F330776

General Info

Members Datasets Scaffolds Average Seq Length
219 88 438 238

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100198772|Ga0070713_1001987721
Length 258
Sequence MTVTNTVASGASMSVPPVGQKRLVIVGATGMVGGYALRYALDKSAVKSVTSIGRKTLGISHPKLKEVLHQDFADCSTLADALLGQDAAVYCLGTYTGSVSDAELRAITADYTVEFARVLRSSSPNAAFSFLSGNGADPTGRSRLAFARYKGQAEKALLAAGFPRVYLFRPAYIYPVQPRKEPTFSYRLLRAVYPVFRMLFPNQVIRADELAWAMVDVVLRQTQERQGLVFENRDIRAMSVHPLRGDPAGENRSQQTSG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
43 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
65 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
70 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 97.26
Stem 0
Stem Tuber 0
Unclassified 19.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100198772 3300005436 Bacteria 1809
2 Ga0070671_100014574 3300005355 Bacteria 6357
3 Ga0070703_10146798 3300005406 Bacteria 882
4 Ga0070709_10011046 3300005434 Bacteria 5018
5 Ga0070709_10147892 3300005434 Unclassified 1621
6 Ga0070713_100007664 3300005436 Bacteria 7597
7 Ga0070713_100085043 3300005436 Bacteria 2708
8 Ga0070713_100128682 3300005436 Bacteria 2230
9 Ga0070713_100149303 3300005436 Bacteria 2077
10 Ga0070713_100265943 3300005436 Bacteria 1569
11 Ga0070710_10057265 3300005437 Unclassified 2208
12 Ga0070710_10150593 3300005437 Unclassified 1434
13 Ga0070710_10152600 3300005437 Bacteria 1426
14 Ga0070710_10199487 3300005437 Unclassified 1263
15 Ga0070711_100015464 3300005439 Bacteria 4831
16 Ga0070711_100103584 3300005439 Bacteria 2074
17 Ga0070711_100376422 3300005439 Bacteria 1147
18 Ga0070711_100598942 3300005439 Bacteria 919
19 Ga0070705_100096543 3300005440 Bacteria 1855
20 Ga0070694_100176041 3300005444 Bacteria 1579
21 Ga0070708_100001075 3300005445 Bacteria 20881
22 Ga0070708_100029016 3300005445 Bacteria 4767
23 Ga0070708_100059326 3300005445 Bacteria 3411
24 Ga0070708_100360405 3300005445 Unclassified 1370
25 Ga0070708_100363810 3300005445 Bacteria 1363
26 Ga0070708_100383957 3300005445 Bacteria 1324
27 Ga0070708_100418709 3300005445 Bacteria 1263
28 Ga0070708_100462830 3300005445 Bacteria 1196
29 Ga0070706_100040697 3300005467 Bacteria 4290
30 Ga0070706_100076936 3300005467 Bacteria 3088
31 Ga0070706_100093426 3300005467 Bacteria 2791
32 Ga0070706_100097028 3300005467 Bacteria 2737
33 Ga0070706_100307648 3300005467 Bacteria 1478
34 Ga0070706_100517536 3300005467 Unclassified 1110
35 Ga0070707_100009840 3300005468 Bacteria 8898
36 Ga0070707_100026952 3300005468 Bacteria 5463
37 Ga0070707_100128814 3300005468 Bacteria 2460
38 Ga0070707_100184275 3300005468 Bacteria 2035
39 Ga0070707_100277705 3300005468 Bacteria 1628
40 Ga0070707_100352681 3300005468 Bacteria 1429
41 Ga0070707_100517442 3300005468 Bacteria 1155
42 Ga0070698_100002736 3300005471 Bacteria 19380
43 Ga0070698_100011889 3300005471 Bacteria 9234
44 Ga0070698_100196196 3300005471 Bacteria 1955
45 Ga0070698_100196917 3300005471 Unclassified 1951
46 Ga0070698_100263236 3300005471 Bacteria 1656
