F328103

General Info

Members Datasets Scaffolds Average Seq Length
216 139 432 254

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_142189_c1|nmdc:mga00v17_142189_c1_63_986
Length 307
Sequence MRLDTHRVKFARAIRMSPATHRRAARRSVEAGAWRPPPLSGDTRGLIVDVHLTDFVTIGLLVLLEGLLSADNALVLAVLVLGLPRAEQKKALRYGIVGAFAFRALATALAAYLIDVAWVKLVGAAYLLYLPYAHFTEKPEEGQKRTFKPARPWLGLSAFWATVVKVEFTDIVFAIDSILVAVAMSNKLWVIITGGILGIIAMRMLIGQLLTFVQRYPPLVDGAFIIIAWVGIKLLIEYLHQLHFIGFEVPRWLSLGLIVLIFTGAYAYARRVGAVEVADDGPPDAAEALFTEPDPEPDVTPASGDGR

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0
Rhizoplane 0.46
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 9.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_142189_c1 3300050491 Bacteria 1539
2 Ga0065712_10207706 3300005290 Unclassified 1084
3 Ga0065715_10189471 3300005293 Bacteria 1424
4 Ga0070670_100013697 3300005331 Bacteria 6950
5 Ga0070670_100033357 3300005331 Bacteria 4433
6 Ga0070689_100074243 3300005340 Bacteria 2661
7 Ga0070668_100072443 3300005347 Bacteria 2684
8 Ga0070675_100042755 3300005354 Bacteria 3703
9 Ga0070671_100018312 3300005355 Bacteria 5688
10 Ga0070674_100010675 3300005356 Bacteria 5565
11 Ga0070674_100464316 3300005356 Bacteria 1047
12 Ga0070673_100222227 3300005364 Bacteria 1635
13 Ga0070688_100173348 3300005365 Bacteria 1491
14 Ga0070688_100220972 3300005365 Bacteria 1335
15 Ga0070714_100010789 3300005435 Bacteria 7232
16 Ga0070713_100471081 3300005436 Bacteria 1182
17 Ga0070681_10025701 3300005458 Bacteria 5921
18 Ga0068867_100035704 3300005459 Bacteria 3606
19 Ga0070706_100372380 3300005467 Bacteria 1331
20 Ga0070698_100005765 3300005471 Bacteria 13542
21 Ga0070699_100012499 3300005518 Bacteria 7326
22 Ga0070699_100441552 3300005518 Unclassified 1179
23 Ga0070679_100035194 3300005530 Bacteria 4968
24 Ga0070679_100075349 3300005530 Bacteria 3364
25 Ga0070684_100424736 3300005535 Unclassified 1227
26 Ga0070684_100645951 3300005535 Bacteria 985
27 Ga0070697_100374180 3300005536 Bacteria 1233
28 Ga0070697_100593834 3300005536 Unclassified 973
29 Ga0070672_100093527 3300005543 Bacteria 2429
30 Ga0070695_100080010 3300005545 Bacteria 2158
31 Ga0070696_100614774 3300005546 Unclassified 877
32 Ga0070704_100004800 3300005549 Bacteria 7829
33 Ga0070664_100109373 3300005564 Bacteria 2411
34 Ga0068854_100180275 3300005578 Bacteria 1650
35 Ga0068864_100555705 3300005618 Bacteria 1110
36 Ga0068866_10160023 3300005718 Unclassified 1312
37 Ga0068861_100375484 3300005719 Bacteria 1254
38 Ga0068863_100050015 3300005841 Bacteria 3964
39 Ga0068858_100017019 3300005842 Bacteria 6826
40 Ga0081538_10080852 3300005981 Bacteria 1731
41 Ga0075368_10120649 3300006042 Bacteria 1085
42 Ga0075363_100015403 3300006048 Bacteria 3758
43 Ga0075364_10100210 3300006051 Bacteria 1928
44 Ga0075432_10062909 3300006058 Bacteria 1324
45 Ga0075367_10047925 3300006178 Bacteria 2515
46 Ga0075366_10077310 3300006195 Bacteria 1986
47 Ga0075370_10026909 3300006353 Bacteria 3188
