F328013

General Info

Members Datasets Scaffolds Average Seq Length
216 150 432 301

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0114224|Ga0496108_0114224_774_1772
Length 332
Sequence MPQRGRTGPGDLINNQDSGAAAPAGGCVQLEGVYSVLPTPFTATGEVDDDSLRRVVDLFIGAGVNGVTVLGVTGEVARLDDGERQHVLEVVTSHVNGRIGVVAGTTAEGTRTCIGYCRNAKAAGATAVMVSPPRMPKLNSEAVVRHYHALAEAVDIEIVVQDFPPISGYAMEPSLLARIAREIPRARTIKLEDPPTPFKTSRILEQADGLEVRIFGGLGGVFLLEELMAGATGAMTGFAYPEILVQIVRLYRAGQIDEAAAIFYRSVPLMRFEFQDGIGMAIRKEVLRRRGALTAAATRAPAAGLDATTRAALDRVLAWTEAQAAEAPSGRA

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
139 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
140 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
144 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
147 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
148 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
149 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
150 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0
Rhizoplane 3.24
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0114224 3300048911 Unclassified 2311
2 Ga0065712_10004331 3300005290 Bacteria 4109
3 Ga0065712_10032318 3300005290 Bacteria 1497
4 Ga0065712_10132998 3300005290 Bacteria 1527
5 Ga0070676_10059043 3300005328 Bacteria 2274
6 Ga0070690_100219464 3300005330 Bacteria 1332
7 Ga0070670_100012506 3300005331 Bacteria 7264
8 Ga0068868_100181461 3300005338 Bacteria 1746
9 Ga0070660_100191442 3300005339 Bacteria 1657
10 Ga0070689_100172375 3300005340 Bacteria 1754
11 Ga0070689_100242800 3300005340 Bacteria 1484
12 Ga0070691_10032106 3300005341 Bacteria 2465
13 Ga0070692_10051150 3300005345 Bacteria 2147
14 Ga0070675_100001658 3300005354 Bacteria 16459
15 Ga0070671_100048879 3300005355 Bacteria 3519
16 Ga0070671_100099669 3300005355 Bacteria 2437
17 Ga0070674_100025004 3300005356 Bacteria 3881
18 Ga0070674_100047157 3300005356 Bacteria 2950
19 Ga0070674_100489630 3300005356 Bacteria 1022
20 Ga0070673_100070046 3300005364 Bacteria 2813
21 Ga0070673_100141851 3300005364 Bacteria 2027
22 Ga0070673_100229292 3300005364 Bacteria 1611
23 Ga0070701_10065775 3300005438 Bacteria 1925
24 Ga0070701_10294554 3300005438 Bacteria 995
25 Ga0070700_100020373 3300005441 Bacteria 3841
26 Ga0070708_100184633 3300005445 Bacteria 1950
27 Ga0070681_10491623 3300005458 Bacteria 1140
28 Ga0068867_100020828 3300005459 Bacteria 4676
29 Ga0070707_100128727 3300005468 Bacteria 2461
30 Ga0070698_100060932 3300005471 Bacteria 3807
31 Ga0070697_100029664 3300005536 Bacteria 4388
32 Ga0070672_100392280 3300005543 Bacteria 1189
33 Ga0070686_100048363 3300005544 Bacteria 2694
34 Ga0070695_100044401 3300005545 Bacteria 2830
35 Ga0070695_100075735 3300005545 Bacteria 2215
36 Ga0070695_100292318 3300005545 Bacteria 1201
37 Ga0070696_100029645 3300005546 Bacteria 3741
38 Ga0070696_100094641 3300005546 Bacteria 2132
39 Ga0070665_100337434 3300005548 Bacteria 1512
40 Ga0070704_100028066 3300005549 Bacteria 3740
41 Ga0070704_100041823 3300005549 Bacteria 3166
42 Ga0070702_100031515 3300005615 Bacteria 2902