47 Ga0070698_100302670 3300005471 Unclassified 1529
48 Ga0070698_100485181 3300005471 Bacteria 1173
49 Ga0070699_100005926 3300005518 Bacteria 10672
50 Ga0070699_100037098 3300005518 Bacteria 4217
51 Ga0070699_100294081 3300005518 Bacteria 1456
52 Ga0070699_100296502 3300005518 Bacteria 1450
53 Ga0070699_100477864 3300005518 Unclassified 1131
54 Ga0070699_100790138 3300005518 Unclassified 868
55 Ga0070697_100007284 3300005536 Bacteria 8604
56 Ga0070697_100018915 3300005536 Bacteria 5435
57 Ga0070697_100094438 3300005536 Bacteria 2478
58 Ga0070697_100096807 3300005536 Unclassified 2448
59 Ga0070697_100149426 3300005536 Bacteria 1969
60 Ga0070697_100177338 3300005536 Bacteria 1805
61 Ga0070697_100262000 3300005536 Bacteria 1480
62 Ga0070672_100543247 3300005543 Bacteria 1008
63 Ga0070695_100042421 3300005545 Bacteria 2888
64 Ga0070704_100091044 3300005549 Bacteria 2273
65 Ga0070704_100488448 3300005549 Bacteria 1066
66 Ga0068859_100137003 3300005617 Unclassified 2521
67 Ga0081455_10197018 3300005937 Bacteria 1512
68 Ga0081538_10025671 3300005981 Bacteria 4145
69 Ga0070717_10001502 3300006028 Bacteria 16141
70 Ga0070717_10005598 3300006028 Bacteria 9173
71 Ga0070717_10023684 3300006028 Bacteria 4868
72 Ga0070717_10047530 3300006028 Bacteria 3516
73 Ga0070717_10166575 3300006028 Unclassified 1914
74 Ga0070715_10042592 3300006163 Bacteria 1909
75 Ga0070716_100002892 3300006173 Bacteria 7999
76 Ga0070716_100024290 3300006173 Bacteria 3225
77 Ga0070716_100105214 3300006173 Bacteria 1738
78 Ga0070712_100022648 3300006175 Bacteria 4140
79 Ga0070712_100190007 3300006175 Unclassified 1606
80 Ga0070712_100232185 3300006175 Unclassified 1466
81 Ga0070712_100387637 3300006175 Bacteria 1151
82 Ga0068871_100185977 3300006358 Bacteria 1787
83 Ga0075428_100059957 3300006844 Bacteria 4166
84 Ga0075431_100024725 3300006847 Bacteria 6158
85 Ga0075431_100029881 3300006847 Bacteria 5610
86 Ga0075431_100739075 3300006847 Unclassified 960
87 Ga0075433_10002586 3300006852 Bacteria 13792
88 Ga0075433_10036024 3300006852 Bacteria 4259
89 Ga0075433_10065362 3300006852 Bacteria 3191
90 Ga0075433_10115526 3300006852 Bacteria 2381
91 Ga0075433_10204377 3300006852 Bacteria 1756
92 Ga0075434_100008726 3300006871 Bacteria 9433
93 Ga0075434_100015923 3300006871 Bacteria 7223
94 Ga0075434_100023560 3300006871 Bacteria 6001
95 Ga0075434_100227059 3300006871 Bacteria 1886
96 Ga0075434_100400990 3300006871 Bacteria 1392
97 Ga0075429_100073342 3300006880 Bacteria 2982
98 Ga0075429_100130139 3300006880 Bacteria 2201
99 Ga0075429_100293443 3300006880 Bacteria 1424
100 Ga0075436_100070321 3300006914 Unclassified 2420
101 Ga0075436_100084953 3300006914 Unclassified 2197
102 Ga0075436_100392216 3300006914 Bacteria 1005
103 Ga0097620_100136989 3300006931 Unclassified 2521
104 Ga0075435_100030445 3300007076 Bacteria 4244
105 Ga0075435_100041742 3300007076 Bacteria 3667
106 Ga0075435_100099476 3300007076 Unclassified 2408
107 Ga0111539_10364263 3300009094 Unclassified 1683
108 Ga0114129_10004890 3300009147 Bacteria 18909
