_1000011816 163
23 3300006844 Ga0075428_100595271 Ga0075428_1005952713 163
24 3300006871 Ga0075434_101109068 Ga0075434_1011090682 163
25 3300007076 Ga0075435_100768844 Ga0075435_1007688442 163
26 3300026116 Ga0207674_10005940 Ga0207674_100059407 163
27 3300041459 Ga0451800_0377706 Ga0451800_0377706_42_533 163
28 3300050508 nmdc:mga09592_459849_c1 nmdc:mga09592_459849_c1_125_616 163
29 3300005340 Ga0070689_100030569 Ga0070689_1000305692 164
30 3300005544 Ga0070686_100076850 Ga0070686_1000768501 164
31 3300006871 Ga0075434_100071066 Ga0075434_1000710662 164
32 3300009177 Ga0105248_10062508 Ga0105248_100625083 164
33 3300042157 Ga0439458_0007002 Ga0439458_0007002_1773_2312 164
34 3300050512 nmdc:mga0n895_814254_c1 nmdc:mga0n895_814254_c1_91_615 164
35 3300050509 nmdc:mga0qj67_106813_c1 nmdc:mga0qj67_106813_c1_1407_1904 165
36 3300006880 Ga0075429_100556923 Ga0075429_1005569231 167
37 3300009147 Ga0114129_11039181 Ga0114129_110391812 167
38 3300009147 Ga0114129_11845267 Ga0114129_118452672 167
39 3300032005 Ga0307411_10478243 Ga0307411_104782432 167
40 3300009177 Ga0105248_10121312 Ga0105248_101213124 170
41 3300025941 Ga0207711_10530815 Ga0207711_105308153 170
42 3300048915 Ga0496112_0112728 Ga0496112_0112728_1728_2240 170
43 3300005288 Ga0065714_10265641 Ga0065714_102656412 172
44 3300005290 Ga0065712_10017720 Ga0065712_100177201 172
45 3300005293 Ga0065715_10460923 Ga0065715_104609231 172
46 3300005364 Ga0070673_100104872 Ga0070673_1001048723 172
47 3300005617 Ga0068859_100371458 Ga0068859_1003714582 172
48 3300005842 Ga0068858_100079007 Ga0068858_1000790072 172
49 3300005844 Ga0068862_101636240 Ga0068862_1016362401 172
50 3300006931 Ga0097620_100371449 Ga0097620_1003714492 172
51 3300009177 Ga0105248_10089842 Ga0105248_100898422 172
52 3300013308 Ga0157375_10167909 Ga0157375_101679093 172
53 3300025941 Ga0207711_11063786 Ga0207711_110637861 172
54 3300026035 Ga0207703_10193018 Ga0207703_101930182 172
55 3300028380 Ga0268265_11609893 Ga0268265_116098931 172
56 3300005334 Ga0068869_100031116 Ga0068869_1000311164 173
57 3300006852 Ga0075433_10198266 Ga0075433_101982662 173
58 3300025942 Ga0207689_10050739 Ga0207689_100507392 173
59 3300000532 CNAas_1000074 CNAas_10000748 174
60 3300005290 Ga0065712_10113867 Ga0065712_101138672 174
61 3300005293 Ga0065715_10216614 Ga0065715_102166142 174
62 3300005328 Ga0070676_10070573 Ga0070676_100705733 174
63 3300005331 Ga0070670_100069176 Ga0070670_1000691762 174
64 3300005331 Ga0070670_101432522 Ga0070670_1014325221 174
65 3300005333 Ga0070677_10092283 Ga0070677_100922832 174
66 3300005334 Ga0068869_100869528 Ga0068869_1008695282 174
67 3300005336 Ga0070680_100054670 Ga0070680_1000546702 174
68 3300005336 Ga0070680_100455964 Ga0070680_1004559641 174
69 3300005444 Ga0070694_100176131 Ga0070694_1001761312 174
70 3300005457 Ga0070662_100407152 Ga0070662_1004071522 174
71 3300005471 Ga0070698_100587818 Ga0070698_1005878181 174
72 3300005539 Ga0068853_101011402 Ga0068853_1010114022 174
73 3300005549 Ga0070704_100465086 Ga0070704_1004650862 174
74 3300005616 Ga0068852_101237234 Ga0068852_1012372342 174
75 3300005618 Ga0068864_100015136 Ga0068864_1000151367 174
76 3300005618 Ga0068864_100303169 Ga0068864_1003031693 174
77 3300005719 Ga0068861_101089990 Ga0068861_1010899902 174
78 3300005840 Ga0068870_10334274 Ga0068870_103342742 174
79 3300005843 Ga0068860_100025934 Ga0068860_1000259342 174
80 3300005843 Ga0068860_100077958 Ga0068860_1000779582 174
81 3300005844 Ga0068862_100157900 Ga0068862_1001579001 174
82 3300005844 Ga0068862_101042217 Ga0068862_1010422171 174
83 3300005985 Ga0081539_10003279 Ga0081539_1000327911 174
84 3300006844 Ga0075428_100746195 Ga0075428_1007461952 174
85 3300006846 Ga0075430_100295457 Ga0075430_1002954572 174
86 3300006881 Ga0068865_100522015 Ga0068865_1005220152 174
87 3300009094 Ga0111539_10082558 Ga0111539_100825584 174
88 3300009147 Ga0114129_10523621 Ga0114129_105236212 174
89 3300009174 Ga0105241_10352864 Ga0105241_103528642 174