48 Ga0075370_10038654 3300006353 Bacteria 2686
49 Ga0068871_100454886 3300006358 Bacteria 1148
50 Ga0075428_100000010 3300006844 Bacteria 213631
51 Ga0075430_100002851 3300006846 Bacteria 14473
52 Ga0075430_100209807 3300006846 Bacteria 1616
53 Ga0075430_100284501 3300006846 Bacteria 1368
54 Ga0075430_100363579 3300006846 Unclassified 1195
55 Ga0075431_100076716 3300006847 Bacteria 3449
56 Ga0075433_10095091 3300006852 Bacteria 2637
57 Ga0075434_100002119 3300006871 Bacteria 17262
58 Ga0075434_100073591 3300006871 Bacteria 3409
59 Ga0075434_100078662 3300006871 Bacteria 3293
60 Ga0075429_100019593 3300006880 Bacteria 5865
61 Ga0075436_100011621 3300006914 Bacteria 6042
62 Ga0075436_100048566 3300006914 Bacteria 2928
63 Ga0075436_100094482 3300006914 Bacteria 2079
64 Ga0097620_100057689 3300006931 Bacteria 3911
65 Ga0097620_100292221 3300006931 Bacteria 1723
66 Ga0075435_100003596 3300007076 Bacteria 10542
67 Ga0075435_100038179 3300007076 Bacteria 3829
68 Ga0075435_100066230 3300007076 Bacteria 2938
69 Ga0075435_100168556 3300007076 Bacteria 1847
70 Ga0075435_100197765 3300007076 Bacteria 1703
71 Ga0105240_10154385 3300009093 Bacteria 2732
72 Ga0111539_10000001 3300009094 Bacteria 1035431
73 Ga0111539_10102800 3300009094 Bacteria 3353
74 Ga0105247_10377853 3300009101 Bacteria 1004
75 Ga0114129_10005462 3300009147 Bacteria 17965
76 Ga0114129_10028693 3300009147 Bacteria 7884
77 Ga0114129_10319849 3300009147 Bacteria 2063
78 Ga0114129_10364341 3300009147 Bacteria 1912
79 Ga0114129_10378520 3300009147 Bacteria 1870
80 Ga0114129_10821095 3300009147 Bacteria 1184
81 Ga0105243_10008910 3300009148 Bacteria 7673
82 Ga0105248_10035461 3300009177 Bacteria 5580
83 Ga0105238_10274943 3300009551 Bacteria 1665
84 Ga0105249_10070700 3300009553 Bacteria 3222
85 Ga0105249_10291126 3300009553 Bacteria 1634
86 Ga0157369_10083341 3300013105 Bacteria 3420
87 Ga0157374_10067763 3300013296 Bacteria 3356
88 Ga0163163_10090945 3300014325 Bacteria 3065
89 Ga0163163_10681596 3300014325 Bacteria 1091
90 Ga0157380_10263213 3300014326 Bacteria 1568
91 Ga0157380_10445356 3300014326 Bacteria 1242
92 Ga0157379_10007994 3300014968 Bacteria 9172
93 Ga0207682_10031096 3300025893 Bacteria 2141
94 Ga0207682_10138452 3300025893 Bacteria 1091
95 Ga0207699_10364599 3300025906 Bacteria 1022
96 Ga0207707_10064532 3300025912 Bacteria 3188
97 Ga0207695_10109509 3300025913 Bacteria 2744
98 Ga0207695_10785757 3300025913 Bacteria 832
99 Ga0207662_10155925 3300025918 Bacteria 1456
100 Ga0207657_10206122 3300025919 Unclassified 1580
101 Ga0207646_10334504 3300025922 Bacteria 1368
102 Ga0207646_10394368 3300025922 Bacteria 1250
103 Ga0207681_10278196 3300025923 Bacteria 1317
104 Ga0207650_10009681 3300025925 Bacteria 6587
105 Ga0207650_10080345 3300025925 Bacteria 2472
106 Ga0207659_10149138 3300025926 Bacteria 1824
107 Ga0207664_10242189 3300025929 Bacteria 1571
108 Ga0207644_10093987 3300025931 Bacteria 2239
109 Ga0207690_10177887 3300025932 Unclassified 1599
