F328482

General Info

Members Datasets Scaffolds Average Seq Length
217 140 434 192

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100589545|Ga0070708_1005895451
Length 220
Sequence MRKGLSTCSYSRRDSARLTSLCLLVSALLPSISRAQAPVFEISPPGDSTVTFFVKASVALKGTFGKWDATVTFTSPELTTGVLNIKIQADSVSTGSGMKDGKLKSKDFFDAKQNPLITFHSTKFTQTGPDTIEVDGDFTIRGATKPEKLKFTVTGASIKGTMAFDRKDYGMNKSIPFVTIADRVEVTIDLKGKRVSGPPLDLKQSSAGRKSDDGHALNSY

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
54 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.69
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 27.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100589545 3300005445 Unclassified 1048
2 Ga0068869_100317217 3300005334 Bacteria 1263
3 Ga0068869_100331089 3300005334 Bacteria 1237
4 Ga0068868_100426209 3300005338 Bacteria 1149
5 Ga0070660_100350139 3300005339 Bacteria 1216
6 Ga0070669_100483280 3300005353 Bacteria 1025
7 Ga0070673_100289363 3300005364 Unclassified 1439
8 Ga0070703_10005249 3300005406 Bacteria 3621
9 Ga0070709_10010050 3300005434 Bacteria 5231
10 Ga0070709_10023672 3300005434 Bacteria 3610
11 Ga0070709_10191192 3300005434 Unclassified 1444
12 Ga0070709_10337012 3300005434 Bacteria 1111
13 Ga0070714_100389555 3300005435 Bacteria 1315
14 Ga0070714_100554411 3300005435 Bacteria 1100
15 Ga0070714_100834892 3300005435 Unclassified 893
16 Ga0070713_100000217 3300005436 Bacteria 38064
17 Ga0070713_100519002 3300005436 Unclassified 1125
18 Ga0070710_10034224 3300005437 Unclassified 2763
19 Ga0070710_10368357 3300005437 Bacteria 955
20 Ga0070711_100034057 3300005439 Bacteria 3395
21 Ga0070711_100171134 3300005439 Bacteria 1656
22 Ga0070705_100001218 3300005440 Bacteria 13948
23 Ga0070694_100004084 3300005444 Bacteria 8759
24 Ga0070694_100125491 3300005444 Bacteria 1847
25 Ga0070708_100027035 3300005445 Bacteria 4918
26 Ga0068867_100246074 3300005459 Bacteria 1452
27 Ga0070706_100006139 3300005467 Bacteria 11366
28 Ga0070707_100134101 3300005468 Bacteria 2409
29 Ga0070698_100119958 3300005471 Unclassified 2590
30 Ga0070679_100007816 3300005530 Bacteria 10025
31 Ga0070697_100012813 3300005536 Bacteria 6568
32 Ga0070686_100181650 3300005544 Bacteria 1495
33 Ga0070695_100007692 3300005545 Bacteria 6382
34 Ga0070696_100016209 3300005546 Bacteria 5014
35 Ga0070693_100000917 3300005547 Bacteria 13098
36 Ga0070693_100430824 3300005547 Unclassified 921
37 Ga0070665_100019608 3300005548 Bacteria 6789
38 Ga0070665_100054596 3300005548 Unclassified 4007
39 Ga0070665_100886402 3300005548 Bacteria 905
40 Ga0070704_100046672 3300005549 Unclassified 3023
41 Ga0070704_100185075 3300005549 Bacteria 1669
42 Ga0068855_101250163 3300005563 Unclassified 770
43 Ga0068859_100140758 3300005617 Bacteria 2486
44 Ga0068866_10060699 3300005718 Bacteria 1961
45 Ga0068863_100798730 3300005841 Bacteria 941
46 Ga0068863_101150790 3300005841 Bacteria 781
47 Ga0068860_100012211 3300005843 Bacteria 8462
