F326606

General Info

Members Datasets Scaffolds Average Seq Length
215 149 430 166

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10185397|Ga0307410_101853972
Length 174
Sequence MGGEGKLPSPDAPPAGGEGLVTDLGWMAIALEEARLAVQHADVPVGAVVVDALGRELARAHNRREIDADPTAHAEVLALRAAAVARGHWRLDDCTLFVTLEPCAMCAGAMVNARLGRLVFGATDPKAGAVISLFRLAEDRRLNHRFAVTAGCAPEPSVALLQSFFRSLRARGEK

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 1.4
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10185397 3300031852 Bacteria 1579
2 MBSR1b_contig_4856533 2162886012 Bacteria 1027
3 rootH2_10053915 3300003320 Bacteria 5753
4 Ga0065715_10005628 3300005293 Bacteria 4057
5 Ga0070658_11010250 3300005327 Bacteria 723
6 Ga0070676_10666704 3300005328 Bacteria 757
7 Ga0070690_100288434 3300005330 Bacteria 1173
8 Ga0068869_100482540 3300005334 Bacteria 1032
9 Ga0070680_100003749 3300005336 Bacteria 11356
10 Ga0070680_100006806 3300005336 Bacteria 8709
11 Ga0070680_100558067 3300005336 Bacteria 982
12 Ga0070680_100736560 3300005336 Bacteria 848
13 Ga0070680_100781946 3300005336 Bacteria 822
14 Ga0070682_100002963 3300005337 Bacteria 9420
15 Ga0070682_100021274 3300005337 Bacteria 3825
16 Ga0068868_100005590 3300005338 Bacteria 8840
17 Ga0070660_100295240 3300005339 Bacteria 1328
18 Ga0070691_10428866 3300005341 Bacteria 751
19 Ga0070687_100032486 3300005343 Bacteria 2568
20 Ga0070692_10239793 3300005345 Bacteria 1080
21 Ga0070669_100409779 3300005353 Bacteria 1111
22 Ga0070674_100291447 3300005356 Bacteria 1297
23 Ga0070673_100853430 3300005364 Bacteria 843
24 Ga0070659_100709004 3300005366 Bacteria 870
25 Ga0070714_100219260 3300005435 Bacteria 1748
26 Ga0070701_10123360 3300005438 Bacteria 1463
27 Ga0070705_100132501 3300005440 Bacteria 1628
28 Ga0070700_100005542 3300005441 Bacteria 6692
29 Ga0070708_100001280 3300005445 Bacteria 19354
30 Ga0070662_100007174 3300005457 Bacteria 7218
31 Ga0070681_10006167 3300005458 Bacteria 11644
32 Ga0070681_10036149 3300005458 Bacteria 4961
33 Ga0070681_10175068 3300005458 Bacteria 2067
34 Ga0068867_100050497 3300005459 Unclassified 3066
35 Ga0068867_100050600 3300005459 Bacteria 3063
36 Ga0068867_100115841 3300005459 Bacteria 2065
37 Ga0068867_100474177 3300005459 Bacteria 1071
38 Ga0070707_100001470 3300005468 Bacteria 23082
39 Ga0070707_101145883 3300005468 Bacteria 744
40 Ga0070698_100073606 3300005471 Bacteria 3422
41 Ga0070699_100347364 3300005518 Bacteria 1336
42 Ga0070699_100842476 3300005518 Bacteria 839
43 Ga0070679_100000561 3300005530 Bacteria 31548
44 Ga0070679_100060601 3300005530 Bacteria 3771
45 Ga0070679_100334518 3300005530 Bacteria 1463
46 Ga0070679_100392212 3300005530 Bacteria 1334
47 Ga0070684_100005970 3300005535 Bacteria 9382
48 Ga0070697_100418678 3300005536 Bacteria 1164
49 Ga0068853_100092817 3300005539 Bacteria 2656
50 Ga0068853_100542905 3300005539 Bacteria 1100
51 Ga0070672_100893210 3300005543 Bacteria 785
52 Ga0070686_100011687 3300005544 Bacteria 4988
53 Ga0070695_100384506 3300005545 Bacteria 1060
54 Ga0070696_100094263 3300005546 Bacteria 2136
55 Ga0070704_100368721 3300005549 Bacteria 1217
56 Ga0070704_100538674 3300005549 Bacteria 1018
57 Ga0068855_100004528 3300005563 Bacteria 16978
58 Ga0068855_100876604 3300005563 Bacteria 949
59 Ga0068855_100925768 3300005563 Bacteria 920
60 Ga0070664_100000860 3300005564 Bacteria 23476
61 Ga0070664_100357712 3300005564 Bacteria 1329
62 Ga0068857_100009452 3300005577 Bacteria 8466
