F328860

General Info

Members Datasets Scaffolds Average Seq Length
217 142 434 158

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10283677|Ga0207712_102836772
Length 173
Sequence VLVHGLFADGSSWSGVIPRLQTAGLDVTSVQNPLTTLTEAVAAAERKTSGEIRFAIDTTLSIPELWAGKHARDCAHEAFARLRVWDSELNNGVLIYVLMADRDVEIVADRGAAARISPIEWEAACRLMESHFREGRYREGALAGVEAVGGLLEREFPSRSDNRDELPNQPALL

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.15
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 19.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10283677 3300025961 Bacteria 1352
2 rootH2_10160224 3300003320 Unclassified 1022
3 rootL2_10095134 3300003322 Bacteria 2529
4 Ga0070676_10683327 3300005328 Bacteria 748
5 Ga0070690_100405756 3300005330 Bacteria 1002
6 Ga0070670_100320254 3300005331 Bacteria 1358
7 Ga0070677_10062924 3300005333 Bacteria 1536
8 Ga0068869_100117751 3300005334 Unclassified 2028
9 Ga0068869_100370279 3300005334 Bacteria 1172
10 Ga0068869_100589446 3300005334 Bacteria 938
11 Ga0070682_100012247 3300005337 Bacteria 4912
12 Ga0070682_100039217 3300005337 Bacteria 2910
13 Ga0070682_100490896 3300005337 Bacteria 949
14 Ga0068868_101000414 3300005338 Bacteria 765
15 Ga0070689_100005957 3300005340 Bacteria 8385
16 Ga0070691_10437481 3300005341 Bacteria 744
17 Ga0070691_10438934 3300005341 Unclassified 743
18 Ga0070692_10327052 3300005345 Bacteria 945
19 Ga0070668_100027230 3300005347 Bacteria 4339
20 Ga0070668_100256624 3300005347 Bacteria 1453
21 Ga0070669_100701279 3300005353 Unclassified 855
22 Ga0070675_100005011 3300005354 Bacteria 10114
23 Ga0070675_100357246 3300005354 Bacteria 1297
24 Ga0070675_101297901 3300005354 Unclassified 671
25 Ga0070674_100054627 3300005356 Bacteria 2763
26 Ga0070674_100502980 3300005356 Bacteria 1009
27 Ga0070673_100088339 3300005364 Bacteria 2528
28 Ga0070673_100321034 3300005364 Bacteria 1368
29 Ga0070673_100674357 3300005364 Bacteria 948
30 Ga0070688_100738674 3300005365 Unclassified 765
31 Ga0070710_10101366 3300005437 Bacteria 1715
32 Ga0070701_10134539 3300005438 Unclassified 1407
33 Ga0070700_100562360 3300005441 Bacteria 888
34 Ga0070708_101141902 3300005445 Bacteria 729
35 Ga0070678_100045017 3300005456 Bacteria 3155
36 Ga0070678_100142689 3300005456 Bacteria 1918
37 Ga0070685_10019479 3300005466 Bacteria 3662
38 Ga0070685_10170274 3300005466 Bacteria 1395
39 Ga0070685_10590710 3300005466 Unclassified 798
40 Ga0068853_101143565 3300005539 Bacteria 751
41 Ga0070672_100011626 3300005543 Bacteria 6143
42 Ga0070672_100172277 3300005543 Bacteria 1800
43 Ga0070672_100669365 3300005543 Bacteria 907
44 Ga0070672_101630328 3300005543 Bacteria 579
45 Ga0070686_100015976 3300005544 Bacteria 4359
46 Ga0070686_100413337 3300005544 Unclassified 1029
47 Ga0070693_101188660 3300005547 Bacteria 585
48 Ga0070665_100005165 3300005548 Bacteria 13510
49 Ga0070665_100056085 3300005548 Bacteria 3951
50 Ga0070665_100765897 3300005548 Bacteria 978
