F328398

General Info

Members Datasets Scaffolds Average Seq Length
217 152 434 77

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101491309|Ga0068869_1014913091
Length 85
Sequence MATFTIHEAKTNLSKLIARASAGEEIVIAKGKEPVARLEPIARPAGKRGLAGVLKGKVAPLPDSFFDPLPEEELRLWEGEDEGSR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 92.63
Stem 0
Stem Tuber 0
Unclassified 38.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101491309 3300005334 Unclassified 600
2 Ga0070683_100616016 3300005329 Unclassified 1039
3 Ga0070680_101142290 3300005336 Bacteria 673
4 Ga0068868_101339509 3300005338 Bacteria 666
5 Ga0070668_100753135 3300005347 Bacteria 862
6 Ga0070688_101042759 3300005365 Unclassified 651
7 Ga0070709_10028932 3300005434 Unclassified 3309
8 Ga0070709_10130213 3300005434 Bacteria 1717
9 Ga0070709_10831714 3300005434 Bacteria 726
10 Ga0070714_100900823 3300005435 Unclassified 859
11 Ga0070713_100095674 3300005436 Bacteria 2562
12 Ga0070713_100700575 3300005436 Bacteria 967
13 Ga0070713_102174566 3300005436 Bacteria 538
14 Ga0070710_10407109 3300005437 Unclassified 913
15 Ga0070711_100235576 3300005439 Bacteria 1429
16 Ga0070708_100036616 3300005445 Bacteria 4280
17 Ga0070708_100041594 3300005445 Bacteria 4030
18 Ga0070708_100163197 3300005445 Bacteria 2077
19 Ga0070708_100248173 3300005445 Bacteria 1672
20 Ga0070663_101405102 3300005455 Unclassified 618
21 Ga0070681_10077863 3300005458 Bacteria 3273
22 Ga0070681_10455684 3300005458 Bacteria 1191
23 Ga0070706_100062135 3300005467 Bacteria 3450
24 Ga0070707_100128538 3300005468 Bacteria 2462
25 Ga0070707_100131182 3300005468 Unclassified 2437
26 Ga0070707_100844535 3300005468 Bacteria 880
27 Ga0070699_100664638 3300005518 Bacteria 951
28 Ga0070699_100734330 3300005518 Bacteria 903
29 Ga0070699_102102804 3300005518 Unclassified 516
30 Ga0070679_100380449 3300005530 Bacteria 1358
31 Ga0070697_100093793 3300005536 Bacteria 2486
32 Ga0070697_100122745 3300005536 Bacteria 2174
33 Ga0070697_100810892 3300005536 Unclassified 828
34 Ga0068853_100300488 3300005539 Bacteria 1484
35 Ga0070695_100671001 3300005545 Bacteria 820
36 Ga0070695_100971382 3300005545 Bacteria 689
37 Ga0070693_100001965 3300005547 Bacteria 9407
38 Ga0070665_100027468 3300005548 Bacteria 5733
39 Ga0070665_101296579 3300005548 Bacteria 738
40 Ga0070704_100372893 3300005549 Bacteria 1210
41 Ga0068855_100021893 3300005563 Bacteria 7663
42 Ga0068856_100028086 3300005614 Bacteria 5491
43 Ga0068859_100001106 3300005617 Bacteria 27496
44 Ga0068859_101168034 3300005617 Bacteria 847
45 Ga0068866_11238307 3300005718 Unclassified 540
46 Ga0068863_100579964 3300005841 Bacteria 1109
47 Ga0068858_100440351 3300005842 Bacteria 1255
48 Ga0068860_100148187 3300005843 Bacteria 2259
49 Ga0070717_10080529 3300006028 Bacteria 2733
50 Ga0070717_10290762 3300006028 Unclassified 1451
51 Ga0070717_11339062 3300006028 Unclassified 651
52 Ga0070715_11053599 3300006163 Unclassified 510
