F326233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 215 | 147 | 215 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100743401|Ga0068857_1007434012 |
| Length | 249 |
| Sequence | VNGLVRKAVLLAAGRGTRMRDLTNELPKPMIEVRGKPILHHIIEVLHQAGISDVLIIVGYRADTVRAYFGDGARFGVAITYTTQVVQDGTGRVVELAKEFAGKDPFVLSYGDILIEPRNYRRLVALGDAEAMISVKKNEDVSKGGAVFVNERFELIDLREKPQPGEPTSPWYNAGVYTFRPSIFQFTARLEKSPRGEYELTDAVRALALNGCRVQAFELAGEWADVRDPEILAELNSRGAVRSADPAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.16 |
| Rhizosphere | 88.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000001 | 3300003203 | Bacteria | 251772 |
| 2 | JGI25405J52794_10000454 | 3300003911 | Bacteria | 5807 |
| 3 | Ga0065704_10007231 | 3300005289 | Unclassified | 2346 |
| 4 | Ga0065712_10006356 | 3300005290 | Bacteria | 3680 |
| 5 | Ga0065712_10254593 | 3300005290 | Unclassified | 951 |
| 6 | Ga0065715_10000207 | 3300005293 | Bacteria | 34609 |
| 7 | Ga0065715_10011184 | 3300005293 | Bacteria | 3161 |
| 8 | Ga0070658_10000314 | 3300005327 | Bacteria | 41791 |
| 9 | Ga0070658_10195357 | 3300005327 | Bacteria | 1706 |
| 10 | Ga0070676_10029465 | 3300005328 | Bacteria | 3122 |
| 11 | Ga0070670_100226272 | 3300005331 | Unclassified | 1627 |
| 12 | Ga0070666_10090139 | 3300005335 | Bacteria | 2105 |
| 13 | Ga0070660_100417394 | 3300005339 | Bacteria | 1111 |
| 14 | Ga0070689_100023705 | 3300005340 | Bacteria | 4598 |
| 15 | Ga0070668_100006202 | 3300005347 | Bacteria | 8854 |
| 16 | Ga0070669_100001429 | 3300005353 | Bacteria | 17266 |
| 17 | Ga0070675_100021406 | 3300005354 | Bacteria | 5167 |
| 18 | Ga0070675_100543453 | 3300005354 | Bacteria | 1050 |
| 19 | Ga0070671_100032141 | 3300005355 | Bacteria | 4340 |
| 20 | Ga0070671_100151677 | 3300005355 | Unclassified | 1957 |
| 21 | Ga0070674_100000780 | 3300005356 | Bacteria | 16336 |
| 22 | Ga0070688_100125958 | 3300005365 | Bacteria | 1721 |
| 23 | Ga0070709_10090221 | 3300005434 | Bacteria | 2020 |
| 24 | Ga0070709_10227711 | 3300005434 | Unclassified | 1332 |
| 25 | Ga0070714_100222123 | 3300005435 | Bacteria | 1737 |
| 26 | Ga0070713_100357619 | 3300005436 | Unclassified | 1356 |
| 27 | Ga0070701_10092567 | 3300005438 | Bacteria | 1659 |
| 28 | Ga0070711_100079771 | 3300005439 | Bacteria | 2329 |
| 29 | Ga0070705_100305503 | 3300005440 | Bacteria | 1142 |
| 30 | Ga0070708_100182569 | 3300005445 | Bacteria | 1961 |
| 31 | Ga0070708_100212511 | 3300005445 | Bacteria | 1813 |
| 32 | Ga0070663_100497075 | 3300005455 | Unclassified | 1012 |
| 33 | Ga0070678_100062545 | 3300005456 | Bacteria | 2749 |
| 34 | Ga0070662_100013651 | 3300005457 | Bacteria | 5408 |
| 35 | Ga0070706_100003521 | 3300005467 | Bacteria | 15387 |
| 36 | Ga0070706_100012129 | 3300005467 | Bacteria | 7994 |
| 37 | Ga0070706_100115222 | 3300005467 | Bacteria | 2503 |
| 38 | Ga0070707_100014343 | 3300005468 | Bacteria | 7429 |
| 39 | Ga0070707_100041525 | 3300005468 | Unclassified | 4403 |
| 40 | Ga0070707_100135602 | 3300005468 | Bacteria | 2395 |
| 41 | Ga0070698_100006743 | 3300005471 | Bacteria | 12449 |
| 42 | Ga0070698_100008810 | 3300005471 | Bacteria | 10857 |
| 43 | Ga0070698_100010716 | 3300005471 | Bacteria | 9763 |
| 44 | Ga0070698_100051366 | 3300005471 | Unclassified | 4199 |
| 45 | Ga0070698_100795032 | 3300005471 | Bacteria | 890 |