48 Ga0081540_1012377 3300005983 Bacteria 5626
49 Ga0070717_10022837 3300006028 Bacteria 4950
50 Ga0070717_10177661 3300006028 Bacteria 1854
51 Ga0070715_10192048 3300006163 Bacteria 1031
52 Ga0070716_100004331 3300006173 Bacteria 6769
53 Ga0070716_100324672 3300006173 Unclassified 1080
54 Ga0070712_100007632 3300006175 Bacteria 6767
55 Ga0070712_100008306 3300006175 Bacteria 6525
56 Ga0070712_100016097 3300006175 Bacteria 4826
57 Ga0068871_100514843 3300006358 Bacteria 1080
58 Ga0068871_100672505 3300006358 Bacteria 947
59 Ga0075434_100047432 3300006871 Bacteria 4264
60 Ga0097620_100140756 3300006931 Bacteria 2486
61 Ga0099794_10096221 3300007265 Bacteria 1474
62 Ga0099794_10120490 3300007265 Bacteria 1320
63 Ga0099795_10016430 3300007788 Unclassified 2340
64 Ga0105247_10042666 3300009101 Bacteria 2778
65 Ga0105242_10377556 3300009176 Unclassified 1317
66 Ga0105242_10852484 3300009176 Unclassified 907
67 Ga0105248_10006205 3300009177 Bacteria 13101
68 Ga0105248_11680475 3300009177 Unclassified 720
69 Ga0105239_10137108 3300010375 Bacteria 2724
70 Ga0157378_10003331 3300013297 Bacteria 14290
71 Ga0157378_10465277 3300013297 Bacteria 1257
72 Ga0163162_10018149 3300013306 Bacteria 6889
73 Ga0163162_10116118 3300013306 Bacteria 2777
74 Ga0163162_10135113 3300013306 Bacteria 2577
75 Ga0163162_10486423 3300013306 Bacteria 1365
76 Ga0157375_10041270 3300013308 Bacteria 4454
77 Ga0157375_10377030 3300013308 Bacteria 1585
78 Ga0157375_10688979 3300013308 Bacteria 1176
79 Ga0163163_10738694 3300014325 Bacteria 1048
80 Ga0157379_10041300 3300014968 Bacteria 4118
81 Ga0184600_106278 3300019190 Unclassified 1059
82 Ga0213872_10224364 3300021361 Bacteria 799
83 Ga0224571_105598 3300022734 Bacteria 827
84 Ga0224572_1014474 3300024225 Unclassified 1507
85 Ga0228598_1001509 3300024227 Bacteria 5107
86 Ga0228598_1030784 3300024227 Bacteria 1056
87 Ga0207692_10103702 3300025898 Bacteria 1566
88 Ga0207642_10044763 3300025899 Bacteria 1961
89 Ga0207685_10032807 3300025905 Bacteria 1872
90 Ga0207699_10010697 3300025906 Bacteria 4614
91 Ga0207699_10126314 3300025906 Unclassified 1661
92 Ga0207699_10204261 3300025906 Bacteria 1340
93 Ga0207684_10004450 3300025910 Bacteria 13200
94 Ga0207684_10090089 3300025910 Unclassified 2613
95 Ga0207693_10000056 3300025915 Bacteria 95768
96 Ga0207693_10012943 3300025915 Bacteria 6733
97 Ga0207663_10013980 3300025916 Bacteria 4381
98 Ga0207663_10080528 3300025916 Bacteria 2130
99 Ga0207663_10218918 3300025916 Bacteria 1384
100 Ga0207652_10036119 3300025921 Bacteria 4177
101 Ga0207700_10002460 3300025928 Bacteria 10630
102 Ga0207700_10555339 3300025928 Unclassified 1019
103 Ga0207664_10341628 3300025929 Bacteria 1324
104 Ga0207686_10332566 3300025934 Unclassified 1138
105 Ga0207686_11102457 3300025934 Unclassified 647
106 Ga0207665_10008079 3300025939 Bacteria 6944
107 Ga0207665_10229117 3300025939 Unclassified 1365
