F326701

General Info

Members Datasets Scaffolds Average Seq Length
215 160 430 208

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0706616|Ga0436365_0706616_3935_4564
Length 192
Sequence MILIGQYDSPFVRRVGIALTLYGMPFEHRPWSTFGEADKIRPYNPLTRVPTLVLDDGDVLIDSTVILDYLDGLVPAEKRMFPVAEEKAVSLFYEKVLHKQAESDVWVSRCRTQISGGLAALEPDRAARKTAWWFGDNIGHADIAVAAALRFIAEAHPGVIAMTQFPALAAHAQRCEALAAFQGIQQKFIPPA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
144 2643221618 Ensifer sp. Root231 Isolate Unclassified
145 2643221655 Ensifer sp. Root1252 Isolate Unclassified
146 2643221659 Ensifer sp. Root127 Isolate Unclassified
147 2643221712 Ensifer sp. Root258 Isolate Unclassified
148 2643221723 Ensifer sp. Root278 Isolate Unclassified
149 2738543024 Aminobacter sp. AP02 Isolate Unclassified
150 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
151 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
152 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
153 2844163670 Ensifer sp. 1H6 Isolate Unclassified
154 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
155 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
156 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
157 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
158 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
159 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
160 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.63
Metatranscriptomes 0
Isolates 8.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.63
Nodule 2.33
Rhizoplane 4.65
Rhizosphere 54.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0706616 3300039437 Bacteria 6574
2 JGI25159J45721_1000015 3300002987 Bacteria 142431
3 JGI25151J46595_10000199 3300003187 Bacteria 73941
4 JGI25160J50197_1000003 3300003354 Bacteria 482719
5 JGI25160J50197_1014193 3300003354 Bacteria 2675
6 JGI25161J50226_1000741 3300003374 Bacteria 12537
7 Ga0055526_1004390 3300003771 Bacteria 8501
8 Ga0055536_1001164 3300003781 Bacteria 16439
9 Ga0055540_1025970 3300003792 Bacteria 1424
10 Ga0055531_10031142 3300003794 Bacteria 1774
11 Ga0055543_1000034 3300004625 Bacteria 128668
12 Ga0065165_1000025 3300005262 Bacteria 246909
13 Ga0065707_10307091 3300005295 Bacteria 992
14 Ga0068869_100084755 3300005334 Bacteria 2372
15 Ga0070680_100621472 3300005336 Bacteria 928
16 Ga0070689_100117030 3300005340 Bacteria 2125
17 Ga0070689_100546332 3300005340 Bacteria 998
18 Ga0070687_100210682 3300005343 Bacteria 1184
19 Ga0070669_100093118 3300005353 Bacteria 2263
20 Ga0070669_100394117 3300005353 Bacteria 1132
21 Ga0070669_100402665 3300005353 Bacteria 1120
22 Ga0070674_100101773 3300005356 Bacteria 2094
23 Ga0070667_100297644 3300005367 Bacteria 1452
24 Ga0070700_100329138 3300005441 Bacteria 1125
25 Ga0070672_100189747 3300005543 Bacteria 1715
26 Ga0070665_100339887 3300005548 Bacteria 1506
27 Ga0068852_100290541 3300005616 Bacteria 1579
28 Ga0068859_100095022 3300005617 Bacteria 3033
29 Ga0068866_10633089 3300005718 Bacteria 726
30 Ga0068861_100765600 3300005719 Bacteria 903
31 Ga0068863_100410449 3300005841 Bacteria 1326