63 Ga0068854_100708383 3300005578 Bacteria 870
64 Ga0068854_100819429 3300005578 Bacteria 812
65 Ga0070702_100085057 3300005615 Bacteria 1904
66 Ga0068859_100286480 3300005617 Bacteria 1740
67 Ga0068866_10196302 3300005718 Bacteria 1203
68 Ga0068861_100005971 3300005719 Bacteria 8271
69 Ga0068861_100131602 3300005719 Bacteria 2031
70 Ga0068860_100468904 3300005843 Bacteria 1254
71 Ga0068871_100700105 3300006358 Bacteria 928
72 Ga0075430_100389185 3300006846 Bacteria 1150
73 Ga0075433_10353517 3300006852 Bacteria 1298
74 Ga0075434_100017968 3300006871 Bacteria 6824
75 Ga0068865_100115912 3300006881 Bacteria 1984
76 Ga0068865_100371078 3300006881 Bacteria 1164
77 Ga0075436_100113178 3300006914 Bacteria 1895
78 Ga0097620_100286454 3300006931 Bacteria 1740
79 Ga0105240_10223074 3300009093 Bacteria 2195
80 Ga0111539_11834988 3300009094 Bacteria 703
81 Ga0105245_10021390 3300009098 Bacteria 5674
82 Ga0114129_10192375 3300009147 Bacteria 2769
83 Ga0105243_10235954 3300009148 Bacteria 1625
84 Ga0105248_11047868 3300009177 Bacteria 922
85 Ga0099796_10155526 3300010159 Bacteria 903
86 Ga0157373_10031017 3300013100 Bacteria 3847
87 Ga0157373_10168474 3300013100 Bacteria 1542
88 Ga0157373_10271279 3300013100 Bacteria 1201
89 Ga0157373_10340419 3300013100 Bacteria 1069
90 Ga0157373_10500866 3300013100 Bacteria 877
91 Ga0157371_10078247 3300013102 Bacteria 2342
92 Ga0157371_10562617 3300013102 Bacteria 846
93 Ga0157369_10018446 3300013105 Bacteria 7824
94 Ga0157369_10283429 3300013105 Bacteria 1725
95 Ga0157369_11545504 3300013105 Bacteria 675
96 Ga0157378_10003245 3300013297 Bacteria 14461
97 Ga0157378_10012659 3300013297 Bacteria 7381
98 Ga0157378_10027468 3300013297 Bacteria 5022
99 Ga0157372_10006062 3300013307 Bacteria 12845
100 Ga0157372_10279305 3300013307 Bacteria 1941
101 Ga0157372_10602312 3300013307 Bacteria 1281
102 Ga0157372_10869045 3300013307 Bacteria 1047
103 Ga0157372_11806869 3300013307 Bacteria 703
104 Ga0157375_10020417 3300013308 Bacteria 6051
105 Ga0163163_10030767 3300014325 Bacteria 5176
106 Ga0157380_10172321 3300014326 Bacteria 1892
107 Ga0207653_10123391 3300025885 Bacteria 934
108 Ga0207682_10026285 3300025893 Bacteria 2313
109 Ga0207642_10003074 3300025899 Bacteria 5229
110 Ga0207645_10022763 3300025907 Bacteria 4073
111 Ga0207645_10445095 3300025907 Bacteria 874
112 Ga0207705_10007822 3300025909 Bacteria 7850
113 Ga0207705_10923701 3300025909 Bacteria 676
114 Ga0207684_10476251 3300025910 Bacteria 1071
115 Ga0207707_10003325 3300025912 Bacteria 14287
116 Ga0207707_10020185 3300025912 Bacteria 5817
117 Ga0207707_10041847 3300025912 Bacteria 4000
118 Ga0207707_10157799 3300025912 Bacteria 1984
119 Ga0207695_10166659 3300025913 Bacteria 2131
120 Ga0207660_10012633 3300025917 Bacteria 5530
121 Ga0207660_10021658 3300025917 Bacteria 4325
122 Ga0207660_10665063 3300025917 Bacteria 849
123 Ga0207662_10100888 3300025918 Bacteria 1788
124 Ga0207657_10023366 3300025919 Bacteria 5757
125 Ga0207649_10002563 3300025920 Bacteria 10108
126 Ga0207652_10001386 3300025921 Bacteria 21574
127 Ga0207652_10027689 3300025921 Bacteria 4725
128 Ga0207652_10031612 3300025921 Bacteria 4447
129 Ga0207652_10466341 3300025921 Bacteria 1138
130 Ga0207652_10742945 3300025921 Bacteria 874
131 Ga0207646_10882408 3300025922 Bacteria 794
132 Ga0207681_10237876 3300025923 Bacteria 1416
133 Ga0207681_10642769 3300025923 Bacteria 879