108 Ga0207711_10084772 3300025941 Bacteria 2774
109 Ga0207689_10246291 3300025942 Bacteria 1478
110 Ga0207689_10342767 3300025942 Bacteria 1241
111 Ga0207651_10742187 3300025960 Unclassified 867
112 Ga0207641_10543480 3300026088 Bacteria 1132
113 Ga0207676_10262531 3300026095 Bacteria 1560
114 Ga0207683_10727027 3300026121 Unclassified 921
115 Ga0209588_1001487 3300027671 Bacteria 6152
116 Ga0209588_1008607 3300027671 Bacteria 3029
117 Ga0265354_1001290 3300028016 Bacteria 3706
118 Ga0265354_1002362 3300028016 Bacteria 2359
119 Ga0268266_10002256 3300028379 Bacteria 20976
120 Ga0268266_10004840 3300028379 Bacteria 12786
121 Ga0268266_10709158 3300028379 Bacteria 970
122 Ga0268264_10069510 3300028381 Bacteria 2978
123 Ga0265338_10040736 3300028800 Bacteria 4357
124 Ga0265765_1000033 3300030879 Bacteria 6340
125 Ga0265760_10000015 3300031090 Bacteria 91316
126 Ga0265760_10001189 3300031090 Bacteria 7611
127 Ga0265760_10002690 3300031090 Bacteria 5200
128 Ga0265325_10005401 3300031241 Bacteria 7895
129 Ga0265340_10001376 3300031247 Bacteria 13943
130 Ga0316212_1003363 3300033547 Bacteria 2307
131 Ga0316212_1007882 3300033547 Unclassified 1535
132 Ga0373934_0056134 3300035086 Unclassified 1566
133 Ga0373936_0000464 3300035113 Bacteria 13659
134 Ga0373945_0008330 3300035116 Unclassified 3373
135 Ga0373953_0009347 3300035117 Bacteria 3369
136 Ga0373953_0119789 3300035117 Unclassified 1117
137 Ga0373953_0180647 3300035117 Bacteria 910
138 Ga0373954_0103763 3300035118 Unclassified 1372
139 Ga0373956_0100337 3300035119 Bacteria 1342
140 Ga0373956_0313006 3300035119 Bacteria 748
141 Ga0373957_0031939 3300035120 Bacteria 1937
142 Ga0373943_0000168 3300035170 Bacteria 25603
143 Ga0373946_0019442 3300035171 Bacteria 2616
144 Ga0373955_0491055 3300035172 Unclassified 749
145 Ga0373924_0024997 3300035410 Bacteria 2358
146 Ga0373924_0210717 3300035410 Unclassified 858
147 Ga0373924_0254919 3300035410 Unclassified 777
148 Ga0373931_0345087 3300035691 Unclassified 931
149 Ga0373935_0002615 3300035692 Bacteria 10351
150 Ga0373935_0412475 3300035692 Bacteria 971
151 Ga0373927_0000180 3300035695 Bacteria 49813
152 Ga0373933_0009822 3300035724 Bacteria 5237
153 Ga0373933_0019254 3300035724 Bacteria 3853
154 Ga0373933_0147853 3300035724 Unclassified 1486
155 Ga0373947_0004016 3300035725 Bacteria 8641
156 Ga0373947_0114429 3300035725 Unclassified 1708
157 Ga0373937_0004850 3300036401 Bacteria 11431
158 Ga0373937_0022676 3300036401 Bacteria 5647
159 Ga0373937_0163886 3300036401 Unclassified 2084
160 Ga0373937_0386642 3300036401 Bacteria 1327
161 Ga0373925_0004329 3300037068 Bacteria 10743
162 Ga0373925_0004453 3300037068 Bacteria 10588
163 Ga0373925_0065058 3300037068 Unclassified 2746
164 Ga0373925_0279314 3300037068 Bacteria 1345
165 Ga0373925_0415082 3300037068 Bacteria 1099
166 Ga0436363_0233195 3300039450 Unclassified 2330
167 Ga0495653_0239908 3300046463 Bacteria 1209