| 46 | Ga0070699_100231798 | 3300005518 | Bacteria | 1647 |
| 47 | Ga0070697_100000889 | 3300005536 | Bacteria | 22458 |
| 48 | Ga0070697_100186625 | 3300005536 | Bacteria | 1759 |
| 49 | Ga0070697_100430251 | 3300005536 | Unclassified | 1148 |
| 50 | Ga0068853_100000002 | 3300005539 | Bacteria | 485323 |
| 51 | Ga0070695_100062391 | 3300005545 | Unclassified | 2420 |
| 52 | Ga0070696_100021487 | 3300005546 | Unclassified | 4375 |
| 53 | Ga0070693_100377067 | 3300005547 | Bacteria | 977 |
| 54 | Ga0070665_100223687 | 3300005548 | Bacteria | 1883 |
| 55 | Ga0070665_100520407 | 3300005548 | Bacteria | 1201 |
| 56 | Ga0068855_100007176 | 3300005563 | Bacteria | 13521 |
| 57 | Ga0068857_100743401 | 3300005577 | Bacteria | 934 |
| 58 | Ga0068856_100044681 | 3300005614 | Bacteria | 4361 |
| 59 | Ga0070702_100095572 | 3300005615 | Unclassified | 1812 |
| 60 | Ga0068859_100476154 | 3300005617 | Unclassified | 1344 |
| 61 | Ga0068866_10006711 | 3300005718 | Unclassified | 4799 |
| 62 | Ga0068862_100250816 | 3300005844 | Unclassified | 1613 |
| 63 | Ga0081455_10000314 | 3300005937 | Bacteria | 63484 |
| 64 | Ga0081455_10000959 | 3300005937 | Bacteria | 36868 |
| 65 | Ga0081455_10018047 | 3300005937 | Bacteria | 6739 |
| 66 | Ga0081455_10034338 | 3300005937 | Unclassified | 4545 |
| 67 | Ga0081455_10065366 | 3300005937 | Bacteria | 3042 |
| 68 | Ga0081455_10090032 | 3300005937 | Bacteria | 2489 |
| 69 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 70 | Ga0081539_10005852 | 3300005985 | Bacteria | 12194 |
| 71 | Ga0070717_10125108 | 3300006028 | Unclassified | 2206 |
| 72 | Ga0070716_100145826 | 3300006173 | Bacteria | 1516 |
| 73 | Ga0070712_100078038 | 3300006175 | Bacteria | 2389 |
| 74 | Ga0070712_100107523 | 3300006175 | Unclassified | 2075 |
| 75 | Ga0070712_100609471 | 3300006175 | Unclassified | 925 |
| 76 | Ga0068871_100062686 | 3300006358 | Bacteria | 3039 |
| 77 | Ga0068871_100243598 | 3300006358 | Bacteria | 1564 |
| 78 | Ga0075434_100202211 | 3300006871 | Bacteria | 2007 |
| 79 | Ga0075434_100555340 | 3300006871 | Bacteria | 1168 |
| 80 | Ga0075429_100269666 | 3300006880 | Bacteria | 1491 |
| 81 | Ga0068865_100019590 | 3300006881 | Bacteria | 4380 |
| 82 | Ga0097620_100476142 | 3300006931 | Unclassified | 1344 |
| 83 | Ga0105240_10000022 | 3300009093 | Bacteria | 387911 |
| 84 | Ga0105240_10396126 | 3300009093 | Unclassified | 1556 |
| 85 | Ga0111539_10148139 | 3300009094 | Bacteria | 2748 |
| 86 | Ga0105245_10022602 | 3300009098 | Bacteria | 5521 |
| 87 | Ga0114129_10152701 | 3300009147 | Bacteria | 3159 |
| 88 | Ga0105242_10044238 | 3300009176 | Bacteria | 3605 |
| 89 | Ga0105238_10339698 | 3300009551 | Bacteria | 1489 |
| 90 | Ga0105249_10071958 | 3300009553 | Bacteria | 3195 |
| 91 | Ga0105249_10916749 | 3300009553 | Unclassified | 943 |
| 92 | Ga0105239_10647611 | 3300010375 | Bacteria | 1207 |
| 93 | Ga0157371_10473442 | 3300013102 | Unclassified | 923 |
| 94 | Ga0157378_10115638 | 3300013297 | Bacteria | 2465 |
| 95 | Ga0157378_10120941 | 3300013297 | Bacteria | 2413 |
| 96 | Ga0163162_10004249 | 3300013306 | Bacteria | 13776 |
| 97 | Ga0163162_10463445 | 3300013306 | Bacteria | 1399 |
| 98 | Ga0157372_10019851 | 3300013307 | Bacteria | 7242 |