134 Ga0207664_10213987 3300025929 Bacteria 1669
135 Ga0207644_10016067 3300025931 Bacteria 5033
136 Ga0207690_10475699 3300025932 Bacteria 1008
137 Ga0207690_10662118 3300025932 Bacteria 856
138 Ga0207690_11235542 3300025932 Bacteria 624
139 Ga0207706_10004784 3300025933 Bacteria 12681
140 Ga0207706_10375712 3300025933 Bacteria 1234
141 Ga0207706_11141200 3300025933 Bacteria 650
142 Ga0207669_10240163 3300025937 Bacteria 1342
143 Ga0207704_10174088 3300025938 Bacteria 1547
144 Ga0207689_10673973 3300025942 Bacteria 872
145 Ga0207679_10037888 3300025945 Bacteria 3432
146 Ga0207679_10750475 3300025945 Bacteria 888
147 Ga0207667_10036846 3300025949 Bacteria 5237
148 Ga0207667_10484010 3300025949 Bacteria 1256
149 Ga0207667_10775917 3300025949 Bacteria 957
150 Ga0207651_10861620 3300025960 Bacteria 805
151 Ga0207640_10282459 3300025981 Bacteria 1304
152 Ga0207677_10116048 3300026023 Bacteria 2004
153 Ga0207639_10126148 3300026041 Bacteria 2111
154 Ga0207639_10344671 3300026041 Bacteria 1329
155 Ga0207678_10019612 3300026067 Bacteria 5944
156 Ga0207708_10001716 3300026075 Bacteria 16222
157 Ga0207648_10057518 3300026089 Bacteria 3393
158 Ga0207648_10060708 3300026089 Bacteria 3297
159 Ga0207648_10068964 3300026089 Unclassified 3081
160 Ga0207648_10156250 3300026089 Bacteria 2013
161 Ga0207648_10607795 3300026089 Bacteria 1008
162 Ga0207674_10026617 3300026116 Bacteria 6136
163 Ga0207675_100651169 3300026118 Bacteria 1060
164 Ga0207683_10092368 3300026121 Bacteria 2697
165 Ga0207698_11063324 3300026142 Bacteria 821
166 Ga0209998_10000587 3300027717 Bacteria 9800
167 Ga0209974_10073636 3300027876 Bacteria 1168
168 Ga0268264_10174925 3300028381 Bacteria 1945
169 Ga0307408_100409558 3300031548 Bacteria 1166
170 Ga0307405_10200653 3300031731 Bacteria 1448
171 Ga0307413_10145221 3300031824 Bacteria 1646
172 Ga0307413_10311362 3300031824 Bacteria 1198
173 Ga0307406_10009420 3300031901 Bacteria 5475
174 Ga0307407_10019392 3300031903 Bacteria 3462
175 Ga0307412_10165278 3300031911 Bacteria 1649
176 Ga0307409_100645562 3300031995 Bacteria 1051
177 Ga0307416_100068557 3300032002 Bacteria 2931
178 Ga0307416_100078278 3300032002 Bacteria 2781
179 Ga0307411_10027419 3300032005 Bacteria 3446
180 Ga0307411_10099057 3300032005 Bacteria 2056
181 Ga0307411_10210767 3300032005 Bacteria 1500
182 Ga0307415_100094537 3300032126 Bacteria 2173
183 Ga0307415_100738749 3300032126 Bacteria 892
184 Ga0373958_0097633 3300034819 Bacteria 685
185 Ga0373941_0046332 3300035115 Bacteria 1365
186 Ga0373935_0113120 3300035692 Bacteria 1804
187 Ga0316582_0153424 3300036647 Bacteria 1558
188 Ga0316584_0441365 3300036712 Bacteria 922
189 Ga0439434_0043797 3300042435 Bacteria 1378
190 Ga0466957_0410078 3300044842 Bacteria 928
191 Ga0451576_0111850 3300045051 Bacteria 2842
192 Ga0495590_0232533 3300046457 Bacteria 683
193 Ga0495643_0098073 3300046522 Bacteria 1505
194 Ga0495642_0074440 3300046528 Bacteria 1424
195 Ga0496106_0360931 3300048909 Bacteria 1167
196 Ga0496112_0135568 3300048915 Bacteria 2432
197 Ga0496113_0294444 3300048916 Bacteria 1299
198 Ga0501038_0986049 3300049574 Bacteria 619
199 Ga0501047_0016151 3300049581 Bacteria 7122
200 Ga0501048_0169199 3300049582 Bacteria 1548
201 Ga0501067_0180569 3300049583 Bacteria 1175
202 Ga0501070_0384889 3300049586 Bacteria 1136
203 Ga0501070_0419597 3300049586 Bacteria 1081
204 Ga0501077_0028549 3300049593 Bacteria 3546
205 nmdc:mga0k408_235438_c1 3300050493 Bacteria 1093