43 Ga0068859_100153174 3300005617 Bacteria 2381
44 Ga0068864_100147108 3300005618 Bacteria 2131
45 Ga0068864_100285288 3300005618 Bacteria 1542
46 Ga0068861_100014765 3300005719 Bacteria 5488
47 Ga0068863_100225440 3300005841 Bacteria 1807
48 Ga0068858_100018543 3300005842 Bacteria 6515
49 Ga0070717_10137119 3300006028 Bacteria 2108
50 Ga0075368_10003993 3300006042 Bacteria 4969
51 Ga0075368_10032691 3300006042 Unclassified 2021
52 Ga0075364_10002238 3300006051 Bacteria 10847
53 Ga0075367_10027209 3300006178 Bacteria 3251
54 Ga0075367_10259131 3300006178 Bacteria 1091
55 Ga0075370_10011228 3300006353 Bacteria 4701
56 Ga0068871_100202751 3300006358 Bacteria 1713
57 Ga0075428_100039516 3300006844 Bacteria 5193
58 Ga0075428_100076115 3300006844 Bacteria 3664
59 Ga0075428_100086130 3300006844 Unclassified 3426
60 Ga0075430_100016907 3300006846 Bacteria 6212
61 Ga0075430_100165317 3300006846 Bacteria 1841
62 Ga0075430_100183370 3300006846 Bacteria 1741
63 Ga0075431_100005775 3300006847 Bacteria 12240
64 Ga0075431_100132855 3300006847 Bacteria 2566
65 Ga0075433_10027010 3300006852 Bacteria 4866
66 Ga0075433_10051306 3300006852 Bacteria 3591
67 Ga0075434_100414451 3300006871 Bacteria 1368
68 Ga0075429_100004354 3300006880 Bacteria 12163
69 Ga0075429_100051953 3300006880 Unclassified 3565
70 Ga0075429_100136611 3300006880 Bacteria 2146
71 Ga0075429_100294318 3300006880 Unclassified 1421
72 Ga0068865_100021785 3300006881 Bacteria 4172
73 Ga0075436_100040119 3300006914 Bacteria 3230
74 Ga0075436_100207956 3300006914 Bacteria 1387
75 Ga0097620_100153175 3300006931 Bacteria 2381
76 Ga0105240_10014656 3300009093 Bacteria 10698
77 Ga0111539_10001220 3300009094 Bacteria 34222
78 Ga0111539_10050100 3300009094 Bacteria 4976
79 Ga0111539_10121221 3300009094 Bacteria 3064
80 Ga0111539_10208654 3300009094 Bacteria 2276
81 Ga0111539_10290597 3300009094 Unclassified 1902
82 Ga0111539_10470363 3300009094 Bacteria 1464
83 Ga0105245_10123826 3300009098 Bacteria 2417
84 Ga0114129_10007302 3300009147 Bacteria 15735
85 Ga0114129_10009915 3300009147 Bacteria 13576
86 Ga0114129_10010013 3300009147 Bacteria 13512
87 Ga0114129_10012437 3300009147 Bacteria 12116
88 Ga0114129_10018849 3300009147 Bacteria 9829
89 Ga0114129_10073938 3300009147 Bacteria 4748
90 Ga0114129_10083713 3300009147 Bacteria 4430
91 Ga0114129_10088931 3300009147 Bacteria 4282
92 Ga0114129_10149239 3300009147 Unclassified 3200
93 Ga0114129_10325048 3300009147 Bacteria 2044
94 Ga0105241_10050988 3300009174 Bacteria 3155
95 Ga0105248_10008808 3300009177 Bacteria 11084
96 Ga0105248_10335368 3300009177 Bacteria 1703
97 Ga0105249_10350931 3300009553 Bacteria 1495
98 Ga0105249_10357309 3300009553 Bacteria 1481
99 Ga0157374_10650418 3300013296 Bacteria 1066
100 Ga0163163_10014263 3300014325 Bacteria 7303
101 Ga0163163_10110700 3300014325 Bacteria 2775
102 Ga0163163_10639176 3300014325 Bacteria 1127
103 Ga0157380_10198441 3300014326 Unclassified 1778
104 Ga0207697_10003062 3300025315 Bacteria 8384
105 Ga0207682_10024727 3300025893 Bacteria 2380