53 Ga0070716_100048616 3300006173 Bacteria 2398
54 Ga0070716_100971956 3300006173 Unclassified 670
55 Ga0070712_100178820 3300006175 Bacteria 1651
56 Ga0070712_101159370 3300006175 Unclassified 672
57 Ga0070712_101716437 3300006175 Unclassified 550
58 Ga0097621_101181216 3300006237 Unclassified 720
59 Ga0075431_101712911 3300006847 Bacteria 585
60 Ga0075436_100003305 3300006914 Bacteria 11034
61 Ga0075436_100115158 3300006914 Unclassified 1878
62 Ga0097620_101167980 3300006931 Bacteria 847
63 Ga0075435_100833038 3300007076 Unclassified 804
64 Ga0099794_10018907 3300007265 Bacteria 3096
65 Ga0099794_10046348 3300007265 Bacteria 2082
66 Ga0099794_10179207 3300007265 Unclassified 1081
67 Ga0099794_10333693 3300007265 Unclassified 787
68 Ga0099794_10361205 3300007265 Bacteria 756
69 Ga0099794_10712375 3300007265 Unclassified 535
70 Ga0099795_10024238 3300007788 Unclassified 2021
71 Ga0105240_10062957 3300009093 Bacteria 4617
72 Ga0105240_11716579 3300009093 Unclassified 655
73 Ga0111539_10865538 3300009094 Unclassified 1051
74 Ga0105245_10003012 3300009098 Bacteria 15110
75 Ga0105245_10714727 3300009098 Unclassified 1036
76 Ga0105245_12264792 3300009098 Bacteria 597
77 Ga0105241_12615005 3300009174 Bacteria 507
78 Ga0105248_10066569 3300009177 Bacteria 4045
79 Ga0105248_11942045 3300009177 Bacteria 668
80 Ga0105248_12392809 3300009177 Bacteria 602
81 Ga0105237_10474617 3300009545 Unclassified 1257
82 Ga0105238_10269560 3300009551 Bacteria 1683
83 Ga0157369_10382186 3300013105 Bacteria 1461
84 Ga0157369_10507059 3300013105 Unclassified 1248
85 Ga0157374_10173696 3300013296 Bacteria 2103
86 Ga0157374_12758570 3300013296 Unclassified 519
87 Ga0157378_10173067 3300013297 Unclassified 2026
88 Ga0157378_11608903 3300013297 Unclassified 696
89 Ga0163162_10678263 3300013306 Bacteria 1153
90 Ga0163162_11659560 3300013306 Bacteria 729
91 Ga0157372_10017711 3300013307 Bacteria 7647
92 Ga0157375_10415365 3300013308 Bacteria 1512
93 Ga0163163_10826756 3300014325 Bacteria 990
94 Ga0163163_11849318 3300014325 Bacteria 664
95 Ga0157379_11355290 3300014968 Bacteria 688
96 Ga0157379_11570071 3300014968 Unclassified 642
97 Ga0213875_10001308 3300021388 Bacteria 16507
98 Ga0228598_1000285 3300024227 Bacteria 9788
99 Ga0228598_1027725 3300024227 Unclassified 1114
100 Ga0228598_1101669 3300024227 Unclassified 580
101 Ga0207692_11109105 3300025898 Unclassified 524
102 Ga0207642_10900089 3300025899 Unclassified 567
103 Ga0207642_10911969 3300025899 Unclassified 563
104 Ga0207710_10319188 3300025900 Unclassified 787
105 Ga0207685_10763790 3300025905 Unclassified 530
106 Ga0207699_10001447 3300025906 Bacteria 11271
107 Ga0207699_10660755 3300025906 Unclassified 764
108 Ga0207684_10110023 3300025910 Bacteria 2358
109 Ga0207707_10056203 3300025912 Bacteria 3424
110 Ga0207695_10030410 3300025913 Bacteria 5943
111 Ga0207695_10905826 3300025913 Unclassified 761