| 99 | Ga0157372_10067448 | 3300013307 | Bacteria | 4020 |
| 100 | Ga0157372_10231805 | 3300013307 | Bacteria | 2141 |
| 101 | Ga0157375_10117806 | 3300013308 | Bacteria | 2762 |
| 102 | Ga0157375_10413175 | 3300013308 | Unclassified | 1516 |
| 103 | Ga0157377_10517622 | 3300014745 | Unclassified | 837 |
| 104 | Ga0157379_10121608 | 3300014968 | Bacteria | 2348 |
| 105 | Ga0157376_10000519 | 3300014969 | Bacteria | 24874 |
| 106 | Ga0157376_10170336 | 3300014969 | Bacteria | 1982 |
| 107 | Ga0157376_10432241 | 3300014969 | Unclassified | 1280 |
| 108 | Ga0163161_10002181 | 3300017792 | Bacteria | 14119 |
| 109 | Ga0207697_10000681 | 3300025315 | Bacteria | 19317 |
| 110 | Ga0207688_10005383 | 3300025901 | Bacteria | 6954 |
| 111 | Ga0207685_10002754 | 3300025905 | Bacteria | 4105 |
| 112 | Ga0207699_10004656 | 3300025906 | Bacteria | 6562 |
| 113 | Ga0207645_10001228 | 3300025907 | Bacteria | 21121 |
| 114 | Ga0207705_10000430 | 3300025909 | Bacteria | 36578 |
| 115 | Ga0207705_10120803 | 3300025909 | Bacteria | 1944 |
| 116 | Ga0207684_10000333 | 3300025910 | Bacteria | 65788 |
| 117 | Ga0207684_10006692 | 3300025910 | Bacteria | 10473 |
| 118 | Ga0207684_10008775 | 3300025910 | Bacteria | 8975 |
| 119 | Ga0207684_10026333 | 3300025910 | Unclassified | 4958 |
| 120 | Ga0207684_10307207 | 3300025910 | Bacteria | 1367 |
| 121 | Ga0207695_10000022 | 3300025913 | Bacteria | 659090 |
| 122 | Ga0207693_10093358 | 3300025915 | Unclassified | 2358 |
| 123 | Ga0207693_10096129 | 3300025915 | Unclassified | 2322 |
| 124 | Ga0207663_10012205 | 3300025916 | Bacteria | 4637 |
| 125 | Ga0207657_10275897 | 3300025919 | Bacteria | 1336 |
| 126 | Ga0207646_10004113 | 3300025922 | Bacteria | 16011 |
| 127 | Ga0207646_10016080 | 3300025922 | Bacteria | 7030 |
| 128 | Ga0207646_10030531 | 3300025922 | Unclassified | 4884 |
| 129 | Ga0207646_10080784 | 3300025922 | Unclassified | 2907 |
| 130 | Ga0207646_10359920 | 3300025922 | Bacteria | 1314 |
| 131 | Ga0207681_10008231 | 3300025923 | Bacteria | 6378 |
| 132 | Ga0207694_10140016 | 3300025924 | Bacteria | 1945 |
| 133 | Ga0207659_10120679 | 3300025926 | Bacteria | 2008 |
| 134 | Ga0207700_10013284 | 3300025928 | Bacteria | 5351 |
| 135 | Ga0207664_10091892 | 3300025929 | Bacteria | 2490 |
| 136 | Ga0207664_10247851 | 3300025929 | Unclassified | 1553 |
| 137 | Ga0207644_10009724 | 3300025931 | Bacteria | 6322 |
| 138 | Ga0207644_10011970 | 3300025931 | Bacteria | 5753 |
| 139 | Ga0207706_10023356 | 3300025933 | Bacteria | 5553 |
| 140 | Ga0207686_10278181 | 3300025934 | Unclassified | 1234 |
| 141 | Ga0207669_10004027 | 3300025937 | Bacteria | 6430 |
| 142 | Ga0207704_10018396 | 3300025938 | Bacteria | 3646 |
| 143 | Ga0207704_10135355 | 3300025938 | Bacteria | 1714 |
| 144 | Ga0207665_10009733 | 3300025939 | Bacteria | 6310 |
| 145 | Ga0207665_10183227 | 3300025939 | Bacteria | 1517 |
| 146 | Ga0207665_10202066 | 3300025939 | Unclassified | 1448 |
| 147 | Ga0207665_10527693 | 3300025939 | Unclassified | 915 |
| 148 | Ga0207691_10001630 | 3300025940 | Bacteria | 22283 |
| 149 | Ga0207689_10353440 | 3300025942 | Bacteria | 1222 |
| 150 | Ga0207667_10005675 | 3300025949 | Bacteria | 15214 |
| 151 | Ga0207677_10414634 | 3300026023 | Unclassified | 1145 |
| 152 | Ga0207703_10005011 | 3300026035 | Bacteria | 10737 |