106 Ga0207688_10065209 3300025901 Bacteria 2058
107 Ga0207647_10105167 3300025904 Bacteria 1672
108 Ga0207699_10137535 3300025906 Bacteria 1602
109 Ga0207645_10010139 3300025907 Bacteria 6480
110 Ga0207654_10129150 3300025911 Bacteria 1597
111 Ga0207681_10368061 3300025923 Bacteria 1154
112 Ga0207659_10000180 3300025926 Bacteria 37729
113 Ga0207706_10309070 3300025933 Bacteria 1377
114 Ga0207711_10018035 3300025941 Bacteria 5866
115 Ga0207711_10263648 3300025941 Bacteria 1584
116 Ga0207679_10375678 3300025945 Bacteria 1245
117 Ga0207651_10012844 3300025960 Bacteria 4761
118 Ga0207651_10115234 3300025960 Bacteria 2026
119 Ga0207703_10074831 3300026035 Bacteria 2805
120 Ga0207703_10215370 3300026035 Bacteria 1714
121 Ga0207708_10004773 3300026075 Bacteria 9979
122 Ga0207641_10040415 3300026088 Bacteria 3906
123 Ga0207648_10002431 3300026089 Bacteria 20035
124 Ga0207676_10035154 3300026095 Bacteria 3800
125 Ga0207676_10131592 3300026095 Bacteria 2128
126 Ga0207675_100074363 3300026118 Bacteria 3179
127 Ga0207683_10016531 3300026121 Bacteria 6281
128 Ga0209813_10023948 3300027866 Unclassified 1741
129 Ga0207428_10002958 3300027907 Bacteria 16812
130 Ga0207428_10046593 3300027907 Bacteria 3487
131 Ga0268266_10130890 3300028379 Bacteria 2244
132 Ga0268265_10102946 3300028380 Bacteria 2311
133 Ga0265332_10097069 3300031238 Bacteria 1244
134 Ga0265328_10004870 3300031239 Bacteria 5784
135 Ga0265325_10157435 3300031241 Bacteria 1071
136 Ga0265340_10029980 3300031247 Bacteria 2730
137 Ga0265331_10026914 3300031250 Bacteria 2887
138 Ga0307408_100180418 3300031548 Unclassified 1693
139 Ga0307405_10166764 3300031731 Bacteria 1566
140 Ga0307413_10193431 3300031824 Bacteria 1462
141 Ga0307406_10038725 3300031901 Unclassified 2953
142 Ga0307406_10236262 3300031901 Bacteria 1368
143 Ga0307407_10111490 3300031903 Unclassified 1718
144 Ga0307409_100009094 3300031995 Bacteria 6082
145 Ga0307416_100091066 3300032002 Unclassified 2618
146 Ga0307416_100341654 3300032002 Unclassified 1510
147 Ga0307411_10047387 3300032005 Bacteria 2778
148 Ga0373926_0039410 3300035083 Bacteria 1684
149 Ga0373940_0059260 3300035088 Unclassified 1092
150 Ga0373937_0299096 3300036401 Unclassified 1521
151 Ga0373925_0004365 3300037068 Bacteria 10696
152 Ga0439431_0012449 3300041997 Bacteria 1955
153 Ga0439450_001813 3300042008 Bacteria 3216
154 Ga0439462_0023220 3300042015 Bacteria 1625
155 Ga0439435_0027696 3300042436 Bacteria 1518
156 Ga0451576_0681869 3300045051 Bacteria 1080
157 Ga0495592_0084560 3300046454 Bacteria 2289
158 Ga0495629_0136038 3300046459 Unclassified 1711
159 Ga0495638_0044611 3300046460 Bacteria 2792
160 Ga0495580_0014529 3300046472 Bacteria 5969
161 Ga0495639_0068719 3300046475 Bacteria 1634
162 Ga0495628_0021130 3300046516 Bacteria 5359
163 Ga0495628_0070663 3300046516 Bacteria 2722
164 Ga0495630_0137719 3300046517 Bacteria 1855
165 Ga0495667_0173277 3300046559 Bacteria 1386
166 Ga0495599_0005946 3300046678 Bacteria 7337
167 Ga0495649_0141953 3300046694 Viruses 1264