51 Ga0070704_100964675 3300005549 Bacteria 770
52 Ga0068857_100138341 3300005577 Bacteria 2200
53 Ga0068857_100296530 3300005577 Bacteria 1490
54 Ga0070702_100162881 3300005615 Bacteria 1443
55 Ga0068859_100024959 3300005617 Bacteria 6000
56 Ga0068859_100607202 3300005617 Bacteria 1187
57 Ga0068859_100792301 3300005617 Unclassified 1036
58 Ga0068864_100030866 3300005618 Bacteria 4544
59 Ga0068866_10641506 3300005718 Bacteria 722
60 Ga0068861_100000765 3300005719 Bacteria 19275
61 Ga0068861_100066266 3300005719 Bacteria 2784
62 Ga0068861_100105483 3300005719 Bacteria 2250
63 Ga0068861_100744941 3300005719 Bacteria 915
64 Ga0068861_101783347 3300005719 Unclassified 610
65 Ga0068870_10063505 3300005840 Bacteria 1992
66 Ga0068870_10369506 3300005840 Bacteria 925
67 Ga0068863_100341958 3300005841 Unclassified 1456
68 Ga0068863_100673953 3300005841 Bacteria 1027
69 Ga0068858_101415543 3300005842 Bacteria 685
70 Ga0068860_100157502 3300005843 Bacteria 2189
71 Ga0068860_101088800 3300005843 Bacteria 818
72 Ga0068862_100065320 3300005844 Bacteria 3134
73 Ga0081455_10002212 3300005937 Bacteria 23167
74 Ga0097621_100042016 3300006237 Bacteria 3682
75 Ga0097621_100057277 3300006237 Bacteria 3186
76 Ga0097621_100176384 3300006237 Bacteria 1845
77 Ga0068871_100007839 3300006358 Bacteria 7651
78 Ga0068871_100058385 3300006358 Bacteria 3141
79 Ga0068871_100328492 3300006358 Unclassified 1348
80 Ga0068871_101361064 3300006358 Unclassified 668
81 Ga0068865_100175742 3300006881 Bacteria 1645
82 Ga0068865_101545476 3300006881 Bacteria 595
83 Ga0097620_100024959 3300006931 Bacteria 6000
84 Ga0097620_100607111 3300006931 Bacteria 1187
85 Ga0097620_100792338 3300006931 Unclassified 1036
86 Ga0105240_10403238 3300009093 Bacteria 1540
87 Ga0111539_10809320 3300009094 Unclassified 1090
88 Ga0105242_12332253 3300009176 Bacteria 582
89 Ga0105248_10113882 3300009177 Bacteria 3050
90 Ga0105238_11609698 3300009551 Bacteria 680
91 Ga0105249_10878132 3300009553 Unclassified 963
92 Ga0157374_11888259 3300013296 Bacteria 623
93 Ga0157375_10530138 3300013308 Unclassified 1340
94 Ga0163163_10366566 3300014325 Unclassified 1497
95 Ga0163163_11412756 3300014325 Unclassified 758
96 Ga0157380_10022020 3300014326 Bacteria 4789
97 Ga0157380_10322825 3300014326 Bacteria 1432
98 Ga0157380_10457640 3300014326 Bacteria 1227
99 Ga0157380_11124080 3300014326 Bacteria 826
100 Ga0157379_10254424 3300014968 Unclassified 1595
101 Ga0157379_11508006 3300014968 Bacteria 654
102 Ga0157379_11690914 3300014968 Bacteria 620
103 Ga0157376_10389070 3300014969 Unclassified 1345
104 Ga0207682_10000689 3300025893 Bacteria 15698
105 Ga0207682_10002094 3300025893 Bacteria 9037
106 Ga0207645_10150211 3300025907 Bacteria 1520
107 Ga0207645_10334600 3300025907 Bacteria 1012
108 Ga0207643_10290577 3300025908 Bacteria 1015
109 Ga0207662_10131090 3300025918 Unclassified 1580
110 Ga0207659_10513882 3300025926 Bacteria 1015