109 Ga0114129_10650939 3300009147 Bacteria 1360
110 Ga0114129_11017753 3300009147 Unclassified 1042
111 Ga0105242_10072967 3300009176 Bacteria 2852
112 Ga0105248_10118975 3300009177 Bacteria 2980
113 Ga0105248_10164509 3300009177 Bacteria 2501
114 Ga0105248_10607611 3300009177 Bacteria 1234
115 Ga0105237_10439555 3300009545 Bacteria 1310
116 Ga0157374_10681367 3300013296 Bacteria 1040
117 Ga0157378_10106963 3300013297 Bacteria 2559
118 Ga0157376_10135095 3300014969 Unclassified 2206
119 Ga0157376_10208658 3300014969 Bacteria 1802
120 Ga0224570_100076 3300022730 Bacteria 5596
121 Ga0224572_1004691 3300024225 Bacteria 2396
122 Ga0228598_1006655 3300024227 Bacteria 2385
123 Ga0228598_1007228 3300024227 Bacteria 2268
124 Ga0207653_10012423 3300025885 Bacteria 2659
125 Ga0207685_10007464 3300025905 Bacteria 3048
126 Ga0207699_10008295 3300025906 Bacteria 5120
127 Ga0207699_10009272 3300025906 Bacteria 4892
128 Ga0207699_10087117 3300025906 Unclassified 1952
129 Ga0207699_10455760 3300025906 Bacteria 918
130 Ga0207684_10001064 3300025910 Bacteria 30762
131 Ga0207684_10059043 3300025910 Bacteria 3256
132 Ga0207684_10116509 3300025910 Bacteria 2289
133 Ga0207684_10158642 3300025910 Bacteria 1947
134 Ga0207684_10160758 3300025910 Bacteria 1934
135 Ga0207684_10223693 3300025910 Bacteria 1624
136 Ga0207684_10292695 3300025910 Bacteria 1404
137 Ga0207684_10665618 3300025910 Unclassified 886
138 Ga0207693_10042132 3300025915 Bacteria 3594
139 Ga0207693_10046824 3300025915 Bacteria 3398
140 Ga0207693_10057953 3300025915 Bacteria 3035
141 Ga0207693_10125426 3300025915 Bacteria 2018
142 Ga0207693_10360292 3300025915 Unclassified 1138
143 Ga0207663_10220537 3300025916 Bacteria 1379
144 Ga0207663_10237408 3300025916 Bacteria 1335
145 Ga0207663_10739565 3300025916 Bacteria 781
146 Ga0207646_10000118 3300025922 Bacteria 109016
147 Ga0207646_10002928 3300025922 Bacteria 19795
148 Ga0207646_10065117 3300025922 Bacteria 3253
149 Ga0207646_10082793 3300025922 Bacteria 2870
150 Ga0207646_10446893 3300025922 Bacteria 1166
151 Ga0207687_10064171 3300025927 Bacteria 2603
152 Ga0207700_10124062 3300025928 Unclassified 2098
153 Ga0207700_10125143 3300025928 Bacteria 2090
154 Ga0207700_10251823 3300025928 Unclassified 1509
155 Ga0207700_10424736 3300025928 Bacteria 1168
156 Ga0207700_10443288 3300025928 Unclassified 1143
157 Ga0207700_10620356 3300025928 Bacteria 963
158 Ga0207700_10690682 3300025928 Unclassified 911
159 Ga0207664_10527438 3300025929 Unclassified 1059
160 Ga0207644_10078928 3300025931 Bacteria 2427
161 Ga0207686_10046252 3300025934 Bacteria 2683
162 Ga0207665_10014039 3300025939 Bacteria 5269
163 Ga0207665_10023105 3300025939 Bacteria 4096
164 Ga0207665_10034950 3300025939 Bacteria 3335
165 Ga0207665_10153406 3300025939 Unclassified 1651
166 Ga0207711_10071786 3300025941 Bacteria 3005
167 Ga0207711_10154491 3300025941 Bacteria 2073
168 Ga0207658_10255606 3300025986 Bacteria 1491
169 Ga0207703_10087387 3300026035 Unclassified 2614
170 Ga0207648_10721282 3300026089 Unclassified 925
