F330135

General Info

Members Datasets Scaffolds Average Seq Length
218 103 436 116

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10117934|Ga0307410_101179342
Length 113
Sequence MDIFQEKSYAFALRVVRLSEYLNNEKKEFILSKKILDSGTNIGLLIEEGKQGESRVDFIQKYSVANIRGVQNKFLVTAAARFAESSQAESLLADCEELQKLLISALKTARKSE

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
97 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
100 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
101 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
103 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 0
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 13.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10117934 3300031852 Bacteria 1931
2 SwRhRL2b_contig_1586503 2162886007 Bacteria 1096
3 LJQas_1005466 3300000549 Bacteria 1611
4 rootL2_10177322 3300003322 Unclassified 1738
5 Ga0065704_10085400 3300005289 Bacteria 3227
6 Ga0070670_100080678 3300005331 Bacteria 2796
7 Ga0070670_100495379 3300005331 Bacteria 1086
8 Ga0070670_101058678 3300005331 Bacteria 739
9 Ga0070670_101446638 3300005331 Unclassified 630
10 Ga0070677_10838773 3300005333 Bacteria 527
11 Ga0070680_100425443 3300005336 Bacteria 1133
12 Ga0070680_100526716 3300005336 Bacteria 1012
13 Ga0070660_100038608 3300005339 Bacteria 3626
14 Ga0070660_100332013 3300005339 Bacteria 1250
15 Ga0070660_100615861 3300005339 Bacteria 908
16 Ga0070689_100108508 3300005340 Unclassified 2205
17 Ga0070689_100784868 3300005340 Bacteria 837
18 Ga0070661_100129075 3300005344 Bacteria 1898
19 Ga0070661_100490583 3300005344 Bacteria 982
20 Ga0070661_100572818 3300005344 Bacteria 910
21 Ga0070669_100896413 3300005353 Bacteria 757
22 Ga0070675_100897860 3300005354 Bacteria 812
23 Ga0070688_100175180 3300005365 Bacteria 1484
24 Ga0070659_100033647 3300005366 Bacteria 3982
25 Ga0070701_10332573 3300005438 Unclassified 943
26 Ga0070694_101528440 3300005444 Bacteria 565
27 Ga0070662_100595722 3300005457 Bacteria 929
28 Ga0070681_10827169 3300005458 Unclassified 843
29 Ga0070681_11527914 3300005458 Bacteria 592
30 Ga0068867_100183770 3300005459 Bacteria 1664
31 Ga0068867_101752982 3300005459 Bacteria 583
32 Ga0070685_10135982 3300005466 Bacteria 1542
33 Ga0070685_10589871 3300005466 Bacteria 798
34 Ga0070685_10759763 3300005466 Bacteria 711
35 Ga0070679_100143310 3300005530 Bacteria 2368
36 Ga0070679_102014616 3300005530 Bacteria 526
37 Ga0068853_100038523 3300005539 Bacteria 4072
38 Ga0068853_100239988 3300005539 Bacteria 1661
39 Ga0068853_100686671 3300005539 Bacteria 976
40 Ga0068853_101991140 3300005539 Bacteria 563
41 Ga0070672_101002967 3300005543 Unclassified 740
42 Ga0070696_101750114 3300005546 Bacteria 536
43 Ga0070665_100173352 3300005548 Bacteria 2158
44 Ga0070665_100185946 3300005548 Bacteria 2078
45 Ga0070665_100448678 3300005548 Bacteria 1299
46 Ga0070704_100099881 3300005549 Bacteria 2183
47 Ga0068855_100156133 3300005563 Bacteria 2592
48 Ga0068855_100274808 3300005563 Bacteria 1872
49 Ga0068855_100711742 3300005563 Bacteria 1074
50 Ga0070664_100018688 3300005564 Bacteria 5699
51 Ga0070664_100050036 3300005564 Bacteria 3535
52 Ga0070664_100120186 3300005564 Bacteria 2300
53 Ga0070664_100733313 3300005564 Bacteria 922
54 Ga0070664_101684068 3300005564 Bacteria 601
55 Ga0068857_100027660 3300005577 Bacteria 5002
56 Ga0068857_100031373 3300005577 Bacteria 4696
57 Ga0068857_100084359 3300005577 Bacteria 2839
58 Ga0068857_100587344 3300005577 Unclassified 1052