111 Ga0207659_10774987 3300025926 Bacteria 823
112 Ga0207690_11016345 3300025932 Bacteria 690
113 Ga0207706_10135399 3300025933 Bacteria 2167
114 Ga0207670_10007040 3300025936 Bacteria 6262
115 Ga0207669_10095904 3300025937 Bacteria 1945
116 Ga0207669_10107998 3300025937 Bacteria 1857
117 Ga0207704_10384247 3300025938 Bacteria 1103
118 Ga0207704_11293390 3300025938 Unclassified 623
119 Ga0207704_11310768 3300025938 Unclassified 619
120 Ga0207691_10005548 3300025940 Bacteria 12184
121 Ga0207691_10011179 3300025940 Bacteria 8616
122 Ga0207711_10620259 3300025941 Unclassified 1009
123 Ga0207689_10063840 3300025942 Bacteria 3030
124 Ga0207689_10428872 3300025942 Bacteria 1104
125 Ga0207689_10503593 3300025942 Bacteria 1015
126 Ga0207667_10017769 3300025949 Bacteria 7999
127 Ga0207651_10102365 3300025960 Bacteria 2129
128 Ga0207651_10157450 3300025960 Bacteria 1776
129 Ga0207651_10530859 3300025960 Bacteria 1021
130 Ga0207668_10079259 3300025972 Bacteria 2375
131 Ga0207668_10707151 3300025972 Bacteria 886
132 Ga0207640_10653324 3300025981 Unclassified 896
133 Ga0207658_10518387 3300025986 Unclassified 1064
134 Ga0207658_10858222 3300025986 Unclassified 826
135 Ga0207678_11042168 3300026067 Bacteria 724
136 Ga0207708_10007387 3300026075 Bacteria 8122
137 Ga0207708_10062802 3300026075 Bacteria 2837
138 Ga0207708_11381376 3300026075 Bacteria 618
139 Ga0207641_10519225 3300026088 Bacteria 1158
140 Ga0207648_10308863 3300026089 Bacteria 1419
141 Ga0207676_10026563 3300026095 Bacteria 4307
142 Ga0207674_10235345 3300026116 Bacteria 1779
143 Ga0207675_100005020 3300026118 Bacteria 12749
144 Ga0207675_100013062 3300026118 Bacteria 7750
145 Ga0207675_100050235 3300026118 Bacteria 3892
146 Ga0207675_100159819 3300026118 Bacteria 2149
147 Ga0207675_100477596 3300026118 Bacteria 1238
148 Ga0207675_101712626 3300026118 Bacteria 648
149 Ga0207683_10005725 3300026121 Bacteria 10662
150 Ga0207683_10271401 3300026121 Unclassified 1549
151 Ga0268266_10010004 3300028379 Bacteria 8324
152 Ga0268266_10047871 3300028379 Bacteria 3664
153 Ga0268265_10237690 3300028380 Unclassified 1605
154 Ga0307513_10037134 3300031456 Bacteria 5424
155 Ga0307509_10027416 3300031507 Bacteria 6339
156 Ga0307509_10494186 3300031507 Bacteria 909
157 Ga0307408_100177205 3300031548 Bacteria 1706
158 Ga0307408_100893399 3300031548 Unclassified 813
159 Ga0307405_10029838 3300031731 Bacteria 3191
160 Ga0307413_10013694 3300031824 Bacteria 4089
161 Ga0307413_10589515 3300031824 Unclassified 908
162 Ga0307410_10022753 3300031852 Bacteria 3881
163 Ga0307406_10004823 3300031901 Bacteria 7348
164 Ga0307406_10731416 3300031901 Bacteria 829
165 Ga0307407_10402286 3300031903 Unclassified 982
166 Ga0307409_100028143 3300031995 Bacteria 3998
167 Ga0307409_100031946 3300031995 Bacteria 3808
168 Ga0307409_101413836 3300031995 Bacteria 722
169 Ga0307416_100284877 3300032002 Bacteria 1632
