F326233

General Info

Members Datasets Scaffolds Average Seq Length
215 147 215 241

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100743401|Ga0068857_1007434012
Length 249
Sequence VNGLVRKAVLLAAGRGTRMRDLTNELPKPMIEVRGKPILHHIIEVLHQAGISDVLIIVGYRADTVRAYFGDGARFGVAITYTTQVVQDGTGRVVELAKEFAGKDPFVLSYGDILIEPRNYRRLVALGDAEAMISVKKNEDVSKGGAVFVNERFELIDLREKPQPGEPTSPWYNAGVYTFRPSIFQFTARLEKSPRGEYELTDAVRALALNGCRVQAFELAGEWADVRDPEILAELNSRGAVRSADPAAL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.16
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000001 3300003203 Bacteria 251772
2 JGI25405J52794_10000454 3300003911 Bacteria 5807
3 Ga0065704_10007231 3300005289 Unclassified 2346
4 Ga0065712_10006356 3300005290 Bacteria 3680
5 Ga0065712_10254593 3300005290 Unclassified 951
6 Ga0065715_10000207 3300005293 Bacteria 34609
7 Ga0065715_10011184 3300005293 Bacteria 3161
8 Ga0070658_10000314 3300005327 Bacteria 41791
9 Ga0070658_10195357 3300005327 Bacteria 1706
10 Ga0070676_10029465 3300005328 Bacteria 3122
11 Ga0070670_100226272 3300005331 Unclassified 1627
12 Ga0070666_10090139 3300005335 Bacteria 2105
13 Ga0070660_100417394 3300005339 Bacteria 1111
14 Ga0070689_100023705 3300005340 Bacteria 4598
15 Ga0070668_100006202 3300005347 Bacteria 8854
16 Ga0070669_100001429 3300005353 Bacteria 17266
17 Ga0070675_100021406 3300005354 Bacteria 5167
18 Ga0070675_100543453 3300005354 Bacteria 1050
19 Ga0070671_100032141 3300005355 Bacteria 4340
20 Ga0070671_100151677 3300005355 Unclassified 1957
21 Ga0070674_100000780 3300005356 Bacteria 16336
22 Ga0070688_100125958 3300005365 Bacteria 1721
23 Ga0070709_10090221 3300005434 Bacteria 2020
24 Ga0070709_10227711 3300005434 Unclassified 1332
25 Ga0070714_100222123 3300005435 Bacteria 1737
26 Ga0070713_100357619 3300005436 Unclassified 1356
27 Ga0070701_10092567 3300005438 Bacteria 1659
28 Ga0070711_100079771 3300005439 Bacteria 2329
29 Ga0070705_100305503 3300005440 Bacteria 1142
30 Ga0070708_100182569 3300005445 Bacteria 1961
31 Ga0070708_100212511 3300005445 Bacteria 1813
32 Ga0070663_100497075 3300005455 Unclassified 1012
33 Ga0070678_100062545 3300005456 Bacteria 2749
34 Ga0070662_100013651 3300005457 Bacteria 5408
35 Ga0070706_100003521 3300005467 Bacteria 15387
36 Ga0070706_100012129 3300005467 Bacteria 7994
37 Ga0070706_100115222 3300005467 Bacteria 2503
38 Ga0070707_100014343 3300005468 Bacteria 7429
39 Ga0070707_100041525 3300005468 Unclassified 4403
40 Ga0070707_100135602 3300005468 Bacteria 2395
41 Ga0070698_100006743 3300005471 Bacteria 12449
42 Ga0070698_100008810 3300005471 Bacteria 10857
43 Ga0070698_100010716 3300005471 Bacteria 9763
44 Ga0070698_100051366 3300005471 Unclassified 4199
45 Ga0070698_100795032 3300005471 Bacteria 890
46 Ga0070699_100231798 3300005518 Bacteria 1647
47 Ga0070697_100000889 3300005536 Bacteria 22458
48 Ga0070697_100186625 3300005536 Bacteria 1759
49 Ga0070697_100430251 3300005536 Unclassified 1148
50 Ga0068853_100000002 3300005539 Bacteria 485323
51 Ga0070695_100062391 3300005545 Unclassified 2420
52 Ga0070696_100021487 3300005546 Unclassified 4375
53 Ga0070693_100377067 3300005547 Bacteria 977
54 Ga0070665_100223687 3300005548 Bacteria 1883