59 Ga0068857_101196582 3300005577 Bacteria 736
60 Ga0070702_100743890 3300005615 Bacteria 752
61 Ga0068852_102215143 3300005616 Bacteria 571
62 Ga0068859_100127649 3300005617 Bacteria 2613
63 Ga0068859_100218456 3300005617 Bacteria 1994
64 Ga0068864_100040096 3300005618 Bacteria 4005
65 Ga0068864_100054507 3300005618 Bacteria 3451
66 Ga0068864_100113688 3300005618 Bacteria 2413
67 Ga0068864_100941169 3300005618 Bacteria 854
68 Ga0068864_101187537 3300005618 Unclassified 761
69 Ga0068864_102093917 3300005618 Bacteria 572
70 Ga0068864_102183303 3300005618 Bacteria 560
71 Ga0068861_100256712 3300005719 Bacteria 1494
72 Ga0068861_100570670 3300005719 Bacteria 1034
73 Ga0068861_101892632 3300005719 Bacteria 593
74 Ga0068870_10504192 3300005840 Bacteria 807
75 Ga0068870_10731449 3300005840 Bacteria 685
76 Ga0068863_100325067 3300005841 Bacteria 1494
77 Ga0068863_101820231 3300005841 Bacteria 619
78 Ga0068858_100179438 3300005842 Bacteria 1999
79 Ga0068860_100388614 3300005843 Bacteria 1378
80 Ga0068860_102560414 3300005843 Bacteria 529
81 Ga0097620_100127668 3300006931 Bacteria 2613
82 Ga0097620_100218446 3300006931 Bacteria 1994
83 Ga0105243_10104203 3300009148 Bacteria 2361
84 Ga0105243_10203312 3300009148 Bacteria 1739
85 Ga0105241_11034294 3300009174 Bacteria 770
86 Ga0105241_11869028 3300009174 Bacteria 588
87 Ga0105242_10712989 3300009176 Bacteria 983
88 Ga0105248_12500180 3300009177 Bacteria 588
89 Ga0105249_10027840 3300009553 Bacteria 5100
90 Ga0105249_10053459 3300009553 Bacteria 3691
91 Ga0105249_10078403 3300009553 Unclassified 3065
92 Ga0105249_10270285 3300009553 Bacteria 1693
93 Ga0105249_11083367 3300009553 Bacteria 871
94 Ga0105249_13333102 3300009553 Bacteria 517
95 Ga0105239_10634507 3300010375 Bacteria 1220
96 Ga0105246_12556785 3300011119 Unclassified 503
97 Ga0157373_10037019 3300013100 Bacteria 3501
98 Ga0157373_10211851 3300013100 Bacteria 1366
99 Ga0157373_10997639 3300013100 Bacteria 625
100 Ga0157378_11162349 3300013297 Bacteria 810
101 Ga0163162_10414944 3300013306 Bacteria 1478
102 Ga0163162_10992029 3300013306 Bacteria 949
103 Ga0157372_10064658 3300013307 Bacteria 4104
104 Ga0157372_10288457 3300013307 Bacteria 1909
105 Ga0157372_10744988 3300013307 Bacteria 1139
106 Ga0157372_11084926 3300013307 Bacteria 926
107 Ga0157372_11620208 3300013307 Bacteria 745
108 Ga0157375_10011344 3300013308 Bacteria 7868
109 Ga0157375_10764251 3300013308 Bacteria 1117
110 Ga0157375_11299516 3300013308 Unclassified 855
111 Ga0163163_10209514 3300014325 Bacteria 1998
112 Ga0163163_10528907 3300014325 Bacteria 1241
113 Ga0163163_10672273 3300014325 Bacteria 1099
114 Ga0163163_11465798 3300014325 Bacteria 744
115 Ga0163163_13160814 3300014325 Bacteria 514
116 Ga0157380_11114155 3300014326 Bacteria 829
117 Ga0157377_10383700 3300014745 Bacteria 952
118 Ga0157377_10604455 3300014745 Bacteria 783
119 Ga0207654_10235125 3300025911 Bacteria 1222
120 Ga0207654_11066182 3300025911 Bacteria 588
121 Ga0207660_10369398 3300025917 Bacteria 1152
122 Ga0207657_10042031 3300025919 Bacteria 4036
123 Ga0207657_10057008 3300025919 Bacteria 3369
124 Ga0207657_10735620 3300025919 Bacteria 765
125 Ga0207649_10133319 3300025920 Bacteria 1690
126 Ga0207649_10305512 3300025920 Bacteria 1164
127 Ga0207652_10076075 3300025921 Bacteria 2926
128 Ga0207652_11604780 3300025921 Bacteria 555
129 Ga0207650_10477318 3300025925 Bacteria 1040
130 Ga0207650_11163144 3300025925 Bacteria 657
131 Ga0207659_10188279 3300025926 Bacteria 1640
132 Ga0207706_10211910 3300025933 Bacteria 1698