170 Ga0307416_100546185 3300032002 Bacteria 1231
171 Ga0307416_100814240 3300032002 Bacteria 1030
172 Ga0307411_10265243 3300032005 Bacteria 1358
173 Ga0451791_0819374 3300041451 Bacteria 1591
174 Ga0451797_0821898 3300041453 Unclassified 806
175 Ga0451795_0797579 3300041456 Bacteria 1561
176 Ga0451800_1585954 3300041459 Unclassified 820
177 Ga0451802_1033210 3300041460 Bacteria 959
178 Ga0451807_2616650 3300041486 Bacteria 1374
179 Ga0451833_0961156 3300041491 Bacteria 822
180 Ga0451837_1679604 3300041494 Bacteria 1744
181 Ga0451845_0669750 3300041501 Bacteria 563
182 Ga0451855_1748730 3300041511 Bacteria 621
183 Ga0451853_0659004 3300041512 Bacteria 680
184 Ga0450906_056699 3300042145 Unclassified 694
185 Ga0451577_0454726 3300042876 Bacteria 1163
186 Ga0495617_142517 3300046452 Unclassified 765
187 Ga0495590_0281049 3300046457 Unclassified 623
188 Ga0495638_0019045 3300046460 Bacteria 4545
189 Ga0495610_0288495 3300046512 Bacteria 637
190 Ga0495616_0001081 3300046513 Bacteria 19363
191 Ga0495632_0044790 3300046519 Bacteria 2207
192 Ga0495668_0213190 3300046616 Bacteria 1057
193 Ga0495668_0305208 3300046616 Unclassified 873
194 Ga0495671_0340401 3300046692 Unclassified 720
195 Ga0495649_0218283 3300046694 Unclassified 987
196 Ga0495686_0067543 3300047472 Bacteria 2207
197 Ga0496104_0079430 3300048907 Bacteria 3127
198 Ga0496105_0179317 3300048908 Bacteria 1735
199 Ga0496114_0036194 3300048917 Bacteria 4080
200 Ga0501032_0473855 3300049569 Bacteria 801
201 Ga0501037_0945014 3300049573 Bacteria 563
202 Ga0501039_0117688 3300049575 Bacteria 2081
203 Ga0501041_0019201 3300049577 Bacteria 4078
204 Ga0501042_0370526 3300049578 Bacteria 1036
205 Ga0501048_0549201 3300049582 Bacteria 829
206 Ga0501068_0502182 3300049584 Bacteria 787
207 Ga0501072_0006305 3300049588 Bacteria 9030
208 Ga0501074_0178903 3300049590 Bacteria 1513
209 Ga0501075_0014294 3300049591 Bacteria 5687
210 Ga0501079_0101557 3300049741 Bacteria 2230
211 Ga0501080_0067911 3300049742 Bacteria 3316
212 Ga0501083_0094306 3300049744 Bacteria 1976
213 Ga0501035_0298165 3300049822 Bacteria 1359
214 Ga0501044_0509587 3300049823 Unclassified 1104
215 Ga0501084_0064640 3300054114 Bacteria 3061
216 Ga0501082_0349195 3300060353 Bacteria 1289
217 Ga0530510_0145023 3300061734 Bacteria 1751
218 Ga0207712_10283677
219 rootH2_10160224
220 rootL2_10095134
221 Ga0070676_10683327
222 Ga0070690_100405756
223 Ga0070670_100320254
224 Ga0070677_10062924
225 Ga0068869_100117751
226 Ga0068869_100370279
227 Ga0068869_100589446
228 Ga0070682_100012247
229 Ga0070682_100039217
230 Ga0070682_100490896
231 Ga0068868_101000414
232 Ga0070689_100005957
233 Ga0070691_10437481
234 Ga0070691_10438934
235 Ga0070692_10327052
236 Ga0070668_100027230
237 Ga0070668_100256624
238 Ga0070669_100701279
239 Ga0070675_100005011
240 Ga0070675_100357246
241 Ga0070675_101297901
242 Ga0070674_100054627
243 Ga0070674_100502980
244 Ga0070673_100088339
245 Ga0070673_100321034