112 Ga0207693_10626762 3300025915 Unclassified 836
113 Ga0207663_10222993 3300025916 Unclassified 1373
114 Ga0207660_11600415 3300025917 Bacteria 525
115 Ga0207646_10610459 3300025922 Bacteria 979
116 Ga0207646_11262057 3300025922 Unclassified 646
117 Ga0207681_11388361 3300025923 Unclassified 590
118 Ga0207694_10475385 3300025924 Bacteria 1045
119 Ga0207687_10010630 3300025927 Bacteria 6015
120 Ga0207687_10256806 3300025927 Bacteria 1392
121 Ga0207700_10010235 3300025928 Bacteria 5903
122 Ga0207700_10833667 3300025928 Bacteria 825
123 Ga0207664_10615206 3300025929 Unclassified 976
124 Ga0207706_11484723 3300025933 Unclassified 553
125 Ga0207665_10069517 3300025939 Unclassified 2402
126 Ga0207711_10088874 3300025941 Bacteria 2713
127 Ga0207689_10976543 3300025942 Bacteria 715
128 Ga0207689_10979477 3300025942 Unclassified 713
129 Ga0207667_10021607 3300025949 Bacteria 7130
130 Ga0207658_11152076 3300025986 Bacteria 709
131 Ga0207677_10922093 3300026023 Bacteria 788
132 Ga0207677_11176824 3300026023 Unclassified 701
133 Ga0207703_10574634 3300026035 Bacteria 1064
134 Ga0207703_11612807 3300026035 Unclassified 624
135 Ga0207639_10470439 3300026041 Bacteria 1144
136 Ga0207678_10213770 3300026067 Bacteria 1650
137 Ga0207702_10579999 3300026078 Unclassified 1099
138 Ga0207641_11614524 3300026088 Bacteria 650
139 Ga0209588_1079659 3300027671 Unclassified 1058
140 Ga0265354_1000395 3300028016 Bacteria 7677
141 Ga0268266_10000208 3300028379 Bacteria 102593
142 Ga0268264_10963972 3300028381 Bacteria 858
143 Ga0268264_12468186 3300028381 Unclassified 525
144 Ga0307517_10449536 3300028786 Bacteria 668
145 Ga0265338_10012719 3300028800 Bacteria 9573
146 Ga0265338_10052450 3300028800 Bacteria 3658
147 Ga0265770_1000819 3300030878 Unclassified 4306
148 Ga0265760_10011520 3300031090 Unclassified 2526
149 Ga0265325_10025969 3300031241 Bacteria 3177
150 Ga0265339_10000034 3300031249 Bacteria 125636
151 Ga0265313_10000096 3300031595 Bacteria 89450
152 Ga0316212_1001859 3300033547 Unclassified 2946
153 Ga0373929_0232473 3300035085 Unclassified 528
154 Ga0373956_0042414 3300035119 Unclassified 2023
155 Ga0373931_0029320 3300035691 Bacteria 2824
156 Ga0373935_0226561 3300035692 Unclassified 1300
157 Ga0373927_0881172 3300035695 Unclassified 591
158 Ga0373933_1083496 3300035724 Unclassified 528
159 Ga0373947_0329806 3300035725 Unclassified 1022
160 Ga0373947_0527706 3300035725 Unclassified 803
161 Ga0373937_0489191 3300036401 Bacteria 1169
162 Ga0373925_0463264 3300037068 Unclassified 1039
163 Ga0436364_0265488 3300037853 Bacteria 17133
164 Ga0436364_1552688 3300037853 Bacteria 88862
165 Ga0436365_1059316 3300039437 Bacteria 1103
166 Ga0436363_0122180 3300039450 Bacteria 1683
167 Ga0451839_1614560 3300041496 Bacteria 911
168 Ga0466969_0450671 3300044656 Bacteria 585
169 Ga0466961_0009871 3300044693 Bacteria 6080
170 Ga0466963_0172780 3300044694 Unclassified 1507