32 Ga0068858_100110282 3300005842 Bacteria 2569
33 Ga0068862_100051719 3300005844 Bacteria 3514
34 Ga0068862_100176161 3300005844 Bacteria 1917
35 Ga0068862_100462382 3300005844 Bacteria 1198
36 Ga0068862_100679408 3300005844 Bacteria 996
37 Ga0081540_1105772 3300005983 Bacteria 1201
38 Ga0081539_10000522 3300005985 Bacteria 79973
39 Ga0075365_10022143 3300006038 Bacteria 3977
40 Ga0075365_10075604 3300006038 Bacteria 2273
41 Ga0075365_10493607 3300006038 Bacteria 865
42 Ga0075365_10577998 3300006038 Bacteria 795
43 Ga0075368_10001448 3300006042 Bacteria 7597
44 Ga0075368_10078362 3300006042 Bacteria 1342
45 Ga0075368_10136624 3300006042 Bacteria 1020
46 Ga0075363_100008075 3300006048 Bacteria 4882
47 Ga0075363_100098766 3300006048 Bacteria 1614
48 Ga0075363_100315594 3300006048 Bacteria 909
49 Ga0075364_10020650 3300006051 Bacteria 4143
50 Ga0075364_10084177 3300006051 Bacteria 2106
51 Ga0075364_10180221 3300006051 Bacteria 1429
52 Ga0075362_10011295 3300006177 Bacteria 3515
53 Ga0075362_10226486 3300006177 Bacteria 915
54 Ga0075367_10004259 3300006178 Bacteria 6956
55 Ga0075367_10009633 3300006178 Bacteria 5057
56 Ga0075367_10178090 3300006178 Bacteria 1325
57 Ga0075366_10010811 3300006195 Bacteria 5133
58 Ga0075370_10124863 3300006353 Bacteria 1500
59 Ga0075370_10339478 3300006353 Bacteria 896
60 Ga0075428_100010443 3300006844 Bacteria 10313
61 Ga0075430_100233143 3300006846 Bacteria 1526
62 Ga0075431_100032002 3300006847 Bacteria 5420
63 Ga0068865_100713797 3300006881 Bacteria 858
64 Ga0097620_100095033 3300006931 Bacteria 3033
65 Ga0111539_10000097 3300009094 Bacteria 91946
66 Ga0105245_10162949 3300009098 Bacteria 2117
67 Ga0105247_10143606 3300009101 Bacteria 1566
68 Ga0105243_10334218 3300009148 Bacteria 1385
69 Ga0105241_10116140 3300009174 Bacteria 2149
70 Ga0105239_10569908 3300010375 Bacteria 1290
71 Ga0105246_10115054 3300011119 Bacteria 1983
72 Ga0157378_11027062 3300013297 Bacteria 859
73 Ga0157375_10686219 3300013308 Bacteria 1178
74 Ga0163163_10337857 3300014325 Bacteria 1561
75 Ga0157380_10043467 3300014326 Bacteria 3518
76 Ga0157380_10053108 3300014326 Bacteria 3212
77 Ga0157380_10067886 3300014326 Bacteria 2873
78 Ga0157380_11174373 3300014326 Bacteria 810
79 Ga0163161_10198552 3300017792 Bacteria 1545
80 Ga0213876_10252867 3300021384 Bacteria 936
81 Ga0209436_100130 3300025208 Bacteria 37375
82 Ga0209130_1000005 3300025284 Bacteria 599620
83 Ga0209130_1000749 3300025284 Bacteria 28197
84 Ga0209676_1001927 3300025292 Bacteria 16772
85 Ga0209676_1035952 3300025292 Bacteria 1447
86 Ga0209025_1000847 3300025294 Bacteria 48445
87 Ga0209564_1000113 3300025295 Bacteria 211564
88 Ga0209758_1002804 3300025297 Bacteria 17007
89 Ga0209256_1003107 3300025299 Bacteria 12151
90 Ga0207426_1000015 3300025302 Bacteria 599316
91 Ga0207426_1000616 3300025302 Bacteria 45569
92 Ga0209051_1001056 3300025303 Bacteria 25758
93 Ga0209257_1001948 3300025304 Bacteria 22281
94 Ga0207642_10197848 3300025899 Bacteria 1108
95 Ga0207710_10090380 3300025900 Bacteria 1432
96 Ga0207680_10294701 3300025903 Bacteria 1130