110 Ga0207706_10478530 3300025933 Bacteria 1076
111 Ga0207669_10006952 3300025937 Bacteria 5206
112 Ga0207691_10048263 3300025940 Bacteria 3904
113 Ga0207691_10182213 3300025940 Unclassified 1835
114 Ga0207711_10116074 3300025941 Bacteria 2386
115 Ga0207661_10061608 3300025944 Bacteria 3032
116 Ga0207661_10362377 3300025944 Bacteria 1310
117 Ga0207661_10470959 3300025944 Bacteria 1146
118 Ga0207679_10119963 3300025945 Bacteria 2092
119 Ga0207679_10177529 3300025945 Bacteria 1759
120 Ga0207651_10127790 3300025960 Unclassified 1940
121 Ga0207651_10182202 3300025960 Bacteria 1667
122 Ga0207668_10050074 3300025972 Bacteria 2876
123 Ga0207640_10137037 3300025981 Bacteria 1778
124 Ga0207677_10198447 3300026023 Bacteria 1593
125 Ga0207703_10337285 3300026035 Bacteria 1384
126 Ga0207641_10170163 3300026088 Bacteria 1988
127 Ga0207641_10588930 3300026088 Bacteria 1088
128 Ga0207648_10104057 3300026089 Bacteria 2489
129 Ga0207676_10568370 3300026095 Bacteria 1085
130 Ga0207675_100122272 3300026118 Bacteria 2464
131 Ga0207683_10044583 3300026121 Bacteria 3877
132 Ga0207428_10000002 3300027907 Bacteria 854851
133 Ga0207428_10003324 3300027907 Bacteria 15634
134 Ga0268266_10176887 3300028379 Bacteria 1940
135 Ga0307410_10204439 3300031852 Unclassified 1510
136 Ga0307410_10262297 3300031852 Bacteria 1348
137 Ga0307406_10055745 3300031901 Bacteria 2528
138 Ga0307412_10207355 3300031911 Bacteria 1493
139 Ga0307409_100152425 3300031995 Bacteria 2009
140 Ga0307409_100253992 3300031995 Bacteria 1609
141 Ga0307416_100187212 3300032002 Bacteria 1947
142 Ga0307416_100493056 3300032002 Unclassified 1288
143 Ga0307416_100645519 3300032002 Bacteria 1143
144 Ga0307411_10007614 3300032005 Bacteria 5539
145 Ga0307411_10359436 3300032005 Bacteria 1190
146 Ga0373954_0069612 3300035118 Bacteria 1671
147 Ga0373931_0078701 3300035691 Bacteria 1814
148 Ga0450920_002533 3300042122 Bacteria 3117
149 Ga0439464_0002978 3300042439 Bacteria 4230
150 Ga0466967_0073827 3300045976 Bacteria 3061
151 Ga0495638_0005681 3300046460 Bacteria 9192
152 Ga0495584_0121999 3300046491 Bacteria 1320
153 Ga0495659_0021302 3300046664 Bacteria 2183
154 Ga0495669_0103983 3300046684 Unclassified 1321
155 Ga0496104_0375746 3300048907 Unclassified 1334
156 Ga0501290_008245 3300049513 Unclassified 1314
157 Ga0501031_0064600 3300049568 Bacteria 2384
158 Ga0501031_0116234 3300049568 Bacteria 1748
159 Ga0501034_0262369 3300049571 Unclassified 1670
160 Ga0501042_0007559 3300049578 Bacteria 7131
161 Ga0501042_0113840 3300049578 Bacteria 1948
162 Ga0501048_0141189 3300049582 Bacteria 1703
163 Ga0501071_0013068 3300049587 Bacteria 5651
164 Ga0501071_0419278 3300049587 Bacteria 1023
165 Ga0501072_0061811 3300049588 Bacteria 2954
166 Ga0501072_0420084 3300049588 Bacteria 1060
167 Ga0501073_0376517 3300049589 Bacteria 981
168 Ga0501075_0366308 3300049591 Bacteria 1098
169 Ga0501077_0129973 3300049593 Bacteria 1597
170 Ga0501233_020529 3300049668 Bacteria 1411