246 Ga0070673_100674357
247 Ga0070688_100738674
248 Ga0070710_10101366
249 Ga0070701_10134539
250 Ga0070700_100562360
251 Ga0070708_101141902
252 Ga0070678_100045017
253 Ga0070678_100142689
254 Ga0070685_10019479
255 Ga0070685_10170274
256 Ga0070685_10590710
257 Ga0068853_101143565
258 Ga0070672_100011626
259 Ga0070672_100172277
260 Ga0070672_100669365
261 Ga0070672_101630328
262 Ga0070686_100015976
263 Ga0070686_100413337
264 Ga0070693_101188660
265 Ga0070665_100005165
266 Ga0070665_100056085
267 Ga0070665_100765897
268 Ga0070704_100964675
269 Ga0068857_100138341
270 Ga0068857_100296530
271 Ga0070702_100162881
272 Ga0068859_100024959
273 Ga0068859_100607202
274 Ga0068859_100792301
275 Ga0068864_100030866
276 Ga0068866_10641506
277 Ga0068861_100000765
278 Ga0068861_100066266
279 Ga0068861_100105483
280 Ga0068861_100744941
281 Ga0068861_101783347
282 Ga0068870_10063505
283 Ga0068870_10369506
284 Ga0068863_100341958
285 Ga0068863_100673953
286 Ga0068858_101415543
287 Ga0068860_100157502
288 Ga0068860_101088800
289 Ga0068862_100065320
290 Ga0081455_10002212
291 Ga0097621_100042016
292 Ga0097621_100057277
293 Ga0097621_100176384
294 Ga0068871_100007839
295 Ga0068871_100058385
296 Ga0068871_100328492
297 Ga0068871_101361064
298 Ga0068865_100175742
299 Ga0068865_101545476
300 Ga0097620_100024959
301 Ga0097620_100607111
302 Ga0097620_100792338
303 Ga0105240_10403238
304 Ga0111539_10809320
305 Ga0105242_12332253
306 Ga0105248_10113882
307 Ga0105238_11609698
308 Ga0105249_10878132
309 Ga0157374_11888259
310 Ga0157375_10530138
311 Ga0163163_10366566
312 Ga0163163_11412756
313 Ga0157380_10022020
314 Ga0157380_10322825
315 Ga0157380_10457640
316 Ga0157380_11124080
317 Ga0157379_10254424
318 Ga0157379_11508006
319 Ga0157379_11690914
320 Ga0157376_10389070
321 Ga0207682_10000689
322 Ga0207682_10002094
323 Ga0207645_10150211
324 Ga0207645_10334600
325 Ga0207643_10290577
326 Ga0207662_10131090
327 Ga0207659_10513882
328 Ga0207659_10774987
329 Ga0207690_11016345
330 Ga0207706_10135399
331 Ga0207670_10007040
332 Ga0207669_10095904
333 Ga0207669_10107998
334 Ga0207704_10384247
335 Ga0207704_11293390
336 Ga0207704_11310768
337 Ga0207691_10005548
338 Ga0207691_10011179
339 Ga0207711_10620259
340 Ga0207689_10063840
341 Ga0207689_10428872
342 Ga0207689_10503593
343 Ga0207667_10017769
344 Ga0207651_10102365
345 Ga0207651_10157450
346 Ga0207651_10530859
347 Ga0207668_10079259
348 Ga0207668_10707151
349 Ga0207640_10653324
350 Ga0207658_10518387
351 Ga0207658_10858222
352 Ga0207678_11042168
353 Ga0207708_10007387
354 Ga0207708_10062802
355 Ga0207708_11381376
356 Ga0207641_10519225
357 Ga0207648_10308863
358 Ga0207676_10026563
359 Ga0207674_10235345
360 Ga0207675_100005020
361 Ga0207675_100013062
362 Ga0207675_100050235
363 Ga0207675_100159819
364 Ga0207675_100477596
365 Ga0207675_101712626
366 Ga0207683_10005725
367 Ga0207683_10271401
368 Ga0268266_10010004
369 Ga0268266_10047871