171 Ga0466963_0866172 3300044694 Unclassified 637
172 Ga0466957_0000025 3300044842 Bacteria 56192
173 Ga0466958_0278357 3300045836 Bacteria 1072
174 Ga0466958_0561687 3300045836 Unclassified 742
175 Ga0466967_0217733 3300045976 Bacteria 1813
176 Ga0466967_0727022 3300045976 Bacteria 984
177 Ga0466967_1516721 3300045976 Unclassified 667
178 Ga0495629_0490173 3300046459 Unclassified 829
179 Ga0495580_0507505 3300046472 Unclassified 804
180 Ga0495582_0088247 3300046473 Bacteria 1727
181 Ga0495639_0085862 3300046475 Unclassified 1471
182 Ga0495662_0086149 3300046476 Bacteria 1530
183 Ga0495664_0099727 3300046477 Bacteria 1749
184 Ga0495594_0051889 3300046499 Bacteria 2257
185 Ga0495630_0195160 3300046517 Bacteria 1545
186 Ga0495630_0769923 3300046517 Unclassified 735
187 Ga0495586_0587594 3300046535 Unclassified 643
188 Ga0495622_0147690 3300046557 Bacteria 1065
189 Ga0495588_0172975 3300046674 Bacteria 1142
190 Ga0495647_0040747 3300046681 Unclassified 1766
191 Ga0495658_0002064 3300046683 Bacteria 10181
192 Ga0495624_0239588 3300046690 Unclassified 1098
193 Ga0495581_0362079 3300047315 Unclassified 846
194 Ga0495674_0056085 3300047319 Unclassified 3453
195 Ga0495674_0123469 3300047319 Bacteria 2186
196 Ga0495674_0127704 3300047319 Bacteria 2144
197 Ga0495676_0033780 3300047321 Bacteria 4300
198 Ga0495593_0089876 3300047673 Bacteria 1582
199 Ga0495614_0016963 3300048089 Bacteria 3166
200 Ga0496100_0584609 3300048903 Unclassified 866
201 Ga0496102_0155439 3300048905 Bacteria 2150
202 Ga0496110_0048792 3300048913 Bacteria 3712
203 Ga0496111_0014741 3300048914 Bacteria 5348
204 Ga0496113_0644508 3300048916 Bacteria 847
205 Ga0496125_0151283 3300048928 Bacteria 1593
206 Ga0496126_0209524 3300048929 Bacteria 1642
207 Ga0496126_0646040 3300048929 Unclassified 828
208 Ga0495682_0362218 3300049460 Unclassified 511
209 Ga0501034_1164096 3300049571 Bacteria 651
210 Ga0501037_0518180 3300049573 Bacteria 807
211 Ga0501040_0915756 3300049576 Unclassified 635
212 Ga0501080_1672374 3300049742 Bacteria 537
213 nmdc:mga0rr50_177108_c1 3300050513 Bacteria 1741
214 nmdc:mga0rr50_835815_c1 3300050513 Bacteria 785
215 nmdc:mga08x19_101093_c1 3300050514 Bacteria 1913
216 nmdc:mga08x19_1081921_c1 3300050514 Unclassified 569
217 nmdc:mga08x19_2294_c1 3300050514 Bacteria 11620
218 Ga0068869_101491309
219 Ga0070683_100616016
220 Ga0070680_101142290
221 Ga0068868_101339509
222 Ga0070668_100753135
223 Ga0070688_101042759
224 Ga0070709_10028932
225 Ga0070709_10130213
226 Ga0070709_10831714
227 Ga0070714_100900823
228 Ga0070713_100095674
229 Ga0070713_100700575
230 Ga0070713_102174566
231 Ga0070710_10407109
232 Ga0070711_100235576
233 Ga0070708_100036616
234 Ga0070708_100041594
235 Ga0070708_100163197
236 Ga0070708_100248173
237 Ga0070663_101405102
238 Ga0070681_10077863
239 Ga0070681_10455684
240 Ga0070706_100062135
241 Ga0070707_100128538
242 Ga0070707_100131182
243 Ga0070707_100844535