97 Ga0207643_10128735 3300025908 Bacteria 1504
98 Ga0207681_10481064 3300025923 Bacteria 1014
99 Ga0207650_10103458 3300025925 Bacteria 2196
100 Ga0207659_10469901 3300025926 Bacteria 1061
101 Ga0207670_10113699 3300025936 Bacteria 1955
102 Ga0207669_10091186 3300025937 Bacteria 1984
103 Ga0207689_10086124 3300025942 Bacteria 2582
104 Ga0207658_10308052 3300025986 Bacteria 1367
105 Ga0207639_10138777 3300026041 Bacteria 2023
106 Ga0207708_10341198 3300026075 Bacteria 1227
107 Ga0207708_10884889 3300026075 Bacteria 772
108 Ga0207641_10455185 3300026088 Bacteria 1237
109 Ga0207648_10638873 3300026089 Bacteria 983
110 Ga0207676_10139317 3300026095 Bacteria 2074
111 Ga0207675_100125941 3300026118 Bacteria 2426
112 Ga0207675_100537047 3300026118 Bacteria 1167
113 Ga0209813_10004452 3300027866 Bacteria 3349
114 Ga0207428_10000217 3300027907 Bacteria 79759
115 Ga0268266_10047541 3300028379 Bacteria 3677
116 Ga0268265_10392441 3300028380 Bacteria 1280
117 Ga0268265_10527229 3300028380 Bacteria 1117
118 Ga0307515_10535405 3300028794 Bacteria 781
119 Ga0307508_10110636 3300031616 Bacteria 2346
120 Ga0307507_10315261 3300033179 Bacteria 946
121 Ga0439453_0009967 3300041408 Bacteria 1557
122 Ga0439435_0054136 3300042436 Bacteria 1155
123 Ga0439444_0075123 3300042437 Bacteria 730
124 Ga0451576_0509981 3300045051 Bacteria 1264
125 Ga0495638_0093884 3300046460 Bacteria 1803
126 Ga0495621_0106685 3300046539 Bacteria 1071
127 Ga0495676_0547888 3300047321 Bacteria 756
128 Ga0496104_0000563 3300048907 Bacteria 31633
129 Ga0496105_0037201 3300048908 Bacteria 4009
130 Ga0496108_0016887 3300048911 Bacteria 5966
131 Ga0496109_0013984 3300048912 Bacteria 6978
132 Ga0496110_0001015 3300048913 Bacteria 19781
133 Ga0496111_0003281 3300048914 Bacteria 9996
134 Ga0496111_0209201 3300048914 Bacteria 1449
135 Ga0496112_0037214 3300048915 Bacteria 4750
136 Ga0496113_0001191 3300048916 Bacteria 14234
137 Ga0496126_0053630 3300048929 Bacteria 3657
138 Ga0501031_0167421 3300049568 Bacteria 1436
139 Ga0501031_0318600 3300049568 Bacteria 1007
140 Ga0501032_0000064 3300049569 Bacteria 91971
141 Ga0501032_0357408 3300049569 Bacteria 940
142 Ga0501033_0000330 3300049570 Bacteria 44983
143 Ga0501033_0181930 3300049570 Bacteria 1506
144 Ga0501034_0000174 3300049571 Bacteria 119615
145 Ga0501034_0053804 3300049571 Bacteria 4053
146 Ga0501034_0160553 3300049571 Bacteria 2219
147 Ga0501034_0769586 3300049571 Bacteria 857
148 Ga0501036_0000399 3300049572 Bacteria 30550
149 Ga0501036_0737937 3300049572 Bacteria 813
150 Ga0501037_0000163 3300049573 Bacteria 62625
151 Ga0501038_0000031 3300049574 Bacteria 132231
152 Ga0501038_0330678 3300049574 Bacteria 1190
153 Ga0501039_0000057 3300049575 Bacteria 89756
154 Ga0501039_0118046 3300049575 Bacteria 2078
155 Ga0501041_0121967 3300049577 Bacteria 1620
156 Ga0501043_0000048 3300049579 Bacteria 109146
157 Ga0501043_0327116 3300049579 Bacteria 1168
158 Ga0501047_0121232 3300049581 Bacteria 2497
159 Ga0501071_0410804 3300049587 Bacteria 1034
160 Ga0501074_0193232 3300049590 Bacteria 1451
161 Ga0501075_0105736 3300049591 Bacteria 2139