90 3300009551 Ga0105238_10045381 Ga0105238_100453812 174
91 3300013297 Ga0157378_10206869 Ga0157378_102068692 174
92 3300013308 Ga0157375_10669174 Ga0157375_106691741 174
93 3300014325 Ga0163163_10399141 Ga0163163_103991412 174
94 3300014326 Ga0157380_10191710 Ga0157380_101917103 174
95 3300014326 Ga0157380_10350646 Ga0157380_103506462 174
96 3300025904 Ga0207647_10002354 Ga0207647_100023549 174
97 3300025907 Ga0207645_10033595 Ga0207645_100335951 174
98 3300025908 Ga0207643_10310004 Ga0207643_103100041 174
99 3300025917 Ga0207660_10079928 Ga0207660_100799284 174
100 3300025924 Ga0207694_10034216 Ga0207694_100342162 174
101 3300025925 Ga0207650_11140315 Ga0207650_111403151 174
102 3300025933 Ga0207706_10052924 Ga0207706_100529244 174
103 3300025938 Ga0207704_10403019 Ga0207704_104030192 174
104 3300025960 Ga0207651_10365016 Ga0207651_103650161 174
105 3300025960 Ga0207651_11165789 Ga0207651_111657891 174
106 3300026089 Ga0207648_10031731 Ga0207648_100317315 174
107 3300026089 Ga0207648_10535164 Ga0207648_105351642 174
108 3300026095 Ga0207676_10092225 Ga0207676_100922253 174
109 3300026095 Ga0207676_10302351 Ga0207676_103023513 174
110 3300026116 Ga0207674_10232554 Ga0207674_102325542 174
111 3300026118 Ga0207675_101087373 Ga0207675_1010873731 174
112 3300026121 Ga0207683_10072785 Ga0207683_100727854 174
113 3300026142 Ga0207698_11249924 Ga0207698_112499241 174
114 3300028380 Ga0268265_10052038 Ga0268265_100520383 174
115 3300028380 Ga0268265_10115224 Ga0268265_101152242 174
116 3300028381 Ga0268264_10035737 Ga0268264_100357372 174
117 3300031824 Ga0307413_10045683 Ga0307413_100456833 174
118 3300031995 Ga0307409_100236510 Ga0307409_1002365102 174
119 3300032002 Ga0307416_100206168 Ga0307416_1002061681 174
120 3300032126 Ga0307415_100080888 Ga0307415_1000808882 174
121 3300042436 Ga0439435_0127831 Ga0439435_0127831_121_645 174
122 3300048915 Ga0496112_1308933 Ga0496112_1308933_103_627 174
123 3300049515 Ga0501292_016386 Ga0501292_016386_301_825 174
124 3300049522 Ga0501299_048525 Ga0501299_048525_203_727 174
125 3300049574 Ga0501038_0000426 Ga0501038_0000426_2922_3446 174
126 3300049652 Ga0501202_013766 Ga0501202_013766_835_1359 174
127 3300049661 Ga0501217_033730 Ga0501217_033730_79_603 174
128 3300049665 Ga0501227_022698 Ga0501227_022698_91_615 174
129 3300049668 Ga0501233_009325 Ga0501233_009325_350_874 174
130 3300049675 Ga0501243_040248 Ga0501243_040248_271_795 174
131 3300049703 Ga0501219_012414 Ga0501219_012414_125_649 174
132 3300049705 Ga0501225_0045974 Ga0501225_0045974_663_1187 174
133 3300049707 Ga0501234_008952 Ga0501234_008952_412_936 174
134 3300049769 Ga0501272_003587 Ga0501272_003587_205_729 174
135 3300049779 Ga0501283_005529 Ga0501283_005529_30_554 174
136 3300050507 nmdc:mga05p37_365263_c1 nmdc:mga05p37_365263_c1_795_1319 174
137 3300005331 Ga0070670_100000070 Ga0070670_10000007013 175
138 3300005336 Ga0070680_100001227 Ga0070680_10000122712 175
139 3300005338 Ga0068868_100798302 Ga0068868_1007983022 175
140 3300005458 Ga0070681_10000097 Ga0070681_100000972 175
141 3300005518 Ga0070699_100007696 Ga0070699_1000076965 175
142 3300005530 Ga0070679_100000197 Ga0070679_10000019738 175
143 3300005546 Ga0070696_100632535 Ga0070696_1006325352 175
144 3300005549 Ga0070704_100070952 Ga0070704_1000709523 175
145 3300006173 Ga0070716_100592911 Ga0070716_1005929112 175
146 3300006844 Ga0075428_100019391 Ga0075428_1000193914 175
147 3300006846 Ga0075430_100065024 Ga0075430_1000650241 175
148 3300006847 Ga0075431_100132221 Ga0075431_1001322211 175
149 3300006880 Ga0075429_100035503 Ga0075429_1000355034 175
150 3300009147 Ga0114129_10061485 Ga0114129_100614852 175
151 3300014325 Ga0163163_10000223 Ga0163163_1000022341 175
152 3300021384 Ga0213876_10021313 Ga0213876_100213134 175
153 3300025912 Ga0207707_10000013 Ga0207707_10000013138 175
154 3300025917 Ga0207660_10000926 Ga0207660_1000092612 175
155 3300025921 Ga0207652_10000071 Ga0207652_1000007137 175
156 3300025925 Ga0207650_10000017 Ga0207650_10000017250 175