244 Ga0070699_100664638
245 Ga0070699_100734330
246 Ga0070699_102102804
247 Ga0070679_100380449
248 Ga0070697_100093793
249 Ga0070697_100122745
250 Ga0070697_100810892
251 Ga0068853_100300488
252 Ga0070695_100671001
253 Ga0070695_100971382
254 Ga0070693_100001965
255 Ga0070665_100027468
256 Ga0070665_101296579
257 Ga0070704_100372893
258 Ga0068855_100021893
259 Ga0068856_100028086
260 Ga0068859_100001106
261 Ga0068859_101168034
262 Ga0068866_11238307
263 Ga0068863_100579964
264 Ga0068858_100440351
265 Ga0068860_100148187
266 Ga0070717_10080529
267 Ga0070717_10290762
268 Ga0070717_11339062
269 Ga0070715_11053599
270 Ga0070716_100048616
271 Ga0070716_100971956
272 Ga0070712_100178820
273 Ga0070712_101159370
274 Ga0070712_101716437
275 Ga0097621_101181216
276 Ga0075431_101712911
277 Ga0075436_100003305
278 Ga0075436_100115158
279 Ga0097620_101167980
280 Ga0075435_100833038
281 Ga0099794_10018907
282 Ga0099794_10046348
283 Ga0099794_10179207
284 Ga0099794_10333693
285 Ga0099794_10361205
286 Ga0099794_10712375
287 Ga0099795_10024238
288 Ga0105240_10062957
289 Ga0105240_11716579
290 Ga0111539_10865538
291 Ga0105245_10003012
292 Ga0105245_10714727
293 Ga0105245_12264792
294 Ga0105241_12615005
295 Ga0105248_10066569
296 Ga0105248_11942045
297 Ga0105248_12392809
298 Ga0105237_10474617
299 Ga0105238_10269560
300 Ga0157369_10382186
301 Ga0157369_10507059
302 Ga0157374_10173696
303 Ga0157374_12758570
304 Ga0157378_10173067
305 Ga0157378_11608903
306 Ga0163162_10678263
307 Ga0163162_11659560
308 Ga0157372_10017711
309 Ga0157375_10415365
310 Ga0163163_10826756
311 Ga0163163_11849318
312 Ga0157379_11355290
313 Ga0157379_11570071
314 Ga0213875_10001308
315 Ga0228598_1000285
316 Ga0228598_1027725
317 Ga0228598_1101669
318 Ga0207692_11109105
319 Ga0207642_10900089
320 Ga0207642_10911969
321 Ga0207710_10319188
322 Ga0207685_10763790
323 Ga0207699_10001447
324 Ga0207699_10660755
325 Ga0207684_10110023
326 Ga0207707_10056203
327 Ga0207695_10030410
328 Ga0207695_10905826
329 Ga0207693_10626762
330 Ga0207663_10222993
331 Ga0207660_11600415
332 Ga0207646_10610459
333 Ga0207646_11262057
334 Ga0207681_11388361
335 Ga0207694_10475385
336 Ga0207687_10010630
337 Ga0207687_10256806
338 Ga0207700_10010235
339 Ga0207700_10833667
340 Ga0207664_10615206
341 Ga0207706_11484723
342 Ga0207665_10069517
343 Ga0207711_10088874
344 Ga0207689_10976543
345 Ga0207689_10979477
346 Ga0207667_10021607
347 Ga0207658_11152076
348 Ga0207677_10922093
349 Ga0207677_11176824
350 Ga0207703_10574634
351 Ga0207703_11612807
352 Ga0207639_10470439
353 Ga0207678_10213770
354 Ga0207702_10579999
355 Ga0207641_11614524
356 Ga0209588_1079659
357 Ga0265354_1000395
358 Ga0268266_10000208
359 Ga0268264_10963972
360 Ga0268264_12468186
361 Ga0307517_10449536
362 Ga0265338_10012719
363 Ga0265338_10052450
364 Ga0265770_1000819
365 Ga0265760_10011520
366 Ga0265325_10025969
367 Ga0265339_10000034
368 Ga0265313_10000096