206 nmdc:mga05p37_164520_c1 3300050507 Bacteria 2708
207 nmdc:mga0qj67_191772_c2 3300050509 Bacteria 700
208 nmdc:mga08y16_1168237_c1 3300050511 Bacteria 742
209 nmdc:mga0n895_33799_c1 3300050512 Bacteria 4916
210 nmdc:mga0rr50_284666_c1 3300050513 Bacteria 1380
211 nmdc:mga08x19_58589_c1 3300050514 Bacteria 2491
212 nmdc:mga0a205_861755_c1 3300050515 Bacteria 753
213 Ga0500583_0262261 3300053092 Bacteria 851
214 Ga0500650_0412239 3300053098 Bacteria 583
215 Ga0530510_0673952 3300061734 Bacteria 788
216 Ga0307410_10185397
217 MBSR1b_contig_4856533
218 rootH2_10053915
219 Ga0065715_10005628
220 Ga0070658_11010250
221 Ga0070676_10666704
222 Ga0070690_100288434
223 Ga0068869_100482540
224 Ga0070680_100003749
225 Ga0070680_100006806
226 Ga0070680_100558067
227 Ga0070680_100736560
228 Ga0070680_100781946
229 Ga0070682_100002963
230 Ga0070682_100021274
231 Ga0068868_100005590
232 Ga0070660_100295240
233 Ga0070691_10428866
234 Ga0070687_100032486
235 Ga0070692_10239793
236 Ga0070669_100409779
237 Ga0070674_100291447
238 Ga0070673_100853430
239 Ga0070659_100709004
240 Ga0070714_100219260
241 Ga0070701_10123360
242 Ga0070705_100132501
243 Ga0070700_100005542
244 Ga0070708_100001280
245 Ga0070662_100007174
246 Ga0070681_10006167
247 Ga0070681_10036149
248 Ga0070681_10175068
249 Ga0068867_100050497
250 Ga0068867_100050600
251 Ga0068867_100115841
252 Ga0068867_100474177
253 Ga0070707_100001470
254 Ga0070707_101145883
255 Ga0070698_100073606
256 Ga0070699_100347364
257 Ga0070699_100842476
258 Ga0070679_100000561
259 Ga0070679_100060601
260 Ga0070679_100334518
261 Ga0070679_100392212
262 Ga0070684_100005970
263 Ga0070697_100418678
264 Ga0068853_100092817
265 Ga0068853_100542905
266 Ga0070672_100893210
267 Ga0070686_100011687
268 Ga0070695_100384506
269 Ga0070696_100094263
270 Ga0070704_100368721
271 Ga0070704_100538674
272 Ga0068855_100004528
273 Ga0068855_100876604
274 Ga0068855_100925768
275 Ga0070664_100000860
276 Ga0070664_100357712
277 Ga0068857_100009452
278 Ga0068854_100708383
279 Ga0068854_100819429
280 Ga0070702_100085057
281 Ga0068859_100286480
282 Ga0068866_10196302
283 Ga0068861_100005971
284 Ga0068861_100131602
285 Ga0068860_100468904
286 Ga0068871_100700105
287 Ga0075430_100389185
288 Ga0075433_10353517
289 Ga0075434_100017968
290 Ga0068865_100115912
291 Ga0068865_100371078
292 Ga0075436_100113178
293 Ga0097620_100286454
294 Ga0105240_10223074
295 Ga0111539_11834988
296 Ga0105245_10021390
297 Ga0114129_10192375
298 Ga0105243_10235954
299 Ga0105248_11047868
300 Ga0099796_10155526
301 Ga0157373_10031017
302 Ga0157373_10168474
303 Ga0157373_10271279
304 Ga0157373_10340419
305 Ga0157373_10500866
306 Ga0157371_10078247
307 Ga0157371_10562617
308 Ga0157369_10018446
309 Ga0157369_10283429
310 Ga0157369_11545504
311 Ga0157378_10003245
312 Ga0157378_10012659
313 Ga0157378_10027468
314 Ga0157372_10006062
315 Ga0157372_10279305
316 Ga0157372_10602312
317 Ga0157372_10869045
318 Ga0157372_11806869
319 Ga0157375_10020417
320 Ga0163163_10030767
321 Ga0157380_10172321
322 Ga0207653_10123391
323 Ga0207682_10026285
324 Ga0207642_10003074
325 Ga0207645_10022763
326 Ga0207645_10445095
327 Ga0207705_10007822
328 Ga0207705_10923701
329 Ga0207684_10476251
330 Ga0207707_10003325
331 Ga0207707_10020185
332 Ga0207707_10041847
333 Ga0207707_10157799
334 Ga0207695_10166659
335 Ga0207660_10012633
336 Ga0207660_10021658
337 Ga0207660_10665063