55 Ga0070665_100520407 3300005548 Bacteria 1201
56 Ga0068855_100007176 3300005563 Bacteria 13521
57 Ga0068857_100743401 3300005577 Bacteria 934
58 Ga0068856_100044681 3300005614 Bacteria 4361
59 Ga0070702_100095572 3300005615 Unclassified 1812
60 Ga0068859_100476154 3300005617 Unclassified 1344
61 Ga0068866_10006711 3300005718 Unclassified 4799
62 Ga0068862_100250816 3300005844 Unclassified 1613
63 Ga0081455_10000314 3300005937 Bacteria 63484
64 Ga0081455_10000959 3300005937 Bacteria 36868
65 Ga0081455_10018047 3300005937 Bacteria 6739
66 Ga0081455_10034338 3300005937 Unclassified 4545
67 Ga0081455_10065366 3300005937 Bacteria 3042
68 Ga0081455_10090032 3300005937 Bacteria 2489
69 Ga0081539_10000014 3300005985 Bacteria 411270
70 Ga0081539_10005852 3300005985 Bacteria 12194
71 Ga0070717_10125108 3300006028 Unclassified 2206
72 Ga0070716_100145826 3300006173 Bacteria 1516
73 Ga0070712_100078038 3300006175 Bacteria 2389
74 Ga0070712_100107523 3300006175 Unclassified 2075
75 Ga0070712_100609471 3300006175 Unclassified 925
76 Ga0068871_100062686 3300006358 Bacteria 3039
77 Ga0068871_100243598 3300006358 Bacteria 1564
78 Ga0075434_100202211 3300006871 Bacteria 2007
79 Ga0075434_100555340 3300006871 Bacteria 1168
80 Ga0075429_100269666 3300006880 Bacteria 1491
81 Ga0068865_100019590 3300006881 Bacteria 4380
82 Ga0097620_100476142 3300006931 Unclassified 1344
83 Ga0105240_10000022 3300009093 Bacteria 387911
84 Ga0105240_10396126 3300009093 Unclassified 1556
85 Ga0111539_10148139 3300009094 Bacteria 2748
86 Ga0105245_10022602 3300009098 Bacteria 5521
87 Ga0114129_10152701 3300009147 Bacteria 3159
88 Ga0105242_10044238 3300009176 Bacteria 3605
89 Ga0105238_10339698 3300009551 Bacteria 1489
90 Ga0105249_10071958 3300009553 Bacteria 3195
91 Ga0105249_10916749 3300009553 Unclassified 943
92 Ga0105239_10647611 3300010375 Bacteria 1207
93 Ga0157371_10473442 3300013102 Unclassified 923
94 Ga0157378_10115638 3300013297 Bacteria 2465
95 Ga0157378_10120941 3300013297 Bacteria 2413
96 Ga0163162_10004249 3300013306 Bacteria 13776
97 Ga0163162_10463445 3300013306 Bacteria 1399
98 Ga0157372_10019851 3300013307 Bacteria 7242
99 Ga0157372_10067448 3300013307 Bacteria 4020
100 Ga0157372_10231805 3300013307 Bacteria 2141
101 Ga0157375_10117806 3300013308 Bacteria 2762
102 Ga0157375_10413175 3300013308 Unclassified 1516
103 Ga0157377_10517622 3300014745 Unclassified 837
104 Ga0157379_10121608 3300014968 Bacteria 2348
105 Ga0157376_10000519 3300014969 Bacteria 24874
106 Ga0157376_10170336 3300014969 Bacteria 1982
107 Ga0157376_10432241 3300014969 Unclassified 1280
108 Ga0163161_10002181 3300017792 Bacteria 14119
109 Ga0207697_10000681 3300025315 Bacteria 19317
110 Ga0207688_10005383 3300025901 Bacteria 6954
111 Ga0207685_10002754 3300025905 Bacteria 4105
112 Ga0207699_10004656 3300025906 Bacteria 6562
113 Ga0207645_10001228 3300025907 Bacteria 21121
114 Ga0207705_10000430 3300025909 Bacteria 36578
115 Ga0207705_10120803 3300025909 Bacteria 1944
116 Ga0207684_10000333 3300025910 Bacteria 65788
117 Ga0207684_10006692 3300025910 Bacteria 10473
118 Ga0207684_10008775 3300025910 Bacteria 8975
119 Ga0207684_10026333 3300025910 Unclassified 4958