171 Ga0501079_0111671 3300049741 Unclassified 2124
172 Ga0501079_0453515 3300049741 Bacteria 1007
173 Ga0501080_0224100 3300049742 Unclassified 1720
174 Ga0501045_0369671 3300049824 Bacteria 1067
175 nmdc:mga06z11_112925_c1 3300050494 Bacteria 1507
176 nmdc:mga06z11_29219_c1 3300050494 Bacteria 2653
177 nmdc:mga06z11_30792_c1 3300050494 Bacteria 2600
178 nmdc:mga06z11_82901_c1 3300050494 Bacteria 1725
179 nmdc:mga07m45_169913_c1 3300050496 Bacteria 1267
180 nmdc:mga07m45_25497_c1 3300050496 Bacteria 3243
181 nmdc:mga05p37_1148_c1 3300050507 Bacteria 30482
182 nmdc:mga05p37_19472_c1 3300050507 Bacteria 8210
183 nmdc:mga05p37_241716_c1 3300050507 Bacteria 2170
184 nmdc:mga05p37_272330_c1 3300050507 Bacteria 2022
185 nmdc:mga05p37_378545_c1 3300050507 Unclassified 1659
186 nmdc:mga05p37_55930_c1 3300050507 Bacteria 4857
187 nmdc:mga09592_41622_c1 3300050508 Bacteria 3863
188 nmdc:mga09592_80760_c1 3300050508 Unclassified 2769
189 nmdc:mga0qj67_8503_c1 3300050509 Bacteria 7616
190 nmdc:mga06r32_29050_c1 3300050510 Bacteria 5178
191 nmdc:mga08y16_156_c1 3300050511 Bacteria 59323
192 nmdc:mga08y16_30610_c1 3300050511 Bacteria 5663
193 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
194 nmdc:mga0n895_102685_c1 3300050512 Bacteria 2870
195 nmdc:mga0n895_255376_c1 3300050512 Bacteria 1779
196 nmdc:mga0n895_257602_c1 3300050512 Bacteria 1771
197 nmdc:mga0n895_257870_c1 3300050512 Bacteria 1770
198 nmdc:mga0n895_618169_c1 3300050512 Bacteria 1085
199 nmdc:mga0n895_96553_c1 3300050512 Bacteria 2961
200 nmdc:mga0rr50_1072_c1 3300050513 Bacteria 14885
201 nmdc:mga0rr50_15930_c1 3300050513 Bacteria 4976
202 nmdc:mga0rr50_22552_c1 3300050513 Bacteria 4324
203 nmdc:mga0rr50_43063_c1 3300050513 Bacteria 3301
204 nmdc:mga08x19_2366_c1 3300050514 Bacteria 11427
205 nmdc:mga08x19_37774_c1 3300050514 Bacteria 3066
206 nmdc:mga0a205_220597_c1 3300050515 Bacteria 1782
207 nmdc:mga0a205_306480_c1 3300050515 Bacteria 1460
208 nmdc:mga0a205_331933_c1 3300050515 Bacteria 1390
209 nmdc:mga0a205_6930_c1 3300050515 Bacteria 9856
210 Ga0501084_0251824 3300054114 Bacteria 1491
211 Ga0501084_0327459 3300054114 Bacteria 1294
212 Ga0590071_000003 3300059421 Bacteria 75639
213 Ga0590071_000209 3300059421 Bacteria 17299
214 Ga0590075_000088 3300059424 Bacteria 23833
215 Ga0590075_000678 3300059424 Bacteria 9063
216 Ga0590077_000016 3300059426 Bacteria 38540
217 nmdc:mga00v17_142189_c1
218 Ga0065712_10207706
219 Ga0065715_10189471
220 Ga0070670_100013697
221 Ga0070670_100033357
222 Ga0070689_100074243
223 Ga0070668_100072443
224 Ga0070675_100042755
225 Ga0070671_100018312
226 Ga0070674_100010675
227 Ga0070674_100464316
228 Ga0070673_100222227
229 Ga0070688_100173348
230 Ga0070688_100220972
231 Ga0070714_100010789
232 Ga0070713_100471081
233 Ga0070681_10025701
234 Ga0068867_100035704
235 Ga0070706_100372380
236 Ga0070698_100005765
237 Ga0070699_100012499
238 Ga0070699_100441552
239 Ga0070679_100035194
240 Ga0070679_100075349