338 Ga0207662_10100888
339 Ga0207657_10023366
340 Ga0207649_10002563
341 Ga0207652_10001386
342 Ga0207652_10027689
343 Ga0207652_10031612
344 Ga0207652_10466341
345 Ga0207652_10742945
346 Ga0207646_10882408
347 Ga0207681_10237876
348 Ga0207681_10642769
349 Ga0207664_10213987
350 Ga0207644_10016067
351 Ga0207690_10475699
352 Ga0207690_10662118
353 Ga0207690_11235542
354 Ga0207706_10004784
355 Ga0207706_10375712
356 Ga0207706_11141200
357 Ga0207669_10240163
358 Ga0207704_10174088
359 Ga0207689_10673973
360 Ga0207679_10037888
361 Ga0207679_10750475
362 Ga0207667_10036846
363 Ga0207667_10484010
364 Ga0207667_10775917
365 Ga0207651_10861620
366 Ga0207640_10282459
367 Ga0207677_10116048
368 Ga0207639_10126148
369 Ga0207639_10344671
370 Ga0207678_10019612
371 Ga0207708_10001716
372 Ga0207648_10057518
373 Ga0207648_10060708
374 Ga0207648_10068964
375 Ga0207648_10156250
376 Ga0207648_10607795
377 Ga0207674_10026617
378 Ga0207675_100651169
379 Ga0207683_10092368
380 Ga0207698_11063324
381 Ga0209998_10000587
382 Ga0209974_10073636
383 Ga0268264_10174925
384 Ga0307408_100409558
385 Ga0307405_10200653
386 Ga0307413_10145221
387 Ga0307413_10311362
388 Ga0307406_10009420
389 Ga0307407_10019392
390 Ga0307412_10165278
391 Ga0307409_100645562
392 Ga0307416_100068557
393 Ga0307416_100078278
394 Ga0307411_10027419
395 Ga0307411_10099057
396 Ga0307411_10210767
397 Ga0307415_100094537
398 Ga0307415_100738749
399 Ga0373958_0097633
400 Ga0373941_0046332
401 Ga0373935_0113120
402 Ga0316582_0153424
403 Ga0316584_0441365
404 Ga0439434_0043797
405 Ga0466957_0410078
406 Ga0451576_0111850
407 Ga0495590_0232533
408 Ga0495643_0098073
409 Ga0495642_0074440
410 Ga0496106_0360931
411 Ga0496112_0135568
412 Ga0496113_0294444
413 Ga0501038_0986049
414 Ga0501047_0016151
415 Ga0501048_0169199
416 Ga0501067_0180569
417 Ga0501070_0384889
418 Ga0501070_0419597
419 Ga0501077_0028549
420 nmdc:mga0k408_235438_c1
421 nmdc:mga05p37_164520_c1
422 nmdc:mga0qj67_191772_c2
423 nmdc:mga08y16_1168237_c1
424 nmdc:mga0n895_33799_c1
425 nmdc:mga0rr50_284666_c1
426 nmdc:mga08x19_58589_c1
427 nmdc:mga0a205_861755_c1
428 Ga0500583_0262261
429 Ga0500650_0412239
430 Ga0530510_0673952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

21

122

0.96

PF14437

MafB19-deam

MafB19-like deaminase

21

169

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9672 21 120
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9654 21 119
8e2r-assembly1.cif.gz_A crystal structure of tadac-1.14 0.9616 22 163
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9573 22 169
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.953 22 169
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9668 61 120 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9582 20 168 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9538 24 125 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9503 22 167 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9471 22 169 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A496KN30-F1-model_v4 deleted 0.9899 22 119
AF-A0A7X6VAJ3-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9897 25 113 GO:0002100
GO:0008270
GO:0052717
AF-T0EE66-F1-model_v4 deleted 0.9886 24 114
AF-A0A3D4TFJ3-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.988 22 122 GO:0002100
GO:0008270
GO:0052717
AF-A0A7C6WKE4-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9879 23 102 GO:0002100
GO:0052717

Map