F327527

General Info

Members Datasets Scaffolds Average Seq Length
216 153 432 155

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10427566|Ga0111539_104275662
Length 185
Sequence MREMFAAKGSGRKDRGLPTAFGACWNLGCRMSEPSLQDRFAPNNKCFGCGPANAKGLRIKSRVEGDVVVADWTPEPHHEAFPGMLNGGIVGALMDCHSNWTAAWHLMTKGKLDAPPSTVTSEFHVKLKRPTPSTVPLRVRARVVESEGDRVVVEAEIESGGKVTSTCRGVFVAVREGHPAYHRWN

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.78
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 17.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10427566 3300009094 Bacteria 1542
2 Ga0065715_10217434 3300005293 Bacteria 1287
3 Ga0070683_100261615 3300005329 Bacteria 1646
4 Ga0070690_100010799 3300005330 Bacteria 5326
5 Ga0070670_100475618 3300005331 Bacteria 1109
6 Ga0070666_10000294 3300005335 Bacteria 32710
7 Ga0070666_10015159 3300005335 Bacteria 4915
8 Ga0070682_100116692 3300005337 Unclassified 1786
9 Ga0068868_100006472 3300005338 Bacteria 8291
10 Ga0070689_100070787 3300005340 Bacteria 2724
11 Ga0070661_100323767 3300005344 Bacteria 1204
12 Ga0070692_10746368 3300005345 Bacteria 663
13 Ga0070669_100697361 3300005353 Bacteria 857
14 Ga0070671_100010530 3300005355 Bacteria 7424
15 Ga0070671_100109618 3300005355 Bacteria 2318
16 Ga0070667_100044370 3300005367 Bacteria 3733
17 Ga0070714_100887693 3300005435 Bacteria 865
18 Ga0070701_10059049 3300005438 Bacteria 2015
19 Ga0070705_100572955 3300005440 Bacteria 869
20 Ga0070694_100076109 3300005444 Unclassified 2323
21 Ga0070662_101279705 3300005457 Bacteria 631
22 Ga0070685_10093868 3300005466 Bacteria 1821
23 Ga0070706_100026060 3300005467 Bacteria 5379
24 Ga0070707_100025302 3300005468 Bacteria 5629
25 Ga0070707_100100831 3300005468 Bacteria 2798
26 Ga0070698_100203744 3300005471 Bacteria 1914
27 Ga0070698_100949369 3300005471 Bacteria 806
28 Ga0070698_101246701 3300005471 Unclassified 693
29 Ga0070699_100905226 3300005518 Unclassified 808
30 Ga0068853_100122522 3300005539 Bacteria 2321
31 Ga0070672_100366789 3300005543 Bacteria 1230
32 Ga0070695_100049074 3300005545 Bacteria 2701
33 Ga0070695_100334497 3300005545 Bacteria 1130
34 Ga0070693_100366176 3300005547 Bacteria 990
35 Ga0070704_100123906 3300005549 Bacteria 1990
36 Ga0070704_101467112 3300005549 Bacteria 627
37 Ga0070664_100522890 3300005564 Unclassified 1095
38 Ga0068857_100103977 3300005577 Bacteria 2550
39 Ga0068856_100571225 3300005614 Unclassified 1152
40 Ga0070702_100015598 3300005615 Unclassified 3882
41 Ga0070702_100377399 3300005615 Bacteria 1007
42 Ga0070702_100872001 3300005615 Archaea 702
43 Ga0068852_100040214 3300005616 Bacteria 3943
44 Ga0068852_100194984 3300005616 Bacteria 1913
45 Ga0068859_100099876 3300005617 Bacteria 2957
46 Ga0068859_100403835 3300005617 Unclassified 1462
47 Ga0068859_101032055 3300005617 Bacteria 903
48 Ga0068866_10130430 3300005718 Unclassified 1429
49 Ga0068863_100057442 3300005841 Bacteria 3683