171 Ga0207676_10151181 3300026095 Bacteria 2000
172 Ga0209588_1001076 3300027671 Bacteria 6999
173 Ga0265356_1000155 3300028017 Bacteria 12416
174 Ga0265762_1000155 3300030760 Bacteria 10697
175 Ga0265760_10000032 3300031090 Bacteria 49109
176 Ga0265760_10000135 3300031090 Bacteria 18506
177 Ga0265760_10003016 3300031090 Bacteria 4926
178 Ga0265325_10025465 3300031241 Bacteria 3213
179 Ga0307516_10024840 3300031730 Bacteria 6114
180 Ga0307516_10029019 3300031730 Bacteria 5595
181 Ga0316212_1011826 3300033547 Unclassified 1246
182 Ga0373940_0055121 3300035088 Bacteria 1125
183 Ga0373955_0275020 3300035172 Bacteria 1012
184 Ga0373935_0117928 3300035692 Unclassified 1770
185 Ga0495662_0005526 3300046476 Bacteria 6322
186 Ga0495628_0024835 3300046516 Bacteria 4902
187 Ga0495630_0000017 3300046517 Bacteria 191957
188 Ga0495630_0014424 3300046517 Bacteria 5758
189 Ga0495645_0030954 3300046543 Bacteria 3897
190 Ga0496103_0435374 3300048906 Bacteria 841
191 Ga0496104_0508760 3300048907 Bacteria 1115
192 Ga0496115_0111730 3300048918 Bacteria 2245
193 nmdc:mga05p37_33076_c1 3300050507 Bacteria 6333
194 nmdc:mga05p37_390147_c1 3300050507 Bacteria 1629
195 nmdc:mga05p37_46224_c1 3300050507 Bacteria 5353
196 nmdc:mga05p37_7283_c1 3300050507 Bacteria 13053
197 nmdc:mga09592_55395_c1 3300050508 Bacteria 3351
198 nmdc:mga0qj67_585378_c1 3300050509 Unclassified 893
199 nmdc:mga06r32_701252_c1 3300050510 Unclassified 978
200 nmdc:mga06r32_75059_c1 3300050510 Bacteria 3280
201 nmdc:mga08y16_329643_c1 3300050511 Unclassified 1570
202 nmdc:mga0n895_107170_c1 3300050512 Bacteria 2808
203 nmdc:mga0n895_119752_c1 3300050512 Bacteria 2653
204 nmdc:mga0n895_211019_c1 3300050512 Bacteria 1972
205 nmdc:mga0n895_213171_c1 3300050512 Bacteria 1961
206 nmdc:mga0n895_21850_c1 3300050512 Bacteria 5991
207 nmdc:mga0n895_34262_c1 3300050512 Bacteria 4886
208 nmdc:mga0n895_9075_c1 3300050512 Bacteria 8673
209 nmdc:mga0n895_97236_c1 3300050512 Bacteria 2950
210 nmdc:mga0rr50_139518_c1 3300050513 Unclassified 1949
211 nmdc:mga0rr50_159621_c1 3300050513 Bacteria 1829
212 nmdc:mga0rr50_586898_c1 3300050513 Unclassified 950
213 nmdc:mga08x19_156349_c1 3300050514 Unclassified 1546
214 nmdc:mga08x19_341389_c1 3300050514 Bacteria 1045
215 nmdc:mga0a205_159415_c1 3300050515 Bacteria 2154
216 nmdc:mga0a205_218151_c1 3300050515 Bacteria 1794
217 nmdc:mga0a205_236912_c1 3300050515 Bacteria 1707
218 nmdc:mga0a205_260933_c1 3300050515 Unclassified 1610
219 nmdc:mga0a205_48751_c2 3300050515 Bacteria 3125
220 Ga0070713_100198772
221 Ga0070671_100014574
222 Ga0070703_10146798
223 Ga0070709_10011046
224 Ga0070709_10147892
225 Ga0070713_100007664
226 Ga0070713_100085043
227 Ga0070713_100128682
228 Ga0070713_100149303
229 Ga0070713_100265943
230 Ga0070710_10057265
231 Ga0070710_10150593
232 Ga0070710_10152600
233 Ga0070710_10199487
234 Ga0070711_100015464
235 Ga0070711_100103584
236 Ga0070711_100376422
237 Ga0070711_100598942
238 Ga0070705_100096543
239 Ga0070694_100176041