157 3300031548 Ga0307408_100146728 Ga0307408_1001467283 175
158 3300031995 Ga0307409_100224539 Ga0307409_1002245392 175
159 3300032005 Ga0307411_10090057 Ga0307411_100900573 175
160 3300037312 Ga0395899_0136987 Ga0395899_0136987_282_809 175
161 3300037418 Ga0395900_0197404 Ga0395900_0197404_608_1135 175
162 3300037466 Ga0395898_0208095 Ga0395898_0208095_315_842 175
163 3300039437 Ga0436365_0978066 Ga0436365_0978066_1310_1837 175
164 3300047319 Ga0495674_0776834 Ga0495674_0776834_39_566 175
165 3300049579 Ga0501043_0001330 Ga0501043_0001330_4799_5326 175
166 3300049580 Ga0501046_0000007 Ga0501046_0000007_205970_206497 175
167 3300049581 Ga0501047_0110222 Ga0501047_0110222_540_1067 175
168 3300049589 Ga0501073_0206312 Ga0501073_0206312_253_780 175
169 3300049744 Ga0501083_0000046 Ga0501083_0000046_1568_2095 175
170 3300049822 Ga0501035_0451426 Ga0501035_0451426_521_1048 175
171 3300049823 Ga0501044_0372538 Ga0501044_0372538_458_985 175
172 3300049824 Ga0501045_0128111 Ga0501045_0128111_101_628 175
173 3300050507 nmdc:mga05p37_162255_c1 nmdc:mga05p37_162255_c1_1191_1718 175
174 3300050507 nmdc:mga05p37_456107_c1 nmdc:mga05p37_456107_c1_164_691 175
175 3300050508 nmdc:mga09592_5709_c1 nmdc:mga09592_5709_c1_5282_5809 175
176 3300005340 Ga0070689_101316506 Ga0070689_1013165061 176
177 3300009094 Ga0111539_10059474 Ga0111539_100594742 176
178 3300009147 Ga0114129_10549277 Ga0114129_105492772 176
179 3300009148 Ga0105243_11070219 Ga0105243_110702192 176
180 3300013105 Ga0157369_10756941 Ga0157369_107569411 176
181 3300013308 Ga0157375_11499798 Ga0157375_114997982 176
182 3300014325 Ga0163163_10000072 Ga0163163_1000007272 176
183 3300035115 Ga0373941_0353334 Ga0373941_0353334_36_566 176
184 3300037471 Ga0395905_0289339 Ga0395905_0289339_506_1036 176
185 3300050511 nmdc:mga08y16_1168600_c1 nmdc:mga08y16_1168600_c1_37_585 176
186 3300000531 CNBas_1000099 CNBas_10000994 177
187 3300002076 JGI24749J21850_1009515 JGI24749J21850_10095152 177
188 3300005327 Ga0070658_10285939 Ga0070658_102859392 177
189 3300005344 Ga0070661_100815657 Ga0070661_1008156572 177
190 3300005444 Ga0070694_100908166 Ga0070694_1009081661 177
191 3300005445 Ga0070708_100183134 Ga0070708_1001831341 177
192 3300005468 Ga0070707_100023282 Ga0070707_1000232824 177
193 3300005518 Ga0070699_100026382 Ga0070699_1000263824 177
194 3300005617 Ga0068859_100022741 Ga0068859_1000227415 177
195 3300005719 Ga0068861_100327386 Ga0068861_1003273863 177
196 3300006163 Ga0070715_10000002 Ga0070715_10000002167 177
197 3300006852 Ga0075433_10780759 Ga0075433_107807592 177
198 3300006914 Ga0075436_100055708 Ga0075436_1000557083 177
199 3300006914 Ga0075436_100385632 Ga0075436_1003856322 177
200 3300006931 Ga0097620_100022741 Ga0097620_1000227415 177
201 3300007076 Ga0075435_101018593 Ga0075435_1010185932 177
202 3300009093 Ga0105240_10480694 Ga0105240_104806942 177
203 3300009094 Ga0111539_10074737 Ga0111539_100747372 177
204 3300009147 Ga0114129_10177723 Ga0114129_101777232 177
205 3300009177 Ga0105248_10032824 Ga0105248_100328246 177
206 3300025905 Ga0207685_10000002 Ga0207685_10000002271 177
207 3300025909 Ga0207705_10208348 Ga0207705_102083482 177
208 3300025922 Ga0207646_10223397 Ga0207646_102233972 177
209 3300025922 Ga0207646_10235850 Ga0207646_102358503 177
210 3300025941 Ga0207711_10016288 Ga0207711_100162883 177
211 3300026118 Ga0207675_100106318 Ga0207675_1001063183 177
212 3300045051 Ga0451576_0254692 Ga0451576_0254692_1126_1659 177
213 3300049592 Ga0501076_0376209 Ga0501076_0376209_49_606 177
214 3300049742 Ga0501080_0327208 Ga0501080_0327208_166_699 177
215 3300050507 nmdc:mga05p37_273191_c1 nmdc:mga05p37_273191_c1_1231_1779 177
216 3300050507 nmdc:mga05p37_976144_c1 nmdc:mga05p37_976144_c1_83_616 177
217 3300050511 nmdc:mga08y16_150444_c1 nmdc:mga08y16_150444_c1_1416_1955 177
218 3300050513 nmdc:mga0rr50_880305_c1 nmdc:mga0rr50_880305_c1_82_618 177
219 3300050514 nmdc:mga08x19_60154_c1 nmdc:mga08x19_60154_c1_1902_2438 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19502