| 153 | Ga0207639_10000009 | 3300026041 | Bacteria | 432727 |
| 154 | Ga0207674_10714478 | 3300026116 | Unclassified | 967 |
| 155 | Ga0207683_10188774 | 3300026121 | Unclassified | 1870 |
| 156 | Ga0268266_10343198 | 3300028379 | Bacteria | 1402 |
| 157 | Ga0268266_10651787 | 3300028379 | Unclassified | 1013 |
| 158 | Ga0373956_0156568 | 3300035119 | Bacteria | 1073 |
| 159 | Ga0373955_0299509 | 3300035172 | Unclassified | 969 |
| 160 | Ga0373935_0106108 | 3300035692 | Unclassified | 1859 |
| 161 | Ga0373935_0313958 | 3300035692 | Bacteria | 1111 |
| 162 | Ga0373933_0064833 | 3300035724 | Bacteria | 2211 |
| 163 | Ga0373947_0028743 | 3300035725 | Bacteria | 3261 |
| 164 | Ga0373937_0379487 | 3300036401 | Bacteria | 1340 |
| 165 | Ga0395900_0125571 | 3300037418 | Unclassified | 2631 |
| 166 | Ga0395900_0637581 | 3300037418 | Bacteria | 1003 |
| 167 | Ga0395898_0930734 | 3300037466 | Unclassified | 807 |
| 168 | Ga0395901_0015680 | 3300038443 | Bacteria | 7719 |
| 169 | Ga0395901_0567787 | 3300038443 | Unclassified | 1148 |
| 170 | Ga0439455_0005543 | 3300042012 | Unclassified | 2568 |
| 171 | Ga0466967_0231855 | 3300045976 | Bacteria | 1758 |
| 172 | Ga0495603_0164839 | 3300046455 | Bacteria | 1285 |
| 173 | Ga0495629_0327786 | 3300046459 | Bacteria | 1046 |
| 174 | Ga0495608_0214282 | 3300046511 | Bacteria | 1210 |
| 175 | Ga0495652_0060278 | 3300046529 | Bacteria | 3207 |
| 176 | Ga0495665_0113183 | 3300046531 | Unclassified | 1423 |
| 177 | Ga0495587_0026066 | 3300046536 | Bacteria | 3567 |
| 178 | Ga0495645_0003646 | 3300046543 | Bacteria | 10460 |
| 179 | Ga0495634_0045508 | 3300046642 | Bacteria | 2966 |
| 180 | Ga0495635_0139019 | 3300046663 | Bacteria | 1655 |
| 181 | Ga0495657_0138955 | 3300046675 | Bacteria | 1516 |
| 182 | Ga0495599_0013687 | 3300046678 | Bacteria | 5015 |
| 183 | Ga0495623_0002288 | 3300046679 | Bacteria | 12771 |
| 184 | Ga0495646_0034808 | 3300046680 | Unclassified | 3126 |
| 185 | Ga0495669_0289507 | 3300046684 | Unclassified | 789 |
| 186 | Ga0495613_0336808 | 3300046689 | Bacteria | 1039 |
| 187 | Ga0495604_0128232 | 3300047317 | Bacteria | 1826 |
| 188 | Ga0495675_0026658 | 3300047444 | Unclassified | 3685 |
| 189 | Ga0496100_0276301 | 3300048903 | Bacteria | 1251 |
| 190 | Ga0496100_0320084 | 3300048903 | Bacteria | 1165 |
| 191 | Ga0496101_0002094 | 3300048904 | Bacteria | 12158 |
| 192 | Ga0496102_0019583 | 3300048905 | Bacteria | 5961 |
| 193 | Ga0496102_0464667 | 3300048905 | Unclassified | 1186 |
| 194 | Ga0496104_0162496 | 3300048907 | Bacteria | 2142 |
| 195 | Ga0496104_0258247 | 3300048907 | Bacteria | 1655 |
| 196 | Ga0496105_0102623 | 3300048908 | Unclassified | 2362 |
| 197 | Ga0496106_0017423 | 3300048909 | Bacteria | 5315 |
| 198 | Ga0496106_0375803 | 3300048909 | Unclassified | 1142 |
| 199 | Ga0496107_0003832 | 3300048910 | Bacteria | 10106 |
| 200 | Ga0496107_0335663 | 3300048910 | Bacteria | 1125 |
| 201 | Ga0496108_0201848 | 3300048911 | Unclassified | 1726 |
| 202 | Ga0496109_0061952 | 3300048912 | Unclassified | 3421 |
| 203 | Ga0496109_0159864 | 3300048912 | Bacteria | 2111 |
| 204 | Ga0496109_0637795 | 3300048912 | Unclassified | 1002 |
| 205 | Ga0496111_0232910 | 3300048914 | Bacteria | 1368 |
| 206 | Ga0496113_0011569 | 3300048916 | Bacteria | 5895 |