50 Ga0068863_100166191 3300005841 Bacteria 2116
51 Ga0068858_100039437 3300005842 Unclassified 4379
52 Ga0068858_100740272 3300005842 Bacteria 957
53 Ga0068860_100114908 3300005843 Bacteria 2574
54 Ga0068860_100990413 3300005843 Bacteria 858
55 Ga0068862_100040166 3300005844 Bacteria 3977
56 Ga0068862_100242064 3300005844 Bacteria 1641
57 Ga0081539_10024866 3300005985 Bacteria 3872
58 Ga0070717_10015086 3300006028 Bacteria 5958
59 Ga0097621_100036189 3300006237 Unclassified 3949
60 Ga0075428_100091020 3300006844 Bacteria 3328
61 Ga0075428_100462246 3300006844 Bacteria 1359
62 Ga0075431_100055982 3300006847 Bacteria 4069
63 Ga0075431_100089926 3300006847 Unclassified 3169
64 Ga0075431_100469542 3300006847 Bacteria 1252
65 Ga0075433_10005482 3300006852 Bacteria 9970
66 Ga0075433_10025427 3300006852 Bacteria 5005
67 Ga0075433_10359183 3300006852 Bacteria 1287
68 Ga0075434_100002234 3300006871 Bacteria 16913
69 Ga0075434_100012324 3300006871 Bacteria 8100
70 Ga0075434_100039320 3300006871 Bacteria 4687
71 Ga0075429_100552735 3300006880 Bacteria 1009
72 Ga0068865_100168971 3300006881 Bacteria 1675
73 Ga0075436_100856652 3300006914 Unclassified 678
74 Ga0097620_100099885 3300006931 Bacteria 2957
75 Ga0097620_100403829 3300006931 Unclassified 1462
76 Ga0097620_101032040 3300006931 Bacteria 903
77 Ga0075435_100140223 3300007076 Bacteria 2028
78 Ga0075435_100278957 3300007076 Bacteria 1426
79 Ga0099794_10302349 3300007265 Bacteria 829
80 Ga0111539_10007644 3300009094 Bacteria 13812
81 Ga0111539_10052007 3300009094 Bacteria 4878
82 Ga0111539_10174597 3300009094 Bacteria 2510
83 Ga0111539_11634754 3300009094 Bacteria 747
84 Ga0105247_10012121 3300009101 Bacteria 5183
85 Ga0114129_10010427 3300009147 Bacteria 13252
86 Ga0114129_10052884 3300009147 Bacteria 5699
87 Ga0105243_10986707 3300009148 Unclassified 844
88 Ga0105242_10024301 3300009176 Bacteria 4784
89 Ga0105248_10083983 3300009177 Bacteria 3582
90 Ga0105248_10679585 3300009177 Bacteria 1161
91 Ga0105237_10174605 3300009545 Unclassified 2149
92 Ga0105249_10044145 3300009553 Bacteria 4054
93 Ga0157370_10137974 3300013104 Unclassified 2272
94 Ga0157374_10047894 3300013296 Bacteria 3964
95 Ga0157374_10327833 3300013296 Bacteria 1518
96 Ga0157378_10016795 3300013297 Bacteria 6414
97 Ga0157378_10099304 3300013297 Bacteria 2655
98 Ga0163162_10142595 3300013306 Bacteria 2510
99 Ga0163162_10295646 3300013306 Unclassified 1751
100 Ga0163162_10491151 3300013306 Unclassified 1359
101 Ga0157375_10107621 3300013308 Bacteria 2881
102 Ga0157375_11367155 3300013308 Bacteria 834
103 Ga0163163_10016495 3300014325 Bacteria 6868
104 Ga0157377_10368249 3300014745 Bacteria 969
105 Ga0157379_10015203 3300014968 Bacteria 6751
106 Ga0157379_10032573 3300014968 Bacteria 4647
107 Ga0157379_10461300 3300014968 Unclassified 1174
108 Ga0157376_10052165 3300014969 Bacteria 3399
109 Ga0163161_10028574 3300017792 Bacteria 3961