168 Ga0495650_0011404 3300046471 Bacteria 4872
169 Ga0495580_0091621 3300046472 Unclassified 2115
170 Ga0495580_0147895 3300046472 Unclassified 1628
171 Ga0495580_0162988 3300046472 Unclassified 1543
172 Ga0495580_0236763 3300046472 Unclassified 1252
173 Ga0495582_0010975 3300046473 Bacteria 4986
174 Ga0495662_0343840 3300046476 Bacteria 733
175 Ga0495664_0051124 3300046477 Bacteria 2454
176 Ga0495606_0039875 3300046507 Bacteria 3159
177 Ga0495608_0348761 3300046511 Unclassified 911
178 Ga0495618_0422225 3300046514 Unclassified 813
179 Ga0495628_0173872 3300046516 Unclassified 1632
180 Ga0495628_0198830 3300046516 Bacteria 1511
181 Ga0495630_0070748 3300046517 Bacteria 2625
182 Ga0495630_0186917 3300046517 Bacteria 1581
183 Ga0495666_0050942 3300046526 Bacteria 1990
184 Ga0495652_0405161 3300046529 Unclassified 965
185 Ga0495586_0062007 3300046535 Bacteria 2035
186 Ga0495667_0001059 3300046559 Bacteria 17885
187 Ga0495625_0003099 3300046660 Bacteria 16988
188 Ga0495657_0000804 3300046675 Bacteria 27848
189 Ga0495599_0452464 3300046678 Bacteria 760
190 Ga0495623_0226455 3300046679 Unclassified 1063
191 Ga0495658_0037203 3300046683 Unclassified 2689
192 Ga0495613_0228170 3300046689 Bacteria 1305
193 Ga0495624_0217508 3300046690 Unclassified 1159
194 Ga0495604_0034645 3300047317 Bacteria 3994
195 Ga0495604_0145653 3300047317 Bacteria 1688
196 Ga0495604_0194084 3300047317 Bacteria 1413
197 Ga0495674_0036838 3300047319 Bacteria 4399
198 Ga0495674_0037060 3300047319 Bacteria 4384
199 Ga0495674_0559141 3300047319 Unclassified 910
200 Ga0495684_0189939 3300047471 Unclassified 1519
201 Ga0495686_0070883 3300047472 Bacteria 2147
202 Ga0495602_0063425 3300048088 Unclassified 3202
203 Ga0495602_0097852 3300048088 Unclassified 2416
204 Ga0495602_0152614 3300048088 Bacteria 1813
205 Ga0496100_0600483 3300048903 Bacteria 855
206 Ga0496101_0614936 3300048904 Bacteria 859
207 Ga0496102_0025106 3300048905 Bacteria 5301
208 Ga0496104_0124128 3300048907 Bacteria 2479
209 Ga0496104_0324748 3300048907 Bacteria 1452
210 Ga0496107_0222903 3300048910 Bacteria 1403
211 Ga0496114_0627288 3300048917 Bacteria 947
212 Ga0496115_0052539 3300048918 Bacteria 3269
213 nmdc:mga0n895_156958_c1 3300050512 Unclassified 1588
214 nmdc:mga0n895_915431_c1 3300050512 Unclassified 862
215 nmdc:mga0rr50_876361_c1 3300050513 Unclassified 765
216 Ga0495601_0057894 3300053077 Bacteria 2455
217 Ga0495619_0135303 3300053085 Unclassified 1695
218 Ga0070708_100589545
219 Ga0068869_100317217
220 Ga0068869_100331089
221 Ga0068868_100426209
222 Ga0070660_100350139
223 Ga0070669_100483280
224 Ga0070673_100289363
225 Ga0070703_10005249
226 Ga0070709_10010050
227 Ga0070709_10023672
228 Ga0070709_10191192
229 Ga0070709_10337012
230 Ga0070714_100389555
231 Ga0070714_100554411
232 Ga0070714_100834892
233 Ga0070713_100000217
234 Ga0070713_100519002
235 Ga0070710_10034224
236 Ga0070710_10368357
237 Ga0070711_100034057