369 Ga0316212_1001859
370 Ga0373929_0232473
371 Ga0373956_0042414
372 Ga0373931_0029320
373 Ga0373935_0226561
374 Ga0373927_0881172
375 Ga0373933_1083496
376 Ga0373947_0329806
377 Ga0373947_0527706
378 Ga0373937_0489191
379 Ga0373925_0463264
380 Ga0436364_0265488
381 Ga0436364_1552688
382 Ga0436365_1059316
383 Ga0436363_0122180
384 Ga0451839_1614560
385 Ga0466969_0450671
386 Ga0466961_0009871
387 Ga0466963_0172780
388 Ga0466963_0866172
389 Ga0466957_0000025
390 Ga0466958_0278357
391 Ga0466958_0561687
392 Ga0466967_0217733
393 Ga0466967_0727022
394 Ga0466967_1516721
395 Ga0495629_0490173
396 Ga0495580_0507505
397 Ga0495582_0088247
398 Ga0495639_0085862
399 Ga0495662_0086149
400 Ga0495664_0099727
401 Ga0495594_0051889
402 Ga0495630_0195160
403 Ga0495630_0769923
404 Ga0495586_0587594
405 Ga0495622_0147690
406 Ga0495588_0172975
407 Ga0495647_0040747
408 Ga0495658_0002064
409 Ga0495624_0239588
410 Ga0495581_0362079
411 Ga0495674_0056085
412 Ga0495674_0123469
413 Ga0495674_0127704
414 Ga0495676_0033780
415 Ga0495593_0089876
416 Ga0495614_0016963
417 Ga0496100_0584609
418 Ga0496102_0155439
419 Ga0496110_0048792
420 Ga0496111_0014741
421 Ga0496113_0644508
422 Ga0496125_0151283
423 Ga0496126_0209524
424 Ga0496126_0646040
425 Ga0495682_0362218
426 Ga0501034_1164096
427 Ga0501037_0518180
428 Ga0501040_0915756
429 Ga0501080_1672374
430 nmdc:mga0rr50_177108_c1
431 nmdc:mga0rr50_835815_c1
432 nmdc:mga08x19_101093_c1
433 nmdc:mga08x19_1081921_c1
434 nmdc:mga08x19_2294_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

1

43

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odk-assembly2.cif.gz_D putative prevent-host-death protein from nitrosomonas europaea 0.9055 1 42
4zlx-assembly1.cif.gz_B n-terminal dna binding domain of the antitoxin phd from phage p1 0.8652 2 41
4zm2-assembly2.cif.gz_D antitoxin phd from phage p1 in complex with its operator dna inverted repeat in a monoclinic space group 0.8606 2 42
3k33-assembly1.cif.gz_C-2 crystal structure of the phd-doc complex 0.8485 2 42
3kh2-assembly1.cif.gz_E crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386 0.8485 3 42
ID Description Score Start End Superfamily
af_P9WF13_12_52_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.9053 2 42 3.40.1620.10
2odkA00 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.9024 3 42 3.40.1620.10
af_P9WF13_12_52_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8865 2 42 3.40.1620.10
4zlxA00 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8665 2 41 3.40.1620.10
af_P9WF17_1_43_3.40.1620.10 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;YefM-like domain 0.8517 1 43 3.40.1620.10
ID Description Score Start End GO Terms
AF-A0A6B0XVC5-F1-model_v4 Antitoxin 0.9773 2 41
AF-A0A1B9C216-F1-model_v4 Antitoxin 0.9711 1 40
AF-A0A386E865-F1-model_v4 deleted 0.9551 1 43
AF-A0A2W6W4W9-F1-model_v4 deleted 0.9415 1 43
AF-A0A5B8J4S7-F1-model_v4 Antitoxin 0.9279 1 41

Map