168 Ga0495600_0012666 3300046809 Bacteria 5278
169 Ga0495672_0021627 3300047320 Bacteria 4193
170 Ga0496102_0450395 3300048905 Bacteria 1208
171 Ga0496103_0085414 3300048906 Bacteria 1989
172 Ga0496104_0043450 3300048907 Bacteria 4222
173 Ga0496106_0181076 3300048909 Unclassified 1673
174 Ga0496106_0242541 3300048909 Bacteria 1440
175 Ga0496113_0042714 3300048916 Bacteria 3351
176 Ga0501034_0014366 3300049571 Bacteria 8159
177 Ga0501073_0032073 3300049589 Bacteria 3747
178 nmdc:mga00v17_66682_c1 3300050491 Bacteria 2222
179 nmdc:mga0yw44_26879_c1 3300050492 Bacteria 3291
180 nmdc:mga06z11_32388_c1 3300050494 Unclassified 2549
181 nmdc:mga06z11_32930_c1 3300050494 Bacteria 2531
182 nmdc:mga04h51_9910_c1 3300050495 Unclassified 2600
183 nmdc:mga05p37_10165_c1 3300050507 Bacteria 11169
184 nmdc:mga05p37_11958_c1 3300050507 Bacteria 10352
185 nmdc:mga05p37_248557_c1 3300050507 Bacteria 2134
186 nmdc:mga05p37_35115_c1 3300050507 Bacteria 6147
187 nmdc:mga05p37_36958_c1 3300050507 Bacteria 5990
188 nmdc:mga05p37_93183_c1 3300050507 Bacteria 3712
189 nmdc:mga09592_33992_c1 3300050508 Unclassified 4261
190 nmdc:mga09592_4000_c1 3300050508 Bacteria 11885
191 nmdc:mga0qj67_103410_c1 3300050509 Bacteria 2298
192 nmdc:mga0qj67_21447_c1 3300050509 Bacteria 4955
193 nmdc:mga06r32_256140_c1 3300050510 Bacteria 1738
194 nmdc:mga06r32_98704_c1 3300050510 Bacteria 2863
195 nmdc:mga08y16_173517_c1 3300050511 Bacteria 2239
196 nmdc:mga08y16_54178_c1 3300050511 Bacteria 4191
197 nmdc:mga08y16_5685_c1 3300050511 Bacteria 13067
198 nmdc:mga0n895_349314_c1 3300050512 Bacteria 1498
199 nmdc:mga0n895_561764_c1 3300050512 Bacteria 1146
200 nmdc:mga0rr50_86094_c1 3300050513 Bacteria 2437
201 nmdc:mga0a205_27851_c1 3300050515 Bacteria 5398
202 nmdc:mga0a205_3170_c1 3300050515 Bacteria 14608
203 Ga0500641_0009888 3300053096 Bacteria 3436
204 Ga0500555_000135 3300053103 Bacteria 35097
205 Ga0500592_002762 3300053116 Bacteria 2828
206 Ga0500628_047038 3300053129 Unclassified 1009
207 Ga0500616_0001647 3300053153 Bacteria 20644
208 Ga0500645_000480 3300053730 Bacteria 27291
209 Ga0500599_000988 3300053736 Bacteria 3183
210 Ga0590071_001292 3300059421 Bacteria 6713
211 Ga0590075_002560 3300059424 Bacteria 4342
212 2889298178 2889295896 Bacteria 4704906
213 2981286662 2981284811 Bacteria 4641497
214 2981291613 2981289755 Bacteria 4641509
215 2981982303 2981980479 Bacteria 4641628
216 2981987206 2981985349 Bacteria 4641497
217 Ga0496108_0114224
218 Ga0065712_10004331
219 Ga0065712_10032318
220 Ga0065712_10132998
221 Ga0070676_10059043
222 Ga0070690_100219464
223 Ga0070670_100012506
224 Ga0068868_100181461
225 Ga0070660_100191442
226 Ga0070689_100172375
227 Ga0070689_100242800
228 Ga0070691_10032106
229 Ga0070692_10051150
230 Ga0070675_100001658
231 Ga0070671_100048879
232 Ga0070671_100099669
233 Ga0070674_100025004
234 Ga0070674_100047157
235 Ga0070674_100489630
236 Ga0070673_100070046
237 Ga0070673_100141851
238 Ga0070673_100229292
239 Ga0070701_10065775
240 Ga0070701_10294554
241 Ga0070700_100020373
242 Ga0070708_100184633