120 Ga0207684_10307207 3300025910 Bacteria 1367
121 Ga0207695_10000022 3300025913 Bacteria 659090
122 Ga0207693_10093358 3300025915 Unclassified 2358
123 Ga0207693_10096129 3300025915 Unclassified 2322
124 Ga0207663_10012205 3300025916 Bacteria 4637
125 Ga0207657_10275897 3300025919 Bacteria 1336
126 Ga0207646_10004113 3300025922 Bacteria 16011
127 Ga0207646_10016080 3300025922 Bacteria 7030
128 Ga0207646_10030531 3300025922 Unclassified 4884
129 Ga0207646_10080784 3300025922 Unclassified 2907
130 Ga0207646_10359920 3300025922 Bacteria 1314
131 Ga0207681_10008231 3300025923 Bacteria 6378
132 Ga0207694_10140016 3300025924 Bacteria 1945
133 Ga0207659_10120679 3300025926 Bacteria 2008
134 Ga0207700_10013284 3300025928 Bacteria 5351
135 Ga0207664_10091892 3300025929 Bacteria 2490
136 Ga0207664_10247851 3300025929 Unclassified 1553
137 Ga0207644_10009724 3300025931 Bacteria 6322
138 Ga0207644_10011970 3300025931 Bacteria 5753
139 Ga0207706_10023356 3300025933 Bacteria 5553
140 Ga0207686_10278181 3300025934 Unclassified 1234
141 Ga0207669_10004027 3300025937 Bacteria 6430
142 Ga0207704_10018396 3300025938 Bacteria 3646
143 Ga0207704_10135355 3300025938 Bacteria 1714
144 Ga0207665_10009733 3300025939 Bacteria 6310
145 Ga0207665_10183227 3300025939 Bacteria 1517
146 Ga0207665_10202066 3300025939 Unclassified 1448
147 Ga0207665_10527693 3300025939 Unclassified 915
148 Ga0207691_10001630 3300025940 Bacteria 22283
149 Ga0207689_10353440 3300025942 Bacteria 1222
150 Ga0207667_10005675 3300025949 Bacteria 15214
151 Ga0207677_10414634 3300026023 Unclassified 1145
152 Ga0207703_10005011 3300026035 Bacteria 10737
153 Ga0207639_10000009 3300026041 Bacteria 432727
154 Ga0207674_10714478 3300026116 Unclassified 967
155 Ga0207683_10188774 3300026121 Unclassified 1870
156 Ga0268266_10343198 3300028379 Bacteria 1402
157 Ga0268266_10651787 3300028379 Unclassified 1013
158 Ga0373956_0156568 3300035119 Bacteria 1073
159 Ga0373955_0299509 3300035172 Unclassified 969
160 Ga0373935_0106108 3300035692 Unclassified 1859
161 Ga0373935_0313958 3300035692 Bacteria 1111
162 Ga0373933_0064833 3300035724 Bacteria 2211
163 Ga0373947_0028743 3300035725 Bacteria 3261
164 Ga0373937_0379487 3300036401 Bacteria 1340
165 Ga0395900_0125571 3300037418 Unclassified 2631
166 Ga0395900_0637581 3300037418 Bacteria 1003
167 Ga0395898_0930734 3300037466 Unclassified 807
168 Ga0395901_0015680 3300038443 Bacteria 7719
169 Ga0395901_0567787 3300038443 Unclassified 1148
170 Ga0439455_0005543 3300042012 Unclassified 2568
171 Ga0466967_0231855 3300045976 Bacteria 1758
172 Ga0495603_0164839 3300046455 Bacteria 1285
173 Ga0495629_0327786 3300046459 Bacteria 1046
174 Ga0495608_0214282 3300046511 Bacteria 1210
175 Ga0495652_0060278 3300046529 Bacteria 3207
176 Ga0495665_0113183 3300046531 Unclassified 1423
177 Ga0495587_0026066 3300046536 Bacteria 3567
178 Ga0495645_0003646 3300046543 Bacteria 10460
179 Ga0495634_0045508 3300046642 Bacteria 2966
180 Ga0495635_0139019 3300046663 Bacteria 1655
181 Ga0495657_0138955 3300046675 Bacteria 1516
182 Ga0495599_0013687 3300046678 Bacteria 5015
183 Ga0495623_0002288 3300046679 Bacteria 12771
184 Ga0495646_0034808 3300046680 Unclassified 3126