162 Ga0501076_0020423 3300049592 Bacteria 5071
163 Ga0501076_0307525 3300049592 Bacteria 1300
164 Ga0501077_0004813 3300049593 Bacteria 8205
165 Ga0501035_0000198 3300049822 Bacteria 73523
166 Ga0501035_0007909 3300049822 Bacteria 9931
167 Ga0501044_0026761 3300049823 Bacteria 6103
168 Ga0501044_0226117 3300049823 Bacteria 1821
169 nmdc:mga03683_184094_c1 3300050489 Bacteria 954
170 nmdc:mga03683_8846_c1 3300050489 Bacteria 3558
171 nmdc:mga03n38_3994_c1 3300050490 Bacteria 4818
172 nmdc:mga03n38_41327_c1 3300050490 Bacteria 1448
173 nmdc:mga03n38_81880_c1 3300050490 Bacteria 1518
174 nmdc:mga03n38_99750_c1 3300050490 Bacteria 1399
175 nmdc:mga00v17_41247_c1 3300050491 Bacteria 2772
176 nmdc:mga00v17_54679_c1 3300050491 Bacteria 2436
177 nmdc:mga0yw44_18172_c1 3300050492 Bacteria 3845
178 nmdc:mga0yw44_35745_c1 3300050492 Bacteria 2922
179 nmdc:mga0k408_1870_c1 3300050493 Bacteria 11285
180 nmdc:mga06z11_4884_c1 3300050494 Bacteria 5317
181 nmdc:mga06z11_490779_c1 3300050494 Bacteria 744
182 nmdc:mga04h51_38243_c1 3300050495 Bacteria 1553
183 nmdc:mga04h51_55539_c1 3300050495 Bacteria 1342
184 nmdc:mga07m45_233343_c1 3300050496 Bacteria 1071
185 nmdc:mga07m45_42231_c1 3300050496 Bacteria 1914
186 nmdc:mga07m45_479603_c1 3300050496 Bacteria 721
187 nmdc:mga0qj67_212472_c1 3300050509 Bacteria 1571
188 nmdc:mga06r32_24488_c1 3300050510 Bacteria 5603
189 nmdc:mga08y16_88_c1 3300050511 Bacteria 77244
190 nmdc:mga0sz30_47257_c1 3300050516 Bacteria 1818
191 Ga0500644_0015224 3300053088 Bacteria 2187
192 Ga0500616_0018562 3300053153 Bacteria 3931
193 Ga0500616_0046979 3300053153 Bacteria 2294
194 Ga0501084_0042349 3300054114 Bacteria 3809
195 Ga0501082_0026146 3300060353 Bacteria 5031
196 Ga0501082_0225799 3300060353 Bacteria 1629
197 Ga0530510_0026347 3300061734 Bacteria 4161
198 2600195357 2599185352 Bacteria 7228948
199 2644103710 2643221618 Bacteria 7717186
200 2644306640 2643221655 Bacteria 7722067
201 2644330830 2643221659 Bacteria 7890716
202 2644612251 2643221712 Bacteria 7729434
203 2644671549 2643221723 Bacteria 7095460
204 2739306501 2738543024 Bacteria 5603683
205 2756671454 2756170246 Bacteria 7451806
206 2821445108 2821443989 Bacteria 7658172
207 2844008638 2844002411 Bacteria 7168230
208 2844170014 2844163670 Bacteria 7266046
209 2871468243 2871466892 Bacteria 6923287
210 2882632486 2882632389 Bacteria 8154593
211 2883293414 2883291878 Bacteria 5894118
212 2883357999 2883354860 Bacteria 5865246
213 2906379192 2906378014 Bacteria 6911440
214 2941506606 2941499720 Bacteria 7599444
215 8002287841 8002285264 Bacteria 6717907
216 Ga0436365_0706616
217 JGI25159J45721_1000015
218 JGI25151J46595_10000199
219 JGI25160J50197_1000003
220 JGI25160J50197_1014193
221 JGI25161J50226_1000741
222 Ga0055526_1004390
223 Ga0055536_1001164
224 Ga0055540_1025970
225 Ga0055531_10031142
226 Ga0055543_1000034
227 Ga0065165_1000025
228 Ga0065707_10307091
229 Ga0068869_100084755
230 Ga0070680_100621472
231 Ga0070689_100117030
232 Ga0070689_100546332
233 Ga0070687_100210682
234 Ga0070669_100093118
235 Ga0070669_100394117