240 Ga0070708_100001075
241 Ga0070708_100029016
242 Ga0070708_100059326
243 Ga0070708_100360405
244 Ga0070708_100363810
245 Ga0070708_100383957
246 Ga0070708_100418709
247 Ga0070708_100462830
248 Ga0070706_100040697
249 Ga0070706_100076936
250 Ga0070706_100093426
251 Ga0070706_100097028
252 Ga0070706_100307648
253 Ga0070706_100517536
254 Ga0070707_100009840
255 Ga0070707_100026952
256 Ga0070707_100128814
257 Ga0070707_100184275
258 Ga0070707_100277705
259 Ga0070707_100352681
260 Ga0070707_100517442
261 Ga0070698_100002736
262 Ga0070698_100011889
263 Ga0070698_100196196
264 Ga0070698_100196917
265 Ga0070698_100263236
266 Ga0070698_100302670
267 Ga0070698_100485181
268 Ga0070699_100005926
269 Ga0070699_100037098
270 Ga0070699_100294081
271 Ga0070699_100296502
272 Ga0070699_100477864
273 Ga0070699_100790138
274 Ga0070697_100007284
275 Ga0070697_100018915
276 Ga0070697_100094438
277 Ga0070697_100096807
278 Ga0070697_100149426
279 Ga0070697_100177338
280 Ga0070697_100262000
281 Ga0070672_100543247
282 Ga0070695_100042421
283 Ga0070704_100091044
284 Ga0070704_100488448
285 Ga0068859_100137003
286 Ga0081455_10197018
287 Ga0081538_10025671
288 Ga0070717_10001502
289 Ga0070717_10005598
290 Ga0070717_10023684
291 Ga0070717_10047530
292 Ga0070717_10166575
293 Ga0070715_10042592
294 Ga0070716_100002892
295 Ga0070716_100024290
296 Ga0070716_100105214
297 Ga0070712_100022648
298 Ga0070712_100190007
299 Ga0070712_100232185
300 Ga0070712_100387637
301 Ga0068871_100185977
302 Ga0075428_100059957
303 Ga0075431_100024725
304 Ga0075431_100029881
305 Ga0075431_100739075
306 Ga0075433_10002586
307 Ga0075433_10036024
308 Ga0075433_10065362
309 Ga0075433_10115526
310 Ga0075433_10204377
311 Ga0075434_100008726
312 Ga0075434_100015923
313 Ga0075434_100023560
314 Ga0075434_100227059
315 Ga0075434_100400990
316 Ga0075429_100073342
317 Ga0075429_100130139
318 Ga0075429_100293443
319 Ga0075436_100070321
320 Ga0075436_100084953
321 Ga0075436_100392216
322 Ga0097620_100136989
323 Ga0075435_100030445
324 Ga0075435_100041742
325 Ga0075435_100099476
326 Ga0111539_10364263
327 Ga0114129_10004890
328 Ga0114129_10650939
329 Ga0114129_11017753
330 Ga0105242_10072967
331 Ga0105248_10118975
332 Ga0105248_10164509
333 Ga0105248_10607611
334 Ga0105237_10439555
335 Ga0157374_10681367
336 Ga0157378_10106963
337 Ga0157376_10135095
338 Ga0157376_10208658
339 Ga0224570_100076
340 Ga0224572_1004691
341 Ga0228598_1006655
342 Ga0228598_1007228
343 Ga0207653_10012423
344 Ga0207685_10007464
345 Ga0207699_10008295
346 Ga0207699_10009272
347 Ga0207699_10087117
348 Ga0207699_10455760
349 Ga0207684_10001064
350 Ga0207684_10059043
351 Ga0207684_10116509
352 Ga0207684_10158642
353 Ga0207684_10160758
354 Ga0207684_10223693
355 Ga0207684_10292695
356 Ga0207684_10665618
357 Ga0207693_10042132
358 Ga0207693_10046824
359 Ga0207693_10057953
360 Ga0207693_10125426
361 Ga0207693_10360292
362 Ga0207663_10220537
363 Ga0207663_10237408
364 Ga0207663_10739565
365 Ga0207646_10000118
366 Ga0207646_10002928
367 Ga0207646_10065117