185 Ga0495669_0289507 3300046684 Unclassified 789
186 Ga0495613_0336808 3300046689 Bacteria 1039
187 Ga0495604_0128232 3300047317 Bacteria 1826
188 Ga0495675_0026658 3300047444 Unclassified 3685
189 Ga0496100_0276301 3300048903 Bacteria 1251
190 Ga0496100_0320084 3300048903 Bacteria 1165
191 Ga0496101_0002094 3300048904 Bacteria 12158
192 Ga0496102_0019583 3300048905 Bacteria 5961
193 Ga0496102_0464667 3300048905 Unclassified 1186
194 Ga0496104_0162496 3300048907 Bacteria 2142
195 Ga0496104_0258247 3300048907 Bacteria 1655
196 Ga0496105_0102623 3300048908 Unclassified 2362
197 Ga0496106_0017423 3300048909 Bacteria 5315
198 Ga0496106_0375803 3300048909 Unclassified 1142
199 Ga0496107_0003832 3300048910 Bacteria 10106
200 Ga0496107_0335663 3300048910 Bacteria 1125
201 Ga0496108_0201848 3300048911 Unclassified 1726
202 Ga0496109_0061952 3300048912 Unclassified 3421
203 Ga0496109_0159864 3300048912 Bacteria 2111
204 Ga0496109_0637795 3300048912 Unclassified 1002
205 Ga0496111_0232910 3300048914 Bacteria 1368
206 Ga0496113_0011569 3300048916 Bacteria 5895
207 Ga0496114_0056797 3300048917 Bacteria 3267
208 Ga0496114_0075177 3300048917 Bacteria 2845
209 Ga0496114_0279802 3300048917 Bacteria 1471
210 Ga0496115_0001896 3300048918 Bacteria 14967
211 Ga0496115_0007762 3300048918 Bacteria 7912
212 Ga0496115_0075238 3300048918 Unclassified 2743
213 nmdc:mga0n895_65591_c1 3300050512 Bacteria 3594
214 Ga0495601_0022724 3300053077 Bacteria 3853
215 Ga0495612_0037670 3300053078 Bacteria 1964

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10016080 Ga0207646_100160804 229
2 3300005327 Ga0070658_10195357 Ga0070658_101953573 234
3 3300005563 Ga0068855_100007176 Ga0068855_1000071765 234
4 3300010375 Ga0105239_10647611 Ga0105239_106476111 234
5 3300025909 Ga0207705_10120803 Ga0207705_101208032 234
6 3300025939 Ga0207665_10202066 Ga0207665_102020661 234
7 3300025949 Ga0207667_10005675 Ga0207667_1000567513 234
8 3300005290 Ga0065712_10006356 Ga0065712_100063564 235
9 3300005293 Ga0065715_10011184 Ga0065715_100111844 235
10 3300005365 Ga0070688_100125958 Ga0070688_1001259582 235
11 3300005539 Ga0068853_100000002 Ga0068853_10000000262 235
12 3300005937 Ga0081455_10018047 Ga0081455_100180475 235
13 3300026041 Ga0207639_10000009 Ga0207639_1000000917 235
14 3300042012 Ga0439455_0005543 Ga0439455_0005543_1660_2367 235
15 3300048905 Ga0496102_0464667 Ga0496102_0464667_452_1165 235
16 3300048911 Ga0496108_0201848 Ga0496108_0201848_684_1397 235
17 3300048916 Ga0496113_0011569 Ga0496113_0011569_679_1392 235
18 3300005289 Ga0065704_10007231 Ga0065704_100072311 236
19 3300005327 Ga0070658_10000314 Ga0070658_1000031416 236
20 3300005339 Ga0070660_100417394 Ga0070660_1004173941 236
21 3300005354 Ga0070675_100543453 Ga0070675_1005434532 236
22 3300005434 Ga0070709_10090221 Ga0070709_100902212 236
23 3300005455 Ga0070663_100497075 Ga0070663_1004970751 236
24 3300005471 Ga0070698_100006743 Ga0070698_1000067436 236
25 3300005548 Ga0070665_100223687 Ga0070665_1002236872 236
26 3300005548 Ga0070665_100520407 Ga0070665_1005204072 236
27 3300005577 Ga0068857_100743401 Ga0068857_1007434012 236
28 3300005937 Ga0081455_10090032 Ga0081455_100900322 236