241 Ga0070684_100424736
242 Ga0070684_100645951
243 Ga0070697_100374180
244 Ga0070697_100593834
245 Ga0070672_100093527
246 Ga0070695_100080010
247 Ga0070696_100614774
248 Ga0070704_100004800
249 Ga0070664_100109373
250 Ga0068854_100180275
251 Ga0068864_100555705
252 Ga0068866_10160023
253 Ga0068861_100375484
254 Ga0068863_100050015
255 Ga0068858_100017019
256 Ga0081538_10080852
257 Ga0075368_10120649
258 Ga0075363_100015403
259 Ga0075364_10100210
260 Ga0075432_10062909
261 Ga0075367_10047925
262 Ga0075366_10077310
263 Ga0075370_10026909
264 Ga0075370_10038654
265 Ga0068871_100454886
266 Ga0075428_100000010
267 Ga0075430_100002851
268 Ga0075430_100209807
269 Ga0075430_100284501
270 Ga0075430_100363579
271 Ga0075431_100076716
272 Ga0075433_10095091
273 Ga0075434_100002119
274 Ga0075434_100073591
275 Ga0075434_100078662
276 Ga0075429_100019593
277 Ga0075436_100011621
278 Ga0075436_100048566
279 Ga0075436_100094482
280 Ga0097620_100057689
281 Ga0097620_100292221
282 Ga0075435_100003596
283 Ga0075435_100038179
284 Ga0075435_100066230
285 Ga0075435_100168556
286 Ga0075435_100197765
287 Ga0105240_10154385
288 Ga0111539_10000001
289 Ga0111539_10102800
290 Ga0105247_10377853
291 Ga0114129_10005462
292 Ga0114129_10028693
293 Ga0114129_10319849
294 Ga0114129_10364341
295 Ga0114129_10378520
296 Ga0114129_10821095
297 Ga0105243_10008910
298 Ga0105248_10035461
299 Ga0105238_10274943
300 Ga0105249_10070700
301 Ga0105249_10291126
302 Ga0157369_10083341
303 Ga0157374_10067763
304 Ga0163163_10090945
305 Ga0163163_10681596
306 Ga0157380_10263213
307 Ga0157380_10445356
308 Ga0157379_10007994
309 Ga0207682_10031096
310 Ga0207682_10138452
311 Ga0207699_10364599
312 Ga0207707_10064532
313 Ga0207695_10109509
314 Ga0207695_10785757
315 Ga0207662_10155925
316 Ga0207657_10206122
317 Ga0207646_10334504
318 Ga0207646_10394368
319 Ga0207681_10278196
320 Ga0207650_10009681
321 Ga0207650_10080345
322 Ga0207659_10149138
323 Ga0207664_10242189
324 Ga0207644_10093987
325 Ga0207690_10177887
326 Ga0207706_10478530
327 Ga0207669_10006952
328 Ga0207691_10048263
329 Ga0207691_10182213
330 Ga0207711_10116074
331 Ga0207661_10061608
332 Ga0207661_10362377
333 Ga0207661_10470959
334 Ga0207679_10119963
335 Ga0207679_10177529
336 Ga0207651_10127790
337 Ga0207651_10182202
338 Ga0207668_10050074
339 Ga0207640_10137037
340 Ga0207677_10198447
341 Ga0207703_10337285
342 Ga0207641_10170163
343 Ga0207641_10588930
344 Ga0207648_10104057
345 Ga0207676_10568370
346 Ga0207675_100122272
347 Ga0207683_10044583
348 Ga0207428_10000002
349 Ga0207428_10003324
350 Ga0268266_10176887
351 Ga0307410_10204439
352 Ga0307410_10262297
353 Ga0307406_10055745
354 Ga0307412_10207355
355 Ga0307409_100152425
356 Ga0307409_100253992
357 Ga0307416_100187212
358 Ga0307416_100493056
359 Ga0307416_100645519
360 Ga0307411_10007614
361 Ga0307411_10359436
362 Ga0373954_0069612
363 Ga0373931_0078701
364 Ga0450920_002533
365 Ga0439464_0002978
366 Ga0466967_0073827