DUF6036

Nucleotidyltransferase of unknown function (DUF6036)

8

172

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7te2-assembly1.cif.gz_A crystal structure of aerr from rhodobacter capsulatus at 2.25 a. 0.6136 108 173
6b4v-assembly1.cif.gz_N antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.5812 3 72
3d7i-assembly1.cif.gz_B crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution 0.5706 109 173
5uvd-assembly1.cif.gz_A crystal structure of an antigenic nucleotidyltransferase-like protein from paracoccidioides brasiliensis 0.5518 3 168
5uvd-assembly1.cif.gz_A crystal structure of an antigenic nucleotidyltransferase-like protein from paracoccidioides brasiliensis 0.5219 3 168
ID Description Score Start End Superfamily
af_Q2FVE6_5_175_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6502 42 74 3.40.50.720
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6491 5 176 3.30.460.40
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6308 5 176 3.30.460.40
af_A4IDS1_241_324_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.5914 8 73 3.30.70.790
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.5884 5 134 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A2V7W5W5-F1-model_v4 DUF6036 domain-containing protein 0.9895 14 172
AF-A0A3E0P4U1-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9887 2 176
AF-A0A7V9TXM7-F1-model_v4 DUF6036 domain-containing protein 0.987 1 171 GO:0016020
AF-A0A7V9FP56-F1-model_v4 DUF6036 domain-containing protein 0.9847 14 168
AF-A0A1Z4RD57-F1-model_v4 DUF6036 domain-containing protein 0.9839 26 177

Feature Viewer

pLDDT pTM Quality
94.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map