29 3300005985 Ga0081539_10005852 Ga0081539_100058523 236
30 3300006028 Ga0070717_10125108 Ga0070717_101251082 236
31 3300006175 Ga0070712_100107523 Ga0070712_1001075233 236
32 3300006358 Ga0068871_100062686 Ga0068871_1000626864 236
33 3300006871 Ga0075434_100202211 Ga0075434_1002022112 236
34 3300006880 Ga0075429_100269666 Ga0075429_1002696662 236
35 3300009093 Ga0105240_10000022 Ga0105240_10000022250 236
36 3300009093 Ga0105240_10396126 Ga0105240_103961261 236
37 3300009094 Ga0111539_10148139 Ga0111539_101481394 236
38 3300009147 Ga0114129_10152701 Ga0114129_101527013 236
39 3300009551 Ga0105238_10339698 Ga0105238_103396982 236
40 3300013306 Ga0163162_10463445 Ga0163162_104634452 236
41 3300014969 Ga0157376_10000519 Ga0157376_1000051911 236
42 3300014969 Ga0157376_10170336 Ga0157376_101703362 236
43 3300025909 Ga0207705_10000430 Ga0207705_1000043025 236
44 3300025913 Ga0207695_10000022 Ga0207695_10000022268 236
45 3300025919 Ga0207657_10275897 Ga0207657_102758971 236
46 3300025924 Ga0207694_10140016 Ga0207694_101400162 236
47 3300025938 Ga0207704_10135355 Ga0207704_101353552 236
48 3300026035 Ga0207703_10005011 Ga0207703_100050113 236
49 3300026116 Ga0207674_10714478 Ga0207674_107144781 236
50 3300028379 Ga0268266_10343198 Ga0268266_103431982 236
51 3300035119 Ga0373956_0156568 Ga0373956_0156568_159_872 236
52 3300035172 Ga0373955_0299509 Ga0373955_0299509_114_827 236
53 3300035692 Ga0373935_0313958 Ga0373935_0313958_49_762 236
54 3300035724 Ga0373933_0064833 Ga0373933_0064833_483_1196 236
55 3300035725 Ga0373947_0028743 Ga0373947_0028743_2310_3026 236
56 3300036401 Ga0373937_0379487 Ga0373937_0379487_70_783 236
57 3300046455 Ga0495603_0164839 Ga0495603_0164839_33_749 236
58 3300046459 Ga0495629_0327786 Ga0495629_0327786_222_938 236
59 3300046511 Ga0495608_0214282 Ga0495608_0214282_174_887 236
60 3300046529 Ga0495652_0060278 Ga0495652_0060278_811_1524 236
61 3300046531 Ga0495665_0113183 Ga0495665_0113183_58_774 236
62 3300046536 Ga0495587_0026066 Ga0495587_0026066_2598_3311 236
63 3300046543 Ga0495645_0003646 Ga0495645_0003646_2788_3501 236
64 3300046642 Ga0495634_0045508 Ga0495634_0045508_1389_2105 236
65 3300046663 Ga0495635_0139019 Ga0495635_0139019_70_783 236
66 3300046675 Ga0495657_0138955 Ga0495657_0138955_473_1186 236
67 3300046678 Ga0495599_0013687 Ga0495599_0013687_2699_3412 236
68 3300046679 Ga0495623_0002288 Ga0495623_0002288_8190_8903 236
69 3300046684 Ga0495669_0289507 Ga0495669_0289507_14_727 236
70 3300046689 Ga0495613_0336808 Ga0495613_0336808_32_748 236
71 3300047317 Ga0495604_0128232 Ga0495604_0128232_345_1058 236
72 3300047444 Ga0495675_0026658 Ga0495675_0026658_2062_2775 236
73 3300048903 Ga0496100_0276301 Ga0496100_0276301_29_745 236
74 3300048907 Ga0496104_0162496 Ga0496104_0162496_1391_2107 236
75 3300048908 Ga0496105_0102623 Ga0496105_0102623_1506_2222 236
76 3300048912 Ga0496109_0061952 Ga0496109_0061952_794_1510 236
77 3300048917 Ga0496114_0075177 Ga0496114_0075177_506_1222 236
78 3300048918 Ga0496115_0075238 Ga0496115_0075238_2003_2719 236
79 3300050512 nmdc:mga0n895_65591_c1 nmdc:mga0n895_65591_c1_2135_2851 236
80 3300053077 Ga0495601_0022724 Ga0495601_0022724_2774_3487 236