| 207 | Ga0496114_0056797 | 3300048917 | Bacteria | 3267 |
| 208 | Ga0496114_0075177 | 3300048917 | Bacteria | 2845 |
| 209 | Ga0496114_0279802 | 3300048917 | Bacteria | 1471 |
| 210 | Ga0496115_0001896 | 3300048918 | Bacteria | 14967 |
| 211 | Ga0496115_0007762 | 3300048918 | Bacteria | 7912 |
| 212 | Ga0496115_0075238 | 3300048918 | Unclassified | 2743 |
| 213 | nmdc:mga0n895_65591_c1 | 3300050512 | Bacteria | 3594 |
| 214 | Ga0495601_0022724 | 3300053077 | Bacteria | 3853 |
| 215 | Ga0495612_0037670 | 3300053078 | Bacteria | 1964 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10016080 | Ga0207646_100160804 | 229 |
| 2 | 3300005327 | Ga0070658_10195357 | Ga0070658_101953573 | 234 |
| 3 | 3300005563 | Ga0068855_100007176 | Ga0068855_1000071765 | 234 |
| 4 | 3300010375 | Ga0105239_10647611 | Ga0105239_106476111 | 234 |
| 5 | 3300025909 | Ga0207705_10120803 | Ga0207705_101208032 | 234 |
| 6 | 3300025939 | Ga0207665_10202066 | Ga0207665_102020661 | 234 |
| 7 | 3300025949 | Ga0207667_10005675 | Ga0207667_1000567513 | 234 |
| 8 | 3300005290 | Ga0065712_10006356 | Ga0065712_100063564 | 235 |
| 9 | 3300005293 | Ga0065715_10011184 | Ga0065715_100111844 | 235 |
| 10 | 3300005365 | Ga0070688_100125958 | Ga0070688_1001259582 | 235 |
| 11 | 3300005539 | Ga0068853_100000002 | Ga0068853_10000000262 | 235 |
| 12 | 3300005937 | Ga0081455_10018047 | Ga0081455_100180475 | 235 |
| 13 | 3300026041 | Ga0207639_10000009 | Ga0207639_1000000917 | 235 |
| 14 | 3300042012 | Ga0439455_0005543 | Ga0439455_0005543_1660_2367 | 235 |
| 15 | 3300048905 | Ga0496102_0464667 | Ga0496102_0464667_452_1165 | 235 |
| 16 | 3300048911 | Ga0496108_0201848 | Ga0496108_0201848_684_1397 | 235 |
| 17 | 3300048916 | Ga0496113_0011569 | Ga0496113_0011569_679_1392 | 235 |
| 18 | 3300005289 | Ga0065704_10007231 | Ga0065704_100072311 | 236 |
| 19 | 3300005327 | Ga0070658_10000314 | Ga0070658_1000031416 | 236 |
| 20 | 3300005339 | Ga0070660_100417394 | Ga0070660_1004173941 | 236 |
| 21 | 3300005354 | Ga0070675_100543453 | Ga0070675_1005434532 | 236 |
| 22 | 3300005434 | Ga0070709_10090221 | Ga0070709_100902212 | 236 |
| 23 | 3300005455 | Ga0070663_100497075 | Ga0070663_1004970751 | 236 |
| 24 | 3300005471 | Ga0070698_100006743 | Ga0070698_1000067436 | 236 |
| 25 | 3300005548 | Ga0070665_100223687 | Ga0070665_1002236872 | 236 |
| 26 | 3300005548 | Ga0070665_100520407 | Ga0070665_1005204072 | 236 |
| 27 | 3300005577 | Ga0068857_100743401 | Ga0068857_1007434012 | 236 |
| 28 | 3300005937 | Ga0081455_10090032 | Ga0081455_100900322 | 236 |
| 29 | 3300005985 | Ga0081539_10005852 | Ga0081539_100058523 | 236 |
| 30 | 3300006028 | Ga0070717_10125108 | Ga0070717_101251082 | 236 |
| 31 | 3300006175 | Ga0070712_100107523 | Ga0070712_1001075233 | 236 |
| 32 | 3300006358 | Ga0068871_100062686 | Ga0068871_1000626864 | 236 |
| 33 | 3300006871 | Ga0075434_100202211 | Ga0075434_1002022112 | 236 |
| 34 | 3300006880 | Ga0075429_100269666 | Ga0075429_1002696662 | 236 |
| 35 | 3300009093 | Ga0105240_10000022 | Ga0105240_10000022250 | 236 |
| 36 | 3300009093 | Ga0105240_10396126 | Ga0105240_103961261 | 236 |
| 37 | 3300009094 | Ga0111539_10148139 | Ga0111539_101481394 | 236 |
| 38 | 3300009147 | Ga0114129_10152701 | Ga0114129_101527013 | 236 |