110 Ga0213874_10320488 3300021377 Bacteria 588
111 Ga0213876_10072107 3300021384 Bacteria 1824
112 Ga0207680_10023933 3300025903 Bacteria 3343
113 Ga0207680_10025656 3300025903 Bacteria 3254
114 Ga0207684_10000379 3300025910 Bacteria 60091
115 Ga0207684_10069054 3300025910 Bacteria 3003
116 Ga0207646_10026523 3300025922 Bacteria 5286
117 Ga0207646_10052796 3300025922 Bacteria 3637
118 Ga0207659_10551699 3300025926 Bacteria 980
119 Ga0207644_10020319 3300025931 Bacteria 4515
120 Ga0207706_10621040 3300025933 Bacteria 927
121 Ga0207686_10203244 3300025934 Bacteria 1420
122 Ga0207670_10100046 3300025936 Bacteria 2069
123 Ga0207691_10211884 3300025940 Unclassified 1682
124 Ga0207691_10531652 3300025940 Bacteria 997
125 Ga0207691_10701816 3300025940 Unclassified 853
126 Ga0207711_10023614 3300025941 Bacteria 5148
127 Ga0207679_10151397 3300025945 Bacteria 1888
128 Ga0207679_10455836 3300025945 Unclassified 1135
129 Ga0207651_10038670 3300025960 Bacteria 3138
130 Ga0207712_10080567 3300025961 Bacteria 2369
131 Ga0207668_10650702 3300025972 Bacteria 922
132 Ga0207658_11669898 3300025986 Bacteria 582
133 Ga0207677_10100624 3300026023 Bacteria 2126
134 Ga0207703_10682014 3300026035 Bacteria 976
135 Ga0207639_10409517 3300026041 Unclassified 1223
136 Ga0207641_10020076 3300026088 Bacteria 5485
137 Ga0207676_10067448 3300026095 Bacteria 2858
138 Ga0207674_10157040 3300026116 Bacteria 2230
139 Ga0207698_10027282 3300026142 Bacteria 4053
140 Ga0209967_1010878 3300027364 Bacteria 1272
141 Ga0207428_10049254 3300027907 Bacteria 3376
142 Ga0207428_10074936 3300027907 Bacteria 2653
143 Ga0207428_10123322 3300027907 Bacteria 1985
144 Ga0268265_10386061 3300028380 Bacteria 1290
145 Ga0268265_11267672 3300028380 Bacteria 736
146 Ga0268264_10012411 3300028381 Bacteria 7013
147 Ga0268264_10301122 3300028381 Bacteria 1509
148 Ga0265318_10001312 3300028577 Bacteria 14886
149 Ga0265338_10044816 3300028800 Bacteria 4077
150 Ga0265325_10178079 3300031241 Unclassified 991
151 Ga0265340_10006023 3300031247 Bacteria 6694
152 Ga0265316_10002558 3300031344 Bacteria 18801
153 Ga0307408_101593717 3300031548 Unclassified 620
154 Ga0316576_10073882 3300031727 Unclassified 2520
155 Ga0316577_10018788 3300031733 Bacteria 3824
156 Ga0307409_100352644 3300031995 Unclassified 1389
157 Ga0307416_100708636 3300032002 Unclassified 1096
158 Ga0307416_101689368 3300032002 Unclassified 738
159 Ga0307415_100491012 3300032126 Unclassified 1071
160 Ga0316580_10058063 3300032139 Bacteria 1189
161 Ga0373943_0445622 3300035170 Bacteria 752
162 Ga0316574_0187810 3300035398 Bacteria 1329
163 Ga0373937_0300207 3300036401 Bacteria 1518
164 Ga0316584_0153322 3300036712 Bacteria 1714
165 Ga0316584_0353734 3300036712 Unclassified 1054
166 Ga0373925_0497216 3300037068 Bacteria 1001
167 Ga0436365_0519908 3300039437 Bacteria 718
168 Ga0436365_1334742 3300039437 Bacteria 4417