81 3300053078 Ga0495612_0037670 Ga0495612_0037670_729_1442 236
82 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001142 237
83 3300003911 JGI25405J52794_10000454 JGI25405J52794_100004543 237
84 3300005290 Ga0065712_10254593 Ga0065712_102545932 237
85 3300005293 Ga0065715_10000207 Ga0065715_1000020719 237
86 3300005328 Ga0070676_10029465 Ga0070676_100294653 237
87 3300005331 Ga0070670_100226272 Ga0070670_1002262721 237
88 3300005335 Ga0070666_10090139 Ga0070666_100901393 237
89 3300005340 Ga0070689_100023705 Ga0070689_1000237053 237
90 3300005347 Ga0070668_100006202 Ga0070668_1000062025 237
91 3300005353 Ga0070669_100001429 Ga0070669_1000014298 237
92 3300005354 Ga0070675_100021406 Ga0070675_1000214064 237
93 3300005355 Ga0070671_100032141 Ga0070671_1000321413 237
94 3300005355 Ga0070671_100151677 Ga0070671_1001516772 237
95 3300005356 Ga0070674_100000780 Ga0070674_10000078017 237
96 3300005434 Ga0070709_10227711 Ga0070709_102277111 237
97 3300005435 Ga0070714_100222123 Ga0070714_1002221232 237
98 3300005436 Ga0070713_100357619 Ga0070713_1003576192 237
99 3300005438 Ga0070701_10092567 Ga0070701_100925672 237
100 3300005439 Ga0070711_100079771 Ga0070711_1000797712 237
101 3300005440 Ga0070705_100305503 Ga0070705_1003055031 237
102 3300005445 Ga0070708_100182569 Ga0070708_1001825692 237
103 3300005445 Ga0070708_100212511 Ga0070708_1002125112 237
104 3300005456 Ga0070678_100062545 Ga0070678_1000625454 237
105 3300005457 Ga0070662_100013651 Ga0070662_1000136514 237
106 3300005467 Ga0070706_100003521 Ga0070706_1000035213 237
107 3300005467 Ga0070706_100012129 Ga0070706_1000121292 237
108 3300005467 Ga0070706_100115222 Ga0070706_1001152222 237
109 3300005468 Ga0070707_100014343 Ga0070707_1000143431 237
110 3300005468 Ga0070707_100041525 Ga0070707_1000415254 237
111 3300005468 Ga0070707_100135602 Ga0070707_1001356022 237
112 3300005471 Ga0070698_100008810 Ga0070698_1000088109 237
113 3300005471 Ga0070698_100010716 Ga0070698_1000107168 237
114 3300005471 Ga0070698_100051366 Ga0070698_1000513662 237
115 3300005471 Ga0070698_100795032 Ga0070698_1007950321 237
116 3300005518 Ga0070699_100231798 Ga0070699_1002317982 237
117 3300005536 Ga0070697_100000889 Ga0070697_10000088919 237
118 3300005536 Ga0070697_100186625 Ga0070697_1001866252 237
119 3300005536 Ga0070697_100430251 Ga0070697_1004302512 237
120 3300005545 Ga0070695_100062391 Ga0070695_1000623911 237
121 3300005546 Ga0070696_100021487 Ga0070696_1000214873 237
122 3300005547 Ga0070693_100377067 Ga0070693_1003770671 237
123 3300005614 Ga0068856_100044681 Ga0068856_1000446814 237
124 3300005615 Ga0070702_100095572 Ga0070702_1000955723 237
125 3300005617 Ga0068859_100476154 Ga0068859_1004761541 237
126 3300005718 Ga0068866_10006711 Ga0068866_100067113 237
127 3300005844 Ga0068862_100250816 Ga0068862_1002508162 237
128 3300005937 Ga0081455_10000314 Ga0081455_1000031456 237
129 3300005937 Ga0081455_10000959 Ga0081455_100009596 237
130 3300005937 Ga0081455_10034338 Ga0081455_100343382 237
131 3300005937 Ga0081455_10065366 Ga0081455_100653662 237
132 3300005985 Ga0081539_10000014 Ga0081539_10000014248 237
133 3300006173 Ga0070716_100145826 Ga0070716_1001458262 237