| 39 | 3300009551 | Ga0105238_10339698 | Ga0105238_103396982 | 236 |
| 40 | 3300013306 | Ga0163162_10463445 | Ga0163162_104634452 | 236 |
| 41 | 3300014969 | Ga0157376_10000519 | Ga0157376_1000051911 | 236 |
| 42 | 3300014969 | Ga0157376_10170336 | Ga0157376_101703362 | 236 |
| 43 | 3300025909 | Ga0207705_10000430 | Ga0207705_1000043025 | 236 |
| 44 | 3300025913 | Ga0207695_10000022 | Ga0207695_10000022268 | 236 |
| 45 | 3300025919 | Ga0207657_10275897 | Ga0207657_102758971 | 236 |
| 46 | 3300025924 | Ga0207694_10140016 | Ga0207694_101400162 | 236 |
| 47 | 3300025938 | Ga0207704_10135355 | Ga0207704_101353552 | 236 |
| 48 | 3300026035 | Ga0207703_10005011 | Ga0207703_100050113 | 236 |
| 49 | 3300026116 | Ga0207674_10714478 | Ga0207674_107144781 | 236 |
| 50 | 3300028379 | Ga0268266_10343198 | Ga0268266_103431982 | 236 |
| 51 | 3300035119 | Ga0373956_0156568 | Ga0373956_0156568_159_872 | 236 |
| 52 | 3300035172 | Ga0373955_0299509 | Ga0373955_0299509_114_827 | 236 |
| 53 | 3300035692 | Ga0373935_0313958 | Ga0373935_0313958_49_762 | 236 |
| 54 | 3300035724 | Ga0373933_0064833 | Ga0373933_0064833_483_1196 | 236 |
| 55 | 3300035725 | Ga0373947_0028743 | Ga0373947_0028743_2310_3026 | 236 |
| 56 | 3300036401 | Ga0373937_0379487 | Ga0373937_0379487_70_783 | 236 |
| 57 | 3300046455 | Ga0495603_0164839 | Ga0495603_0164839_33_749 | 236 |
| 58 | 3300046459 | Ga0495629_0327786 | Ga0495629_0327786_222_938 | 236 |
| 59 | 3300046511 | Ga0495608_0214282 | Ga0495608_0214282_174_887 | 236 |
| 60 | 3300046529 | Ga0495652_0060278 | Ga0495652_0060278_811_1524 | 236 |
| 61 | 3300046531 | Ga0495665_0113183 | Ga0495665_0113183_58_774 | 236 |
| 62 | 3300046536 | Ga0495587_0026066 | Ga0495587_0026066_2598_3311 | 236 |
| 63 | 3300046543 | Ga0495645_0003646 | Ga0495645_0003646_2788_3501 | 236 |
| 64 | 3300046642 | Ga0495634_0045508 | Ga0495634_0045508_1389_2105 | 236 |
| 65 | 3300046663 | Ga0495635_0139019 | Ga0495635_0139019_70_783 | 236 |
| 66 | 3300046675 | Ga0495657_0138955 | Ga0495657_0138955_473_1186 | 236 |
| 67 | 3300046678 | Ga0495599_0013687 | Ga0495599_0013687_2699_3412 | 236 |
| 68 | 3300046679 | Ga0495623_0002288 | Ga0495623_0002288_8190_8903 | 236 |
| 69 | 3300046684 | Ga0495669_0289507 | Ga0495669_0289507_14_727 | 236 |
| 70 | 3300046689 | Ga0495613_0336808 | Ga0495613_0336808_32_748 | 236 |
| 71 | 3300047317 | Ga0495604_0128232 | Ga0495604_0128232_345_1058 | 236 |
| 72 | 3300047444 | Ga0495675_0026658 | Ga0495675_0026658_2062_2775 | 236 |
| 73 | 3300048903 | Ga0496100_0276301 | Ga0496100_0276301_29_745 | 236 |
| 74 | 3300048907 | Ga0496104_0162496 | Ga0496104_0162496_1391_2107 | 236 |
| 75 | 3300048908 | Ga0496105_0102623 | Ga0496105_0102623_1506_2222 | 236 |
| 76 | 3300048912 | Ga0496109_0061952 | Ga0496109_0061952_794_1510 | 236 |
| 77 | 3300048917 | Ga0496114_0075177 | Ga0496114_0075177_506_1222 | 236 |
| 78 | 3300048918 | Ga0496115_0075238 | Ga0496115_0075238_2003_2719 | 236 |
| 79 | 3300050512 | nmdc:mga0n895_65591_c1 | nmdc:mga0n895_65591_c1_2135_2851 | 236 |
| 80 | 3300053077 | Ga0495601_0022724 | Ga0495601_0022724_2774_3487 | 236 |
| 81 | 3300053078 | Ga0495612_0037670 | Ga0495612_0037670_729_1442 | 236 |
| 82 | 3300003203 | JGI25406J46586_10000001 | JGI25406J46586_10000001142 | 237 |