367 Ga0495638_0005681
368 Ga0495584_0121999
369 Ga0495659_0021302
370 Ga0495669_0103983
371 Ga0496104_0375746
372 Ga0501290_008245
373 Ga0501031_0064600
374 Ga0501031_0116234
375 Ga0501034_0262369
376 Ga0501042_0007559
377 Ga0501042_0113840
378 Ga0501048_0141189
379 Ga0501071_0013068
380 Ga0501071_0419278
381 Ga0501072_0061811
382 Ga0501072_0420084
383 Ga0501073_0376517
384 Ga0501075_0366308
385 Ga0501077_0129973
386 Ga0501233_020529
387 Ga0501079_0111671
388 Ga0501079_0453515
389 Ga0501080_0224100
390 Ga0501045_0369671
391 nmdc:mga06z11_112925_c1
392 nmdc:mga06z11_29219_c1
393 nmdc:mga06z11_30792_c1
394 nmdc:mga06z11_82901_c1
395 nmdc:mga07m45_169913_c1
396 nmdc:mga07m45_25497_c1
397 nmdc:mga05p37_1148_c1
398 nmdc:mga05p37_19472_c1
399 nmdc:mga05p37_241716_c1
400 nmdc:mga05p37_272330_c1
401 nmdc:mga05p37_378545_c1
402 nmdc:mga05p37_55930_c1
403 nmdc:mga09592_41622_c1
404 nmdc:mga09592_80760_c1
405 nmdc:mga0qj67_8503_c1
406 nmdc:mga06r32_29050_c1
407 nmdc:mga08y16_156_c1
408 nmdc:mga08y16_30610_c1
409 nmdc:mga08y16_3_c1
410 nmdc:mga0n895_102685_c1
411 nmdc:mga0n895_255376_c1
412 nmdc:mga0n895_257602_c1
413 nmdc:mga0n895_257870_c1
414 nmdc:mga0n895_618169_c1
415 nmdc:mga0n895_96553_c1
416 nmdc:mga0rr50_1072_c1
417 nmdc:mga0rr50_15930_c1
418 nmdc:mga0rr50_22552_c1
419 nmdc:mga0rr50_43063_c1
420 nmdc:mga08x19_2366_c1
421 nmdc:mga08x19_37774_c1
422 nmdc:mga0a205_220597_c1
423 nmdc:mga0a205_306480_c1
424 nmdc:mga0a205_331933_c1
425 nmdc:mga0a205_6930_c1
426 Ga0501084_0251824
427 Ga0501084_0327459
428 Ga0590071_000003
429 Ga0590071_000209
430 Ga0590075_000088
431 Ga0590075_000678
432 Ga0590077_000016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

59

238

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4006 15 204
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3832 16 204
4pyp-assembly1.cif.gz_A crystal structure of the human glucose transporter glut1 0.3639 16 215
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.3608 22 203
4ybq-assembly2.cif.gz_B rat glut5 with fv in the outward-open form 0.3513 2 205
ID Description Score Start End Superfamily
af_Q1W0R3_258_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4919 19 199 1.20.1250.20
af_Q1W0R3_258_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4622 19 199 1.20.1250.20
af_P32135_206_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4612 4 209 1.20.1250.20
af_P32135_206_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4469 4 209 1.20.1250.20
af_Q4DA26_40_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4341 14 205 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A843RWC7-F1-model_v4 DUF475 domain-containing protein 0.9443 14 237 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.919 14 245 GO:0016020
AF-A0A3N5XSW7-F1-model_v4 TerC family protein 0.9093 14 241 GO:0016020
AF-A0A7V7X4T7-F1-model_v4 DUF475 domain-containing protein 0.9076 14 245 GO:0016020
AF-A0A7V8M8P4-F1-model_v4 deleted 0.8355 22 247

Map