169 Ga0436363_0208088 3300039450 Bacteria 673
170 Ga0451577_0412073 3300042876 Bacteria 1227
171 Ga0466963_0173354 3300044694 Bacteria 1504
172 Ga0453684_0035072 3300044712 Bacteria 6945
173 Ga0453684_0943933 3300044712 Unclassified 921
174 Ga0451576_0280072 3300045051 Bacteria 1744
175 Ga0451576_1579520 3300045051 Bacteria 681
176 Ga0495582_0343192 3300046473 Unclassified 860
177 Ga0495628_0001307 3300046516 Bacteria 22862
178 Ga0495630_0219619 3300046517 Bacteria 1451
179 Ga0495598_0324547 3300046537 Bacteria 587
180 Ga0495667_0000334 3300046559 Bacteria 29853
181 Ga0495684_0011814 3300047471 Bacteria 6737
182 Ga0496100_0416127 3300048903 Unclassified 1026
183 Ga0496104_1269155 3300048907 Unclassified 640
184 Ga0496105_0188900 3300048908 Bacteria 1685
185 Ga0496109_1325420 3300048912 Bacteria 656
186 Ga0496110_0821333 3300048913 Unclassified 834
187 Ga0496114_0019959 3300048917 Bacteria 5437
188 Ga0501031_0708515 3300049568 Bacteria 646
189 Ga0501037_0234160 3300049573 Bacteria 1289
190 Ga0501042_0186148 3300049578 Bacteria 1498
191 Ga0501068_0549473 3300049584 Bacteria 751
192 Ga0501071_0247522 3300049587 Bacteria 1345
193 Ga0501072_0412860 3300049588 Bacteria 1070
194 Ga0501074_0483231 3300049590 Bacteria 878
195 Ga0501076_0020444 3300049592 Bacteria 5069
196 Ga0501079_0165205 3300049741 Bacteria 1726
197 Ga0501080_0030039 3300049742 Bacteria 5061
198 Ga0501045_0170178 3300049824 Bacteria 1623
199 Ga0501045_0713313 3300049824 Bacteria 740
200 nmdc:mga05p37_32284_c1 3300050507 Bacteria 6403
201 nmdc:mga05p37_4089_c2 3300050507 Bacteria 8809
202 nmdc:mga0qj67_410097_c1 3300050509 Bacteria 1093
203 nmdc:mga06r32_391854_c1 3300050510 Bacteria 1371
204 nmdc:mga08y16_15468_c1 3300050511 Bacteria 8024
205 nmdc:mga08y16_192539_c1 3300050511 Bacteria 2115
206 nmdc:mga08y16_4962_c1 3300050511 Bacteria 13906
207 nmdc:mga0n895_130312_c1 3300050512 Bacteria 2540
208 nmdc:mga0n895_639967_c1 3300050512 Bacteria 1063
209 nmdc:mga0n895_98050_c1 3300050512 Bacteria 2938
210 nmdc:mga0rr50_112659_c1 3300050513 Bacteria 2155
211 nmdc:mga0rr50_3284_c1 3300050513 Bacteria 9282
212 nmdc:mga0a205_11747_c1 3300050515 Bacteria 8077
213 nmdc:mga0a205_357910_c1 3300050515 Bacteria 1326
214 nmdc:mga0a205_799504_c1 3300050515 Unclassified 791
215 Ga0501082_0095908 3300060353 Bacteria 2564
216 Ga0530510_0593171 3300061734 Bacteria 842
217 Ga0111539_10427566
218 Ga0065715_10217434
219 Ga0070683_100261615
220 Ga0070690_100010799
221 Ga0070670_100475618
222 Ga0070666_10000294
223 Ga0070666_10015159
224 Ga0070682_100116692
225 Ga0068868_100006472
226 Ga0070689_100070787
227 Ga0070661_100323767
228 Ga0070692_10746368
229 Ga0070669_100697361
230 Ga0070671_100010530
231 Ga0070671_100109618
232 Ga0070667_100044370
233 Ga0070714_100887693
234 Ga0070701_10059049
235 Ga0070705_100572955
236 Ga0070694_100076109
237 Ga0070662_101279705
238 Ga0070685_10093868
239 Ga0070706_100026060