238 Ga0070711_100171134
239 Ga0070705_100001218
240 Ga0070694_100004084
241 Ga0070694_100125491
242 Ga0070708_100027035
243 Ga0068867_100246074
244 Ga0070706_100006139
245 Ga0070707_100134101
246 Ga0070698_100119958
247 Ga0070679_100007816
248 Ga0070697_100012813
249 Ga0070686_100181650
250 Ga0070695_100007692
251 Ga0070696_100016209
252 Ga0070693_100000917
253 Ga0070693_100430824
254 Ga0070665_100019608
255 Ga0070665_100054596
256 Ga0070665_100886402
257 Ga0070704_100046672
258 Ga0070704_100185075
259 Ga0068855_101250163
260 Ga0068859_100140758
261 Ga0068866_10060699
262 Ga0068863_100798730
263 Ga0068863_101150790
264 Ga0068860_100012211
265 Ga0081540_1012377
266 Ga0070717_10022837
267 Ga0070717_10177661
268 Ga0070715_10192048
269 Ga0070716_100004331
270 Ga0070716_100324672
271 Ga0070712_100007632
272 Ga0070712_100008306
273 Ga0070712_100016097
274 Ga0068871_100514843
275 Ga0068871_100672505
276 Ga0075434_100047432
277 Ga0097620_100140756
278 Ga0099794_10096221
279 Ga0099794_10120490
280 Ga0099795_10016430
281 Ga0105247_10042666
282 Ga0105242_10377556
283 Ga0105242_10852484
284 Ga0105248_10006205
285 Ga0105248_11680475
286 Ga0105239_10137108
287 Ga0157378_10003331
288 Ga0157378_10465277
289 Ga0163162_10018149
290 Ga0163162_10116118
291 Ga0163162_10135113
292 Ga0163162_10486423
293 Ga0157375_10041270
294 Ga0157375_10377030
295 Ga0157375_10688979
296 Ga0163163_10738694
297 Ga0157379_10041300
298 Ga0184600_106278
299 Ga0213872_10224364
300 Ga0224571_105598
301 Ga0224572_1014474
302 Ga0228598_1001509
303 Ga0228598_1030784
304 Ga0207692_10103702
305 Ga0207642_10044763
306 Ga0207685_10032807
307 Ga0207699_10010697
308 Ga0207699_10126314
309 Ga0207699_10204261
310 Ga0207684_10004450
311 Ga0207684_10090089
312 Ga0207693_10000056
313 Ga0207693_10012943
314 Ga0207663_10013980
315 Ga0207663_10080528
316 Ga0207663_10218918
317 Ga0207652_10036119
318 Ga0207700_10002460
319 Ga0207700_10555339
320 Ga0207664_10341628
321 Ga0207686_10332566
322 Ga0207686_11102457
323 Ga0207665_10008079
324 Ga0207665_10229117
325 Ga0207711_10084772
326 Ga0207689_10246291
327 Ga0207689_10342767
328 Ga0207651_10742187
329 Ga0207641_10543480
330 Ga0207676_10262531
331 Ga0207683_10727027
332 Ga0209588_1001487
333 Ga0209588_1008607
334 Ga0265354_1001290
335 Ga0265354_1002362
336 Ga0268266_10002256
337 Ga0268266_10004840
338 Ga0268266_10709158
339 Ga0268264_10069510
340 Ga0265338_10040736
341 Ga0265765_1000033
342 Ga0265760_10000015
343 Ga0265760_10001189
344 Ga0265760_10002690
345 Ga0265325_10005401
346 Ga0265340_10001376
347 Ga0316212_1003363
348 Ga0316212_1007882
349 Ga0373934_0056134
350 Ga0373936_0000464
351 Ga0373945_0008330
352 Ga0373953_0009347
353 Ga0373953_0119789
354 Ga0373953_0180647
355 Ga0373954_0103763
356 Ga0373956_0100337
357 Ga0373956_0313006
358 Ga0373957_0031939
359 Ga0373943_0000168
360 Ga0373946_0019442
361 Ga0373955_0491055
362 Ga0373924_0024997
363 Ga0373924_0210717