| 83 | 3300003911 | JGI25405J52794_10000454 | JGI25405J52794_100004543 | 237 |
| 84 | 3300005290 | Ga0065712_10254593 | Ga0065712_102545932 | 237 |
| 85 | 3300005293 | Ga0065715_10000207 | Ga0065715_1000020719 | 237 |
| 86 | 3300005328 | Ga0070676_10029465 | Ga0070676_100294653 | 237 |
| 87 | 3300005331 | Ga0070670_100226272 | Ga0070670_1002262721 | 237 |
| 88 | 3300005335 | Ga0070666_10090139 | Ga0070666_100901393 | 237 |
| 89 | 3300005340 | Ga0070689_100023705 | Ga0070689_1000237053 | 237 |
| 90 | 3300005347 | Ga0070668_100006202 | Ga0070668_1000062025 | 237 |
| 91 | 3300005353 | Ga0070669_100001429 | Ga0070669_1000014298 | 237 |
| 92 | 3300005354 | Ga0070675_100021406 | Ga0070675_1000214064 | 237 |
| 93 | 3300005355 | Ga0070671_100032141 | Ga0070671_1000321413 | 237 |
| 94 | 3300005355 | Ga0070671_100151677 | Ga0070671_1001516772 | 237 |
| 95 | 3300005356 | Ga0070674_100000780 | Ga0070674_10000078017 | 237 |
| 96 | 3300005434 | Ga0070709_10227711 | Ga0070709_102277111 | 237 |
| 97 | 3300005435 | Ga0070714_100222123 | Ga0070714_1002221232 | 237 |
| 98 | 3300005436 | Ga0070713_100357619 | Ga0070713_1003576192 | 237 |
| 99 | 3300005438 | Ga0070701_10092567 | Ga0070701_100925672 | 237 |
| 100 | 3300005439 | Ga0070711_100079771 | Ga0070711_1000797712 | 237 |
| 101 | 3300005440 | Ga0070705_100305503 | Ga0070705_1003055031 | 237 |
| 102 | 3300005445 | Ga0070708_100182569 | Ga0070708_1001825692 | 237 |
| 103 | 3300005445 | Ga0070708_100212511 | Ga0070708_1002125112 | 237 |
| 104 | 3300005456 | Ga0070678_100062545 | Ga0070678_1000625454 | 237 |
| 105 | 3300005457 | Ga0070662_100013651 | Ga0070662_1000136514 | 237 |
| 106 | 3300005467 | Ga0070706_100003521 | Ga0070706_1000035213 | 237 |
| 107 | 3300005467 | Ga0070706_100012129 | Ga0070706_1000121292 | 237 |
| 108 | 3300005467 | Ga0070706_100115222 | Ga0070706_1001152222 | 237 |
| 109 | 3300005468 | Ga0070707_100014343 | Ga0070707_1000143431 | 237 |
| 110 | 3300005468 | Ga0070707_100041525 | Ga0070707_1000415254 | 237 |
| 111 | 3300005468 | Ga0070707_100135602 | Ga0070707_1001356022 | 237 |
| 112 | 3300005471 | Ga0070698_100008810 | Ga0070698_1000088109 | 237 |
| 113 | 3300005471 | Ga0070698_100010716 | Ga0070698_1000107168 | 237 |
| 114 | 3300005471 | Ga0070698_100051366 | Ga0070698_1000513662 | 237 |
| 115 | 3300005471 | Ga0070698_100795032 | Ga0070698_1007950321 | 237 |
| 116 | 3300005518 | Ga0070699_100231798 | Ga0070699_1002317982 | 237 |
| 117 | 3300005536 | Ga0070697_100000889 | Ga0070697_10000088919 | 237 |
| 118 | 3300005536 | Ga0070697_100186625 | Ga0070697_1001866252 | 237 |
| 119 | 3300005536 | Ga0070697_100430251 | Ga0070697_1004302512 | 237 |
| 120 | 3300005545 | Ga0070695_100062391 | Ga0070695_1000623911 | 237 |
| 121 | 3300005546 | Ga0070696_100021487 | Ga0070696_1000214873 | 237 |
| 122 | 3300005547 | Ga0070693_100377067 | Ga0070693_1003770671 | 237 |
| 123 | 3300005614 | Ga0068856_100044681 | Ga0068856_1000446814 | 237 |
| 124 | 3300005615 | Ga0070702_100095572 | Ga0070702_1000955723 | 237 |
| 125 | 3300005617 | Ga0068859_100476154 | Ga0068859_1004761541 | 237 |
| 126 | 3300005718 | Ga0068866_10006711 | Ga0068866_100067113 | 237 |
| 127 | 3300005844 | Ga0068862_100250816 | Ga0068862_1002508162 | 237 |
| 128 | 3300005937 | Ga0081455_10000314 | Ga0081455_1000031456 | 237 |