368 Ga0207646_10082793
369 Ga0207646_10446893
370 Ga0207687_10064171
371 Ga0207700_10124062
372 Ga0207700_10125143
373 Ga0207700_10251823
374 Ga0207700_10424736
375 Ga0207700_10443288
376 Ga0207700_10620356
377 Ga0207700_10690682
378 Ga0207664_10527438
379 Ga0207644_10078928
380 Ga0207686_10046252
381 Ga0207665_10014039
382 Ga0207665_10023105
383 Ga0207665_10034950
384 Ga0207665_10153406
385 Ga0207711_10071786
386 Ga0207711_10154491
387 Ga0207658_10255606
388 Ga0207703_10087387
389 Ga0207648_10721282
390 Ga0207676_10151181
391 Ga0209588_1001076
392 Ga0265356_1000155
393 Ga0265762_1000155
394 Ga0265760_10000032
395 Ga0265760_10000135
396 Ga0265760_10003016
397 Ga0265325_10025465
398 Ga0307516_10024840
399 Ga0307516_10029019
400 Ga0316212_1011826
401 Ga0373940_0055121
402 Ga0373955_0275020
403 Ga0373935_0117928
404 Ga0495662_0005526
405 Ga0495628_0024835
406 Ga0495630_0000017
407 Ga0495630_0014424
408 Ga0495645_0030954
409 Ga0496103_0435374
410 Ga0496104_0508760
411 Ga0496115_0111730
412 nmdc:mga05p37_33076_c1
413 nmdc:mga05p37_390147_c1
414 nmdc:mga05p37_46224_c1
415 nmdc:mga05p37_7283_c1
416 nmdc:mga09592_55395_c1
417 nmdc:mga0qj67_585378_c1
418 nmdc:mga06r32_701252_c1
419 nmdc:mga06r32_75059_c1
420 nmdc:mga08y16_329643_c1
421 nmdc:mga0n895_107170_c1
422 nmdc:mga0n895_119752_c1
423 nmdc:mga0n895_211019_c1
424 nmdc:mga0n895_213171_c1
425 nmdc:mga0n895_21850_c1
426 nmdc:mga0n895_34262_c1
427 nmdc:mga0n895_9075_c1
428 nmdc:mga0n895_97236_c1
429 nmdc:mga0rr50_139518_c1
430 nmdc:mga0rr50_159621_c1
431 nmdc:mga0rr50_586898_c1
432 nmdc:mga08x19_156349_c1
433 nmdc:mga08x19_341389_c1
434 nmdc:mga0a205_159415_c1
435 nmdc:mga0a205_218151_c1
436 nmdc:mga0a205_236912_c1
437 nmdc:mga0a205_260933_c1
438 nmdc:mga0a205_48751_c2

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8966 8 227
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.8405 8 227
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8167 8 227
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.7886 8 227
2a35-assembly1.cif.gz_A 1.5 a crystal structure of a protein of unknown function pa4017 from pseudomonas aeruginosa pao1, possible epimerase 0.7878 8 228
ID Description Score Start End Superfamily
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8966 8 227 3.40.50.720
af_Q5DX36_1_216_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8694 9 227 3.40.50.720
af_Q4DZT9_2_96_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.857 3 58 3.40.50.720
af_Q5DX36_1_216_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8503 9 227 3.40.50.720
af_P40008_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8447 10 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Z9INY0-F1-model_v4 Epimerase 0.9634 9 125
AF-S7VE36-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9573 10 140
AF-A0A4Q6CJ12-F1-model_v4 Epimerase 0.9558 10 146
AF-A0A833AP09-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9542 6 81
AF-A0A7G8BGI2-F1-model_v4 NAD(P)H-binding protein 0.9538 1 227 GO:0016020

Map