134 3300006175 Ga0070712_100078038 Ga0070712_1000780384 237
135 3300006175 Ga0070712_100609471 Ga0070712_1006094711 237
136 3300006358 Ga0068871_100243598 Ga0068871_1002435982 237
137 3300006871 Ga0075434_100555340 Ga0075434_1005553402 237
138 3300006881 Ga0068865_100019590 Ga0068865_1000195902 237
139 3300006931 Ga0097620_100476142 Ga0097620_1004761421 237
140 3300009098 Ga0105245_10022602 Ga0105245_100226023 237
141 3300009176 Ga0105242_10044238 Ga0105242_100442383 237
142 3300009553 Ga0105249_10071958 Ga0105249_100719583 237
143 3300009553 Ga0105249_10916749 Ga0105249_109167491 237
144 3300013102 Ga0157371_10473442 Ga0157371_104734421 237
145 3300013297 Ga0157378_10115638 Ga0157378_101156384 237
146 3300013297 Ga0157378_10120941 Ga0157378_101209413 237
147 3300013306 Ga0163162_10004249 Ga0163162_100042495 237
148 3300013307 Ga0157372_10019851 Ga0157372_100198513 237
149 3300013307 Ga0157372_10067448 Ga0157372_100674483 237
150 3300013307 Ga0157372_10231805 Ga0157372_102318052 237
151 3300013308 Ga0157375_10117806 Ga0157375_101178064 237
152 3300013308 Ga0157375_10413175 Ga0157375_104131752 237
153 3300014745 Ga0157377_10517622 Ga0157377_105176221 237
154 3300014968 Ga0157379_10121608 Ga0157379_101216083 237
155 3300014969 Ga0157376_10432241 Ga0157376_104322411 237
156 3300017792 Ga0163161_10002181 Ga0163161_100021814 237
157 3300025315 Ga0207697_10000681 Ga0207697_100006815 237
158 3300025901 Ga0207688_10005383 Ga0207688_100053834 237
159 3300025905 Ga0207685_10002754 Ga0207685_100027542 237
160 3300025906 Ga0207699_10004656 Ga0207699_100046564 237
161 3300025907 Ga0207645_10001228 Ga0207645_1000122817 237
162 3300025910 Ga0207684_10000333 Ga0207684_1000033313 237
163 3300025910 Ga0207684_10006692 Ga0207684_100066928 237
164 3300025910 Ga0207684_10008775 Ga0207684_100087757 237
165 3300025910 Ga0207684_10026333 Ga0207684_100263333 237
166 3300025910 Ga0207684_10307207 Ga0207684_103072072 237
167 3300025915 Ga0207693_10093358 Ga0207693_100933583 237
168 3300025915 Ga0207693_10096129 Ga0207693_100961292 237
169 3300025916 Ga0207663_10012205 Ga0207663_100122054 237
170 3300025922 Ga0207646_10004113 Ga0207646_100041133 237
171 3300025922 Ga0207646_10030531 Ga0207646_100305314 237
172 3300025922 Ga0207646_10080784 Ga0207646_100807842 237
173 3300025922 Ga0207646_10359920 Ga0207646_103599202 237
174 3300025923 Ga0207681_10008231 Ga0207681_100082313 237
175 3300025926 Ga0207659_10120679 Ga0207659_101206792 237
176 3300025928 Ga0207700_10013284 Ga0207700_100132842 237
177 3300025929 Ga0207664_10091892 Ga0207664_100918923 237
178 3300025929 Ga0207664_10247851 Ga0207664_102478512 237
179 3300025931 Ga0207644_10009724 Ga0207644_100097243 237
180 3300025931 Ga0207644_10011970 Ga0207644_100119704 237
181 3300025933 Ga0207706_10023356 Ga0207706_100233564 237
182 3300025934 Ga0207686_10278181 Ga0207686_102781811 237
183 3300025937 Ga0207669_10004027 Ga0207669_100040274 237
184 3300025938 Ga0207704_10018396 Ga0207704_100183962 237
185 3300025939 Ga0207665_10009733 Ga0207665_100097333 237
186 3300025939 Ga0207665_10183227 Ga0207665_101832272 237
187 3300025939 Ga0207665_10527693 Ga0207665_105276932 237