133 Ga0207670_10085506 3300025936 Unclassified 2217
134 Ga0207670_10947187 3300025936 Bacteria 723
135 Ga0207689_11233850 3300025942 Bacteria 629
136 Ga0207689_11749126 3300025942 Bacteria 514
137 Ga0207679_10031187 3300025945 Bacteria 3730
138 Ga0207679_10035128 3300025945 Bacteria 3543
139 Ga0207679_10743362 3300025945 Bacteria 892
140 Ga0207667_10060992 3300025949 Bacteria 3947
141 Ga0207667_11150397 3300025949 Bacteria 757
142 Ga0207667_11670091 3300025949 Bacteria 604
143 Ga0207712_10039258 3300025961 Bacteria 3243
144 Ga0207712_10646346 3300025961 Bacteria 919
145 Ga0207712_10663974 3300025961 Bacteria 907
146 Ga0207712_11396785 3300025961 Bacteria 626
147 Ga0207639_11019581 3300026041 Bacteria 775
148 Ga0207639_11118330 3300026041 Unclassified 739
149 Ga0207639_11567338 3300026041 Bacteria 618
150 Ga0207641_10247053 3300026088 Bacteria 1665
151 Ga0207648_10224081 3300026089 Bacteria 1672
152 Ga0207648_10560161 3300026089 Bacteria 1050
153 Ga0207648_11519785 3300026089 Bacteria 629
154 Ga0207676_10446316 3300026095 Bacteria 1218
155 Ga0207676_10451891 3300026095 Unclassified 1211
156 Ga0207676_10536254 3300026095 Bacteria 1116
157 Ga0207676_10567235 3300026095 Unclassified 1086
158 Ga0207674_10002319 3300026116 Bacteria 24104
159 Ga0207674_10019107 3300026116 Bacteria 7429
160 Ga0207674_10743823 3300026116 Unclassified 946
161 Ga0207674_11192044 3300026116 Bacteria 731
162 Ga0207675_100810330 3300026118 Bacteria 950
163 Ga0207675_101204231 3300026118 Bacteria 778
164 Ga0207675_101642983 3300026118 Bacteria 663
165 Ga0207698_10614573 3300026142 Bacteria 1073
166 Ga0268265_10623907 3300028380 Bacteria 1033
167 Ga0268264_10362924 3300028381 Unclassified 1382
168 Ga0268264_11084783 3300028381 Bacteria 809
169 Ga0307408_100518720 3300031548 Bacteria 1046
170 Ga0307405_10003756 3300031731 Bacteria 7052
171 Ga0307405_11230123 3300031731 Bacteria 649
172 Ga0307405_12019501 3300031731 Bacteria 516
173 Ga0307405_12162867 3300031731 Bacteria 500
174 Ga0307413_10010749 3300031824 Bacteria 4458
175 Ga0307413_11705297 3300031824 Bacteria 562
176 Ga0307410_10000239 3300031852 Bacteria 20749
177 Ga0307410_10107590 3300031852 Bacteria 2012
178 Ga0307410_10788640 3300031852 Bacteria 807
179 Ga0307406_10005240 3300031901 Bacteria 7085
180 Ga0307406_10109279 3300031901 Unclassified 1900
181 Ga0307406_10522879 3300031901 Unclassified 966
182 Ga0307406_10575511 3300031901 Unclassified 925
183 Ga0307406_11123724 3300031901 Bacteria 679
184 Ga0307407_10000983 3300031903 Bacteria 9763
185 Ga0307407_10554069 3300031903 Bacteria 850
186 Ga0307412_10003756 3300031911 Bacteria 8437
187 Ga0307409_100235041 3300031995 Bacteria 1664
188 Ga0307416_100010404 3300032002 Bacteria 6141
189 Ga0307416_100550457 3300032002 Bacteria 1227
190 Ga0307416_102647186 3300032002 Bacteria 599
191 Ga0307414_10026092 3300032004 Bacteria 3755
192 Ga0307414_10106597 3300032004 Bacteria 2122
193 Ga0307414_11627071 3300032004 Unclassified 602
194 Ga0307411_10455722 3300032005 Bacteria 1071
195 Ga0307411_10486257 3300032005 Unclassified 1040
196 Ga0307411_10720032 3300032005 Bacteria 871
197 Ga0307411_11501125 3300032005 Bacteria 619
198 Ga0307411_11642839 3300032005 Bacteria 594
199 Ga0307415_100080384 3300032126 Unclassified 2325
200 Ga0307415_100284285 3300032126 Bacteria 1362
201 Ga0307415_100349481 3300032126 Bacteria 1244
202 Ga0307415_100965521 3300032126 Bacteria 790
203 Ga0395900_0752466 3300037418 Bacteria 905