243 Ga0070681_10491623
244 Ga0068867_100020828
245 Ga0070707_100128727
246 Ga0070698_100060932
247 Ga0070697_100029664
248 Ga0070672_100392280
249 Ga0070686_100048363
250 Ga0070695_100044401
251 Ga0070695_100075735
252 Ga0070695_100292318
253 Ga0070696_100029645
254 Ga0070696_100094641
255 Ga0070665_100337434
256 Ga0070704_100028066
257 Ga0070704_100041823
258 Ga0070702_100031515
259 Ga0068859_100153174
260 Ga0068864_100147108
261 Ga0068864_100285288
262 Ga0068861_100014765
263 Ga0068863_100225440
264 Ga0068858_100018543
265 Ga0070717_10137119
266 Ga0075368_10003993
267 Ga0075368_10032691
268 Ga0075364_10002238
269 Ga0075367_10027209
270 Ga0075367_10259131
271 Ga0075370_10011228
272 Ga0068871_100202751
273 Ga0075428_100039516
274 Ga0075428_100076115
275 Ga0075428_100086130
276 Ga0075430_100016907
277 Ga0075430_100165317
278 Ga0075430_100183370
279 Ga0075431_100005775
280 Ga0075431_100132855
281 Ga0075433_10027010
282 Ga0075433_10051306
283 Ga0075434_100414451
284 Ga0075429_100004354
285 Ga0075429_100051953
286 Ga0075429_100136611
287 Ga0075429_100294318
288 Ga0068865_100021785
289 Ga0075436_100040119
290 Ga0075436_100207956
291 Ga0097620_100153175
292 Ga0105240_10014656
293 Ga0111539_10001220
294 Ga0111539_10050100
295 Ga0111539_10121221
296 Ga0111539_10208654
297 Ga0111539_10290597
298 Ga0111539_10470363
299 Ga0105245_10123826
300 Ga0114129_10007302
301 Ga0114129_10009915
302 Ga0114129_10010013
303 Ga0114129_10012437
304 Ga0114129_10018849
305 Ga0114129_10073938
306 Ga0114129_10083713
307 Ga0114129_10088931
308 Ga0114129_10149239
309 Ga0114129_10325048
310 Ga0105241_10050988
311 Ga0105248_10008808
312 Ga0105248_10335368
313 Ga0105249_10350931
314 Ga0105249_10357309
315 Ga0157374_10650418
316 Ga0163163_10014263
317 Ga0163163_10110700
318 Ga0163163_10639176
319 Ga0157380_10198441
320 Ga0207697_10003062
321 Ga0207682_10024727
322 Ga0207688_10065209
323 Ga0207647_10105167
324 Ga0207699_10137535
325 Ga0207645_10010139
326 Ga0207654_10129150
327 Ga0207681_10368061
328 Ga0207659_10000180
329 Ga0207706_10309070
330 Ga0207711_10018035
331 Ga0207711_10263648
332 Ga0207679_10375678
333 Ga0207651_10012844
334 Ga0207651_10115234
335 Ga0207703_10074831
336 Ga0207703_10215370
337 Ga0207708_10004773
338 Ga0207641_10040415
339 Ga0207648_10002431
340 Ga0207676_10035154
341 Ga0207676_10131592
342 Ga0207675_100074363
343 Ga0207683_10016531
344 Ga0209813_10023948
345 Ga0207428_10002958
346 Ga0207428_10046593
347 Ga0268266_10130890
348 Ga0268265_10102946
349 Ga0265332_10097069
350 Ga0265328_10004870
351 Ga0265325_10157435
352 Ga0265340_10029980
353 Ga0265331_10026914
354 Ga0307408_100180418
355 Ga0307405_10166764
356 Ga0307413_10193431
357 Ga0307406_10038725
358 Ga0307406_10236262
359 Ga0307407_10111490
360 Ga0307409_100009094
361 Ga0307416_100091066
362 Ga0307416_100341654
363 Ga0307411_10047387
364 Ga0373926_0039410
365 Ga0373940_0059260
366 Ga0373937_0299096
367 Ga0373925_0004365
368 Ga0439431_0012449
369 Ga0439450_001813
370 Ga0439462_0023220
371 Ga0439435_0027696
372 Ga0451576_0681869