240 Ga0070707_100025302
241 Ga0070707_100100831
242 Ga0070698_100203744
243 Ga0070698_100949369
244 Ga0070698_101246701
245 Ga0070699_100905226
246 Ga0068853_100122522
247 Ga0070672_100366789
248 Ga0070695_100049074
249 Ga0070695_100334497
250 Ga0070693_100366176
251 Ga0070704_100123906
252 Ga0070704_101467112
253 Ga0070664_100522890
254 Ga0068857_100103977
255 Ga0068856_100571225
256 Ga0070702_100015598
257 Ga0070702_100377399
258 Ga0070702_100872001
259 Ga0068852_100040214
260 Ga0068852_100194984
261 Ga0068859_100099876
262 Ga0068859_100403835
263 Ga0068859_101032055
264 Ga0068866_10130430
265 Ga0068863_100057442
266 Ga0068863_100166191
267 Ga0068858_100039437
268 Ga0068858_100740272
269 Ga0068860_100114908
270 Ga0068860_100990413
271 Ga0068862_100040166
272 Ga0068862_100242064
273 Ga0081539_10024866
274 Ga0070717_10015086
275 Ga0097621_100036189
276 Ga0075428_100091020
277 Ga0075428_100462246
278 Ga0075431_100055982
279 Ga0075431_100089926
280 Ga0075431_100469542
281 Ga0075433_10005482
282 Ga0075433_10025427
283 Ga0075433_10359183
284 Ga0075434_100002234
285 Ga0075434_100012324
286 Ga0075434_100039320
287 Ga0075429_100552735
288 Ga0068865_100168971
289 Ga0075436_100856652
290 Ga0097620_100099885
291 Ga0097620_100403829
292 Ga0097620_101032040
293 Ga0075435_100140223
294 Ga0075435_100278957
295 Ga0099794_10302349
296 Ga0111539_10007644
297 Ga0111539_10052007
298 Ga0111539_10174597
299 Ga0111539_11634754
300 Ga0105247_10012121
301 Ga0114129_10010427
302 Ga0114129_10052884
303 Ga0105243_10986707
304 Ga0105242_10024301
305 Ga0105248_10083983
306 Ga0105248_10679585
307 Ga0105237_10174605
308 Ga0105249_10044145
309 Ga0157370_10137974
310 Ga0157374_10047894
311 Ga0157374_10327833
312 Ga0157378_10016795
313 Ga0157378_10099304
314 Ga0163162_10142595
315 Ga0163162_10295646
316 Ga0163162_10491151
317 Ga0157375_10107621
318 Ga0157375_11367155
319 Ga0163163_10016495
320 Ga0157377_10368249
321 Ga0157379_10015203
322 Ga0157379_10032573
323 Ga0157379_10461300
324 Ga0157376_10052165
325 Ga0163161_10028574
326 Ga0213874_10320488
327 Ga0213876_10072107
328 Ga0207680_10023933
329 Ga0207680_10025656
330 Ga0207684_10000379
331 Ga0207684_10069054
332 Ga0207646_10026523
333 Ga0207646_10052796
334 Ga0207659_10551699
335 Ga0207644_10020319
336 Ga0207706_10621040
337 Ga0207686_10203244
338 Ga0207670_10100046
339 Ga0207691_10211884
340 Ga0207691_10531652
341 Ga0207691_10701816
342 Ga0207711_10023614
343 Ga0207679_10151397
344 Ga0207679_10455836
345 Ga0207651_10038670
346 Ga0207712_10080567
347 Ga0207668_10650702
348 Ga0207658_11669898
349 Ga0207677_10100624
350 Ga0207703_10682014
351 Ga0207639_10409517
352 Ga0207641_10020076
353 Ga0207676_10067448
354 Ga0207674_10157040
355 Ga0207698_10027282
356 Ga0209967_1010878
357 Ga0207428_10049254
358 Ga0207428_10074936
359 Ga0207428_10123322
360 Ga0268265_10386061
361 Ga0268265_11267672
362 Ga0268264_10012411