204 Ga0395905_0370792 3300037471 Bacteria 1325
205 Ga0395905_0387095 3300037471 Bacteria 1293
206 Ga0439438_124271 3300041405 Unclassified 620
207 Ga0439465_0027595 3300041413 Bacteria 1799
208 Ga0451841_0591048 3300041498 Unclassified 502
209 Ga0439432_073460 3300042006 Bacteria 1041
210 Ga0439449_0121739 3300042007 Unclassified 969
211 Ga0450923_100757 3300042125 Unclassified 666
212 Ga0450898_067856 3300042134 Unclassified 710
213 Ga0495668_0000102 3300046616 Bacteria 137192
214 Ga0501257_019271 3300049686 Bacteria 1595
215 Ga0501225_0084641 3300049705 Unclassified 913
216 Ga0501268_016034 3300049765 Unclassified 1237
217 Ga0500568_0214255 3300053139 Bacteria 704
218 Ga0500577_0093208 3300053142 Bacteria 1220
219 Ga0307410_10117934
220 SwRhRL2b_contig_1586503
221 LJQas_1005466
222 rootL2_10177322
223 Ga0065704_10085400
224 Ga0070670_100080678
225 Ga0070670_100495379
226 Ga0070670_101058678
227 Ga0070670_101446638
228 Ga0070677_10838773
229 Ga0070680_100425443
230 Ga0070680_100526716
231 Ga0070660_100038608
232 Ga0070660_100332013
233 Ga0070660_100615861
234 Ga0070689_100108508
235 Ga0070689_100784868
236 Ga0070661_100129075
237 Ga0070661_100490583
238 Ga0070661_100572818
239 Ga0070669_100896413
240 Ga0070675_100897860
241 Ga0070688_100175180
242 Ga0070659_100033647
243 Ga0070701_10332573
244 Ga0070694_101528440
245 Ga0070662_100595722
246 Ga0070681_10827169
247 Ga0070681_11527914
248 Ga0068867_100183770
249 Ga0068867_101752982
250 Ga0070685_10135982
251 Ga0070685_10589871
252 Ga0070685_10759763
253 Ga0070679_100143310
254 Ga0070679_102014616
255 Ga0068853_100038523
256 Ga0068853_100239988
257 Ga0068853_100686671
258 Ga0068853_101991140
259 Ga0070672_101002967
260 Ga0070696_101750114
261 Ga0070665_100173352
262 Ga0070665_100185946
263 Ga0070665_100448678
264 Ga0070704_100099881
265 Ga0068855_100156133
266 Ga0068855_100274808
267 Ga0068855_100711742
268 Ga0070664_100018688
269 Ga0070664_100050036
270 Ga0070664_100120186
271 Ga0070664_100733313
272 Ga0070664_101684068
273 Ga0068857_100027660
274 Ga0068857_100031373
275 Ga0068857_100084359
276 Ga0068857_100587344
277 Ga0068857_101196582
278 Ga0070702_100743890
279 Ga0068852_102215143
280 Ga0068859_100127649
281 Ga0068859_100218456
282 Ga0068864_100040096
283 Ga0068864_100054507
284 Ga0068864_100113688
285 Ga0068864_100941169
286 Ga0068864_101187537
287 Ga0068864_102093917
288 Ga0068864_102183303
289 Ga0068861_100256712
290 Ga0068861_100570670
291 Ga0068861_101892632
292 Ga0068870_10504192
293 Ga0068870_10731449
294 Ga0068863_100325067
295 Ga0068863_101820231
296 Ga0068858_100179438
297 Ga0068860_100388614
298 Ga0068860_102560414
299 Ga0097620_100127668
300 Ga0097620_100218446
301 Ga0105243_10104203
302 Ga0105243_10203312
303 Ga0105241_11034294
304 Ga0105241_11869028
305 Ga0105242_10712989
306 Ga0105248_12500180
307 Ga0105249_10027840
308 Ga0105249_10053459
309 Ga0105249_10078403
310 Ga0105249_10270285
311 Ga0105249_11083367
312 Ga0105249_13333102
313 Ga0105239_10634507
314 Ga0105246_12556785
315 Ga0157373_10037019
316 Ga0157373_10211851
317 Ga0157373_10997639
318 Ga0157378_11162349
319 Ga0163162_10414944
320 Ga0163162_10992029
321 Ga0157372_10064658
322 Ga0157372_10288457
323 Ga0157372_10744988
324 Ga0157372_11084926
325 Ga0157372_11620208
326 Ga0157375_10011344
327 Ga0157375_10764251
328 Ga0157375_11299516
329 Ga0163163_10209514
330 Ga0163163_10528907
331 Ga0163163_10672273
332 Ga0163163_11465798
333 Ga0163163_13160814
334 Ga0157380_11114155
335 Ga0157377_10383700
336 Ga0157377_10604455