370 Ga0268265_10237690
371 Ga0307513_10037134
372 Ga0307509_10027416
373 Ga0307509_10494186
374 Ga0307408_100177205
375 Ga0307408_100893399
376 Ga0307405_10029838
377 Ga0307413_10013694
378 Ga0307413_10589515
379 Ga0307410_10022753
380 Ga0307406_10004823
381 Ga0307406_10731416
382 Ga0307407_10402286
383 Ga0307409_100028143
384 Ga0307409_100031946
385 Ga0307409_101413836
386 Ga0307416_100284877
387 Ga0307416_100546185
388 Ga0307416_100814240
389 Ga0307411_10265243
390 Ga0451791_0819374
391 Ga0451797_0821898
392 Ga0451795_0797579
393 Ga0451800_1585954
394 Ga0451802_1033210
395 Ga0451807_2616650
396 Ga0451833_0961156
397 Ga0451837_1679604
398 Ga0451845_0669750
399 Ga0451855_1748730
400 Ga0451853_0659004
401 Ga0450906_056699
402 Ga0451577_0454726
403 Ga0495617_142517
404 Ga0495590_0281049
405 Ga0495638_0019045
406 Ga0495610_0288495
407 Ga0495616_0001081
408 Ga0495632_0044790
409 Ga0495668_0213190
410 Ga0495668_0305208
411 Ga0495671_0340401
412 Ga0495649_0218283
413 Ga0495686_0067543
414 Ga0496104_0079430
415 Ga0496105_0179317
416 Ga0496114_0036194
417 Ga0501032_0473855
418 Ga0501037_0945014
419 Ga0501039_0117688
420 Ga0501041_0019201
421 Ga0501042_0370526
422 Ga0501048_0549201
423 Ga0501068_0502182
424 Ga0501072_0006305
425 Ga0501074_0178903
426 Ga0501075_0014294
427 Ga0501079_0101557
428 Ga0501080_0067911
429 Ga0501083_0094306
430 Ga0501035_0298165
431 Ga0501044_0509587
432 Ga0501084_0064640
433 Ga0501082_0349195
434 Ga0530510_0145023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

31

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.9216 23 149
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.8515 23 148
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.8499 23 148
7tbr-assembly1.cif.gz_A crystal structure of the tpm domain from the rhodothermus marinus protein rhom172_1776 0.8351 30 148
2kpt-assembly1.cif.gz_A solution nmr structure of the n-terminal domain of cg2496 protein from corynebacterium glutamicum. northeast structural genomics consortium target cgr26a 0.7938 23 144
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9216 23 149 3.10.310.50
5anpB00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8515 23 148 3.10.310.50
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8415 21 140 3.10.310.50
af_P9WFJ5_23_159_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8234 23 141 3.10.310.50
af_Q19280_39_210_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7958 43 145 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A2M7NB41-F1-model_v4 TPM domain-containing protein 0.9838 5 122 GO:0016020
AF-A0A257XCI0-F1-model_v4 TPM domain-containing protein 0.9792 1 148 GO:0016020
AF-A0A5C8P4G4-F1-model_v4 TPM domain-containing protein 0.9783 5 151 GO:0016020
AF-A0A349KX52-F1-model_v4 TPM domain-containing protein 0.9766 1 154 GO:0016020
AF-A0A2L0PKJ4-F1-model_v4 TPM domain-containing protein 0.9762 1 152 GO:0016020

Map