188 3300025940 Ga0207691_10001630 Ga0207691_1000163017 237
189 3300025942 Ga0207689_10353440 Ga0207689_103534402 237
190 3300026023 Ga0207677_10414634 Ga0207677_104146342 237
191 3300026121 Ga0207683_10188774 Ga0207683_101887742 237
192 3300028379 Ga0268266_10651787 Ga0268266_106517872 237
193 3300035692 Ga0373935_0106108 Ga0373935_0106108_533_1258 237
194 3300037418 Ga0395900_0125571 Ga0395900_0125571_650_1369 237
195 3300037418 Ga0395900_0637581 Ga0395900_0637581_156_875 237
196 3300037466 Ga0395898_0930734 Ga0395898_0930734_63_779 237
197 3300038443 Ga0395901_0015680 Ga0395901_0015680_1029_1748 237
198 3300038443 Ga0395901_0567787 Ga0395901_0567787_368_1087 237
199 3300045976 Ga0466967_0231855 Ga0466967_0231855_564_1277 237
200 3300046680 Ga0495646_0034808 Ga0495646_0034808_1939_2655 237
201 3300048903 Ga0496100_0320084 Ga0496100_0320084_100_816 237
202 3300048904 Ga0496101_0002094 Ga0496101_0002094_10111_10833 237
203 3300048905 Ga0496102_0019583 Ga0496102_0019583_4689_5411 237
204 3300048907 Ga0496104_0258247 Ga0496104_0258247_525_1241 237
205 3300048909 Ga0496106_0017423 Ga0496106_0017423_1962_2684 237
206 3300048909 Ga0496106_0375803 Ga0496106_0375803_364_1080 237
207 3300048910 Ga0496107_0003832 Ga0496107_0003832_8499_9221 237
208 3300048910 Ga0496107_0335663 Ga0496107_0335663_339_1061 237
209 3300048912 Ga0496109_0159864 Ga0496109_0159864_405_1127 237
210 3300048912 Ga0496109_0637795 Ga0496109_0637795_175_891 237
211 3300048914 Ga0496111_0232910 Ga0496111_0232910_139_861 237
212 3300048917 Ga0496114_0056797 Ga0496114_0056797_2214_2936 237
213 3300048917 Ga0496114_0279802 Ga0496114_0279802_547_1263 237
214 3300048918 Ga0496115_0001896 Ga0496115_0001896_2542_3264 237
215 3300048918 Ga0496115_0007762 Ga0496115_0007762_4649_5365 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

7

240

0.93

PF12804

NTP_transf_3

MobA-like NTP transferase domain

8

205

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.9264 6 236
2ggo-assembly1.cif.gz_A crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii 0.9224 6 236
5z09-assembly2.cif.gz_D-5 st0452(y97n)-utp binding form 0.9185 6 236
5z0a-assembly2.cif.gz_C-3 st0452(y97n)-glcnac binding form 0.9179 6 236
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.9139 1 236
ID Description Score Start End Superfamily
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.951 6 226 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9379 6 226 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9305 4 236 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9254 6 226 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9126 6 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V6DBB4-F1-model_v4 Nucleotidyl transferase 0.9875 1 214 GO:0009058
GO:0016779
AF-A0A2V6DBB4-F1-model_v4 Nucleotidyl transferase 0.983 1 214 GO:0009058
GO:0016779
AF-A0A538NIT0-F1-model_v4 Nucleotidyltransferase family protein 0.9795 56 237 GO:0009058
GO:0016779
AF-A0A2V6DWD3-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9793 104 236 GO:0009058
GO:0016779
AF-A0A2V6HG73-F1-model_v4 Nucleotidyl transferase 0.9763 1 165 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map