364 Ga0373924_0254919
365 Ga0373931_0345087
366 Ga0373935_0002615
367 Ga0373935_0412475
368 Ga0373927_0000180
369 Ga0373933_0009822
370 Ga0373933_0019254
371 Ga0373933_0147853
372 Ga0373947_0004016
373 Ga0373947_0114429
374 Ga0373937_0004850
375 Ga0373937_0022676
376 Ga0373937_0163886
377 Ga0373937_0386642
378 Ga0373925_0004329
379 Ga0373925_0004453
380 Ga0373925_0065058
381 Ga0373925_0279314
382 Ga0373925_0415082
383 Ga0436363_0233195
384 Ga0495653_0239908
385 Ga0495650_0011404
386 Ga0495580_0091621
387 Ga0495580_0147895
388 Ga0495580_0162988
389 Ga0495580_0236763
390 Ga0495582_0010975
391 Ga0495662_0343840
392 Ga0495664_0051124
393 Ga0495606_0039875
394 Ga0495608_0348761
395 Ga0495618_0422225
396 Ga0495628_0173872
397 Ga0495628_0198830
398 Ga0495630_0070748
399 Ga0495630_0186917
400 Ga0495666_0050942
401 Ga0495652_0405161
402 Ga0495586_0062007
403 Ga0495667_0001059
404 Ga0495625_0003099
405 Ga0495657_0000804
406 Ga0495599_0452464
407 Ga0495623_0226455
408 Ga0495658_0037203
409 Ga0495613_0228170
410 Ga0495624_0217508
411 Ga0495604_0034645
412 Ga0495604_0145653
413 Ga0495604_0194084
414 Ga0495674_0036838
415 Ga0495674_0037060
416 Ga0495674_0559141
417 Ga0495684_0189939
418 Ga0495686_0070883
419 Ga0495602_0063425
420 Ga0495602_0097852
421 Ga0495602_0152614
422 Ga0496100_0600483
423 Ga0496101_0614936
424 Ga0496102_0025106
425 Ga0496104_0124128
426 Ga0496104_0324748
427 Ga0496107_0222903
428 Ga0496114_0627288
429 Ga0496115_0052539
430 nmdc:mga0n895_156958_c1
431 nmdc:mga0n895_915431_c1
432 nmdc:mga0rr50_876361_c1
433 Ga0495601_0057894
434 Ga0495619_0135303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

40

192

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8452 26 180
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8219 25 184
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8206 26 180
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.7833 25 184
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.7828 25 184
ID Description Score Start End Superfamily
af_O53630_1_69_3.10.600.10 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.8064 101 140 3.10.600.10
af_O07742_26_201_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7963 25 184 2.40.128.110
af_Q23554_133_405_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7867 103 140 1.10.510.10
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7861 25 184 2.40.128.110
3hpeB00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7688 25 184 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A841K017-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9018 22 192
AF-A0A1Q7Z0Q9-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.8905 46 190
AF-A0A2V8VI57-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.8852 1 190
AF-A0A841K017-F1-model_v4 Polyisoprenoid-binding protein YceI 0.8818 22 192
AF-A0A1Q7Z0Q9-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.879 46 190

Map