363 Ga0268264_10301122
364 Ga0265318_10001312
365 Ga0265338_10044816
366 Ga0265325_10178079
367 Ga0265340_10006023
368 Ga0265316_10002558
369 Ga0307408_101593717
370 Ga0316576_10073882
371 Ga0316577_10018788
372 Ga0307409_100352644
373 Ga0307416_100708636
374 Ga0307416_101689368
375 Ga0307415_100491012
376 Ga0316580_10058063
377 Ga0373943_0445622
378 Ga0316574_0187810
379 Ga0373937_0300207
380 Ga0316584_0153322
381 Ga0316584_0353734
382 Ga0373925_0497216
383 Ga0436365_0519908
384 Ga0436365_1334742
385 Ga0436363_0208088
386 Ga0451577_0412073
387 Ga0466963_0173354
388 Ga0453684_0035072
389 Ga0453684_0943933
390 Ga0451576_0280072
391 Ga0451576_1579520
392 Ga0495582_0343192
393 Ga0495628_0001307
394 Ga0495630_0219619
395 Ga0495598_0324547
396 Ga0495667_0000334
397 Ga0495684_0011814
398 Ga0496100_0416127
399 Ga0496104_1269155
400 Ga0496105_0188900
401 Ga0496109_1325420
402 Ga0496110_0821333
403 Ga0496114_0019959
404 Ga0501031_0708515
405 Ga0501037_0234160
406 Ga0501042_0186148
407 Ga0501068_0549473
408 Ga0501071_0247522
409 Ga0501072_0412860
410 Ga0501074_0483231
411 Ga0501076_0020444
412 Ga0501079_0165205
413 Ga0501080_0030039
414 Ga0501045_0170178
415 Ga0501045_0713313
416 nmdc:mga05p37_32284_c1
417 nmdc:mga05p37_4089_c2
418 nmdc:mga0qj67_410097_c1
419 nmdc:mga06r32_391854_c1
420 nmdc:mga08y16_15468_c1
421 nmdc:mga08y16_192539_c1
422 nmdc:mga08y16_4962_c1
423 nmdc:mga0n895_130312_c1
424 nmdc:mga0n895_639967_c1
425 nmdc:mga0n895_98050_c1
426 nmdc:mga0rr50_112659_c1
427 nmdc:mga0rr50_3284_c1
428 nmdc:mga0a205_11747_c1
429 nmdc:mga0a205_357910_c1
430 nmdc:mga0a205_799504_c1
431 Ga0501082_0095908
432 Ga0530510_0593171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

82

166

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9109 22 146
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.899 37 147
2prx-assembly1.cif.gz_B crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.8925 22 146
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.8877 22 146
2qq2-assembly2.cif.gz_G crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.8842 37 147
ID Description Score Start End Superfamily
2prxB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8873 22 145 3.10.129.10
2prxB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8643 22 145 3.10.129.10
4zv3B01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.859 40 149 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8531 28 146 3.10.129.10
5eo2D01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8446 40 141 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V6MMD9-F1-model_v4 PaaI family thioesterase 0.9991 31 136
AF-A0A3A5WCT0-F1-model_v4 PaaI family thioesterase 0.9964 4 140
AF-A0A2H5WU84-F1-model_v4 Thioesterase domain-containing protein 0.985 2 155
AF-A0A535BJF6-F1-model_v4 PaaI family thioesterase 0.984 69 155
AF-A0A533X4Y9-F1-model_v4 PaaI family thioesterase 0.9834 4 155

Map