236 Ga0070669_100402665
237 Ga0070674_100101773
238 Ga0070667_100297644
239 Ga0070700_100329138
240 Ga0070672_100189747
241 Ga0070665_100339887
242 Ga0068852_100290541
243 Ga0068859_100095022
244 Ga0068866_10633089
245 Ga0068861_100765600
246 Ga0068863_100410449
247 Ga0068858_100110282
248 Ga0068862_100051719
249 Ga0068862_100176161
250 Ga0068862_100462382
251 Ga0068862_100679408
252 Ga0081540_1105772
253 Ga0081539_10000522
254 Ga0075365_10022143
255 Ga0075365_10075604
256 Ga0075365_10493607
257 Ga0075365_10577998
258 Ga0075368_10001448
259 Ga0075368_10078362
260 Ga0075368_10136624
261 Ga0075363_100008075
262 Ga0075363_100098766
263 Ga0075363_100315594
264 Ga0075364_10020650
265 Ga0075364_10084177
266 Ga0075364_10180221
267 Ga0075362_10011295
268 Ga0075362_10226486
269 Ga0075367_10004259
270 Ga0075367_10009633
271 Ga0075367_10178090
272 Ga0075366_10010811
273 Ga0075370_10124863
274 Ga0075370_10339478
275 Ga0075428_100010443
276 Ga0075430_100233143
277 Ga0075431_100032002
278 Ga0068865_100713797
279 Ga0097620_100095033
280 Ga0111539_10000097
281 Ga0105245_10162949
282 Ga0105247_10143606
283 Ga0105243_10334218
284 Ga0105241_10116140
285 Ga0105239_10569908
286 Ga0105246_10115054
287 Ga0157378_11027062
288 Ga0157375_10686219
289 Ga0163163_10337857
290 Ga0157380_10043467
291 Ga0157380_10053108
292 Ga0157380_10067886
293 Ga0157380_11174373
294 Ga0163161_10198552
295 Ga0213876_10252867
296 Ga0209436_100130
297 Ga0209130_1000005
298 Ga0209130_1000749
299 Ga0209676_1001927
300 Ga0209676_1035952
301 Ga0209025_1000847
302 Ga0209564_1000113
303 Ga0209758_1002804
304 Ga0209256_1003107
305 Ga0207426_1000015
306 Ga0207426_1000616
307 Ga0209051_1001056
308 Ga0209257_1001948
309 Ga0207642_10197848
310 Ga0207710_10090380
311 Ga0207680_10294701
312 Ga0207643_10128735
313 Ga0207681_10481064
314 Ga0207650_10103458
315 Ga0207659_10469901
316 Ga0207670_10113699
317 Ga0207669_10091186
318 Ga0207689_10086124
319 Ga0207658_10308052
320 Ga0207639_10138777
321 Ga0207708_10341198
322 Ga0207708_10884889
323 Ga0207641_10455185
324 Ga0207648_10638873
325 Ga0207676_10139317
326 Ga0207675_100125941
327 Ga0207675_100537047
328 Ga0209813_10004452
329 Ga0207428_10000217
330 Ga0268266_10047541
331 Ga0268265_10392441
332 Ga0268265_10527229
333 Ga0307515_10535405
334 Ga0307508_10110636
335 Ga0307507_10315261
336 Ga0439453_0009967
337 Ga0439435_0054136
338 Ga0439444_0075123
339 Ga0451576_0509981
340 Ga0495638_0093884
341 Ga0495621_0106685
342 Ga0495676_0547888
343 Ga0496104_0000563
344 Ga0496105_0037201
345 Ga0496108_0016887
346 Ga0496109_0013984
347 Ga0496110_0001015
348 Ga0496111_0003281
349 Ga0496111_0209201
350 Ga0496112_0037214
351 Ga0496113_0001191
352 Ga0496126_0053630
353 Ga0501031_0167421
354 Ga0501031_0318600
355 Ga0501032_0000064
356 Ga0501032_0357408
357 Ga0501033_0000330
358 Ga0501033_0181930
359 Ga0501034_0000174
360 Ga0501034_0053804
361 Ga0501034_0160553
362 Ga0501034_0769586
363 Ga0501036_0000399
364 Ga0501036_0737937
365 Ga0501037_0000163
366 Ga0501038_0000031
367 Ga0501038_0330678
368 Ga0501039_0000057
369 Ga0501039_0118046