337 Ga0207654_10235125
338 Ga0207654_11066182
339 Ga0207660_10369398
340 Ga0207657_10042031
341 Ga0207657_10057008
342 Ga0207657_10735620
343 Ga0207649_10133319
344 Ga0207649_10305512
345 Ga0207652_10076075
346 Ga0207652_11604780
347 Ga0207650_10477318
348 Ga0207650_11163144
349 Ga0207659_10188279
350 Ga0207706_10211910
351 Ga0207670_10085506
352 Ga0207670_10947187
353 Ga0207689_11233850
354 Ga0207689_11749126
355 Ga0207679_10031187
356 Ga0207679_10035128
357 Ga0207679_10743362
358 Ga0207667_10060992
359 Ga0207667_11150397
360 Ga0207667_11670091
361 Ga0207712_10039258
362 Ga0207712_10646346
363 Ga0207712_10663974
364 Ga0207712_11396785
365 Ga0207639_11019581
366 Ga0207639_11118330
367 Ga0207639_11567338
368 Ga0207641_10247053
369 Ga0207648_10224081
370 Ga0207648_10560161
371 Ga0207648_11519785
372 Ga0207676_10446316
373 Ga0207676_10451891
374 Ga0207676_10536254
375 Ga0207676_10567235
376 Ga0207674_10002319
377 Ga0207674_10019107
378 Ga0207674_10743823
379 Ga0207674_11192044
380 Ga0207675_100810330
381 Ga0207675_101204231
382 Ga0207675_101642983
383 Ga0207698_10614573
384 Ga0268265_10623907
385 Ga0268264_10362924
386 Ga0268264_11084783
387 Ga0307408_100518720
388 Ga0307405_10003756
389 Ga0307405_11230123
390 Ga0307405_12019501
391 Ga0307405_12162867
392 Ga0307413_10010749
393 Ga0307413_11705297
394 Ga0307410_10000239
395 Ga0307410_10107590
396 Ga0307410_10788640
397 Ga0307406_10005240
398 Ga0307406_10109279
399 Ga0307406_10522879
400 Ga0307406_10575511
401 Ga0307406_11123724
402 Ga0307407_10000983
403 Ga0307407_10554069
404 Ga0307412_10003756
405 Ga0307409_100235041
406 Ga0307416_100010404
407 Ga0307416_100550457
408 Ga0307416_102647186
409 Ga0307414_10026092
410 Ga0307414_10106597
411 Ga0307414_11627071
412 Ga0307411_10455722
413 Ga0307411_10486257
414 Ga0307411_10720032
415 Ga0307411_11501125
416 Ga0307411_11642839
417 Ga0307415_100080384
418 Ga0307415_100284285
419 Ga0307415_100349481
420 Ga0307415_100965521
421 Ga0395900_0752466
422 Ga0395905_0370792
423 Ga0395905_0387095
424 Ga0439438_124271
425 Ga0439465_0027595
426 Ga0451841_0591048
427 Ga0439432_073460
428 Ga0439449_0121739
429 Ga0450923_100757
430 Ga0450898_067856
431 Ga0495668_0000102
432 Ga0501257_019271
433 Ga0501225_0084641
434 Ga0501268_016034
435 Ga0500568_0214255
436 Ga0500577_0093208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

2

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9948 3 109
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9924 2 109
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9869 2 108
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9792 1 106
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9766 3 109
ID Description Score Start End Superfamily
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9923 2 109 1.20.1440.60
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9919 2 109 1.20.1440.60
2rldA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9866 2 108 1.20.1440.60
2rldE00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9856 2 109 1.20.1440.60
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9789 1 106 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A419T4F7-F1-model_v4 Four helix bundle protein 1.003 2 113
AF-A0A354HWF2-F1-model_v4 Four helix bundle protein 1.002 3 114
AF-A0A239QKG4-F1-model_v4 Four helix bundle protein 1.002 4 114
AF-H8XP49-F1-model_v4 Four helix bundle protein 1.002 2 100
AF-A0A1V5W2Y2-F1-model_v4 Four helix bundle protein 1.001 4 115

Map