373 Ga0495592_0084560
374 Ga0495629_0136038
375 Ga0495638_0044611
376 Ga0495580_0014529
377 Ga0495639_0068719
378 Ga0495628_0021130
379 Ga0495628_0070663
380 Ga0495630_0137719
381 Ga0495667_0173277
382 Ga0495599_0005946
383 Ga0495649_0141953
384 Ga0495600_0012666
385 Ga0495672_0021627
386 Ga0496102_0450395
387 Ga0496103_0085414
388 Ga0496104_0043450
389 Ga0496106_0181076
390 Ga0496106_0242541
391 Ga0496113_0042714
392 Ga0501034_0014366
393 Ga0501073_0032073
394 nmdc:mga00v17_66682_c1
395 nmdc:mga0yw44_26879_c1
396 nmdc:mga06z11_32388_c1
397 nmdc:mga06z11_32930_c1
398 nmdc:mga04h51_9910_c1
399 nmdc:mga05p37_10165_c1
400 nmdc:mga05p37_11958_c1
401 nmdc:mga05p37_248557_c1
402 nmdc:mga05p37_35115_c1
403 nmdc:mga05p37_36958_c1
404 nmdc:mga05p37_93183_c1
405 nmdc:mga09592_33992_c1
406 nmdc:mga09592_4000_c1
407 nmdc:mga0qj67_103410_c1
408 nmdc:mga0qj67_21447_c1
409 nmdc:mga06r32_256140_c1
410 nmdc:mga06r32_98704_c1
411 nmdc:mga08y16_173517_c1
412 nmdc:mga08y16_54178_c1
413 nmdc:mga08y16_5685_c1
414 nmdc:mga0n895_349314_c1
415 nmdc:mga0n895_561764_c1
416 nmdc:mga0rr50_86094_c1
417 nmdc:mga0a205_27851_c1
418 nmdc:mga0a205_3170_c1
419 Ga0500641_0009888
420 Ga0500555_000135
421 Ga0500592_002762
422 Ga0500628_047038
423 Ga0500616_0001647
424 Ga0500645_000480
425 Ga0500599_000988
426 Ga0590071_001292
427 Ga0590075_002560
428 2889298178
429 2981286662
430 2981291613
431 2981982303
432 2981987206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

29

319

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c0c-assembly1.cif.gz_A crystal structure of azospirillum brasilense l-2-keto-3-deoxyarabonate dehydratase (apo form) 0.9487 3 291
3fkk-assembly1.cif.gz_A structure of l-2-keto-3-deoxyarabonate dehydratase 0.9478 3 291
7c0e-assembly3.cif.gz_J crystal structure of azospirillum brasilense l-2-keto-3-deoxyarabonate dehydratase (2-oxobutyrate-bound form) 0.9448 3 291
3nev-assembly1.cif.gz_C crystal structure of yage, a prophage protein from e. coli k12 in complex with kdgal 0.9335 1 294
3na8-assembly1.cif.gz_D crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.9334 2 293
ID Description Score Start End Superfamily
3fkkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9478 3 291 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9319 1 294 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.928 3 293 3.20.20.70
5c54C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9271 2 291 3.20.20.70
3s5oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9265 1 293 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V9JS72-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9776 1 302 GO:0005829
GO:0008840
AF-A0A432JCE3-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9705 2 302 GO:0005829
GO:0008840
AF-A0A2V9JS72-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9681 1 302 GO:0005829
GO:0008840
AF-A0A847HTA7-F1-model_v4 Dihydrodipicolinate synthase family protein 0.968 3 296 GO:0005829
GO:0008840
AF-F0G2E3-F1-model_v4 Dihydrodipicolinate synthetase 0.9644 3 105 GO:0005829
GO:0008840

Map