370 Ga0501041_0121967
371 Ga0501043_0000048
372 Ga0501043_0327116
373 Ga0501047_0121232
374 Ga0501071_0410804
375 Ga0501074_0193232
376 Ga0501075_0105736
377 Ga0501076_0020423
378 Ga0501076_0307525
379 Ga0501077_0004813
380 Ga0501035_0000198
381 Ga0501035_0007909
382 Ga0501044_0026761
383 Ga0501044_0226117
384 nmdc:mga03683_184094_c1
385 nmdc:mga03683_8846_c1
386 nmdc:mga03n38_3994_c1
387 nmdc:mga03n38_41327_c1
388 nmdc:mga03n38_81880_c1
389 nmdc:mga03n38_99750_c1
390 nmdc:mga00v17_41247_c1
391 nmdc:mga00v17_54679_c1
392 nmdc:mga0yw44_18172_c1
393 nmdc:mga0yw44_35745_c1
394 nmdc:mga0k408_1870_c1
395 nmdc:mga06z11_4884_c1
396 nmdc:mga06z11_490779_c1
397 nmdc:mga04h51_38243_c1
398 nmdc:mga04h51_55539_c1
399 nmdc:mga07m45_233343_c1
400 nmdc:mga07m45_42231_c1
401 nmdc:mga07m45_479603_c1
402 nmdc:mga0qj67_212472_c1
403 nmdc:mga06r32_24488_c1
404 nmdc:mga08y16_88_c1
405 nmdc:mga0sz30_47257_c1
406 Ga0500644_0015224
407 Ga0500616_0018562
408 Ga0500616_0046979
409 Ga0501084_0042349
410 Ga0501082_0026146
411 Ga0501082_0225799
412 Ga0530510_0026347
413 2600195357
414 2644103710
415 2644306640
416 2644330830
417 2644612251
418 2644671549
419 2739306501
420 2756671454
421 2821445108
422 2844008638
423 2844170014
424 2871468243
425 2882632486
426 2883293414
427 2883357999
428 2906379192
429 2941506606
430 8002287841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

3

78

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

8

73

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

68

179

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

104

174

0.89

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

72

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m0f-assembly1.cif.gz_A crystal structure of glutathione s transferase in complex with glutathione from pseudomonas fluorescens 0.9018 1 201
4glt-assembly2.cif.gz_C crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound 0.8923 2 204
3m0f-assembly1.cif.gz_A crystal structure of glutathione s transferase in complex with glutathione from pseudomonas fluorescens 0.8892 1 201
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.8851 2 202
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.8832 1 200
ID Description Score Start End Superfamily
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9167 1 78 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9045 2 73 3.40.30.10
5u51D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8997 2 73 3.40.30.10
4ijiG02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8989 81 194 1.20.1050.10
3totA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8857 81 194 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A395KQY7-F1-model_v4 deleted 0.9698 2 208
AF-A0A7W6A1C9-F1-model_v4 Glutathione S-transferase 0.9622 2 207 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-J3I2D8-F1-model_v4 Glutathione S-transferase 0.9614 2 207 GO:0016740
AF-A0A4Q0RU07-F1-model_v4 Glutathione S-transferase 0.9609 1 207 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A395KQY7-F1-model_v4 deleted 0.9607 2 208

Map