| 129 | 3300005937 | Ga0081455_10000959 | Ga0081455_100009596 | 237 |
| 130 | 3300005937 | Ga0081455_10034338 | Ga0081455_100343382 | 237 |
| 131 | 3300005937 | Ga0081455_10065366 | Ga0081455_100653662 | 237 |
| 132 | 3300005985 | Ga0081539_10000014 | Ga0081539_10000014248 | 237 |
| 133 | 3300006173 | Ga0070716_100145826 | Ga0070716_1001458262 | 237 |
| 134 | 3300006175 | Ga0070712_100078038 | Ga0070712_1000780384 | 237 |
| 135 | 3300006175 | Ga0070712_100609471 | Ga0070712_1006094711 | 237 |
| 136 | 3300006358 | Ga0068871_100243598 | Ga0068871_1002435982 | 237 |
| 137 | 3300006871 | Ga0075434_100555340 | Ga0075434_1005553402 | 237 |
| 138 | 3300006881 | Ga0068865_100019590 | Ga0068865_1000195902 | 237 |
| 139 | 3300006931 | Ga0097620_100476142 | Ga0097620_1004761421 | 237 |
| 140 | 3300009098 | Ga0105245_10022602 | Ga0105245_100226023 | 237 |
| 141 | 3300009176 | Ga0105242_10044238 | Ga0105242_100442383 | 237 |
| 142 | 3300009553 | Ga0105249_10071958 | Ga0105249_100719583 | 237 |
| 143 | 3300009553 | Ga0105249_10916749 | Ga0105249_109167491 | 237 |
| 144 | 3300013102 | Ga0157371_10473442 | Ga0157371_104734421 | 237 |
| 145 | 3300013297 | Ga0157378_10115638 | Ga0157378_101156384 | 237 |
| 146 | 3300013297 | Ga0157378_10120941 | Ga0157378_101209413 | 237 |
| 147 | 3300013306 | Ga0163162_10004249 | Ga0163162_100042495 | 237 |
| 148 | 3300013307 | Ga0157372_10019851 | Ga0157372_100198513 | 237 |
| 149 | 3300013307 | Ga0157372_10067448 | Ga0157372_100674483 | 237 |
| 150 | 3300013307 | Ga0157372_10231805 | Ga0157372_102318052 | 237 |
| 151 | 3300013308 | Ga0157375_10117806 | Ga0157375_101178064 | 237 |
| 152 | 3300013308 | Ga0157375_10413175 | Ga0157375_104131752 | 237 |
| 153 | 3300014745 | Ga0157377_10517622 | Ga0157377_105176221 | 237 |
| 154 | 3300014968 | Ga0157379_10121608 | Ga0157379_101216083 | 237 |
| 155 | 3300014969 | Ga0157376_10432241 | Ga0157376_104322411 | 237 |
| 156 | 3300017792 | Ga0163161_10002181 | Ga0163161_100021814 | 237 |
| 157 | 3300025315 | Ga0207697_10000681 | Ga0207697_100006815 | 237 |
| 158 | 3300025901 | Ga0207688_10005383 | Ga0207688_100053834 | 237 |
| 159 | 3300025905 | Ga0207685_10002754 | Ga0207685_100027542 | 237 |
| 160 | 3300025906 | Ga0207699_10004656 | Ga0207699_100046564 | 237 |
| 161 | 3300025907 | Ga0207645_10001228 | Ga0207645_1000122817 | 237 |
| 162 | 3300025910 | Ga0207684_10000333 | Ga0207684_1000033313 | 237 |
| 163 | 3300025910 | Ga0207684_10006692 | Ga0207684_100066928 | 237 |
| 164 | 3300025910 | Ga0207684_10008775 | Ga0207684_100087757 | 237 |
| 165 | 3300025910 | Ga0207684_10026333 | Ga0207684_100263333 | 237 |
| 166 | 3300025910 | Ga0207684_10307207 | Ga0207684_103072072 | 237 |
| 167 | 3300025915 | Ga0207693_10093358 | Ga0207693_100933583 | 237 |
| 168 | 3300025915 | Ga0207693_10096129 | Ga0207693_100961292 | 237 |
| 169 | 3300025916 | Ga0207663_10012205 | Ga0207663_100122054 | 237 |
| 170 | 3300025922 | Ga0207646_10004113 | Ga0207646_100041133 | 237 |
| 171 | 3300025922 | Ga0207646_10030531 | Ga0207646_100305314 | 237 |
| 172 | 3300025922 | Ga0207646_10080784 | Ga0207646_100807842 | 237 |
| 173 | 3300025922 | Ga0207646_10359920 | Ga0207646_103599202 | 237 |
| 174 | 3300025923 | Ga0207681_10008231 | Ga0207681_100082313 | 237 |
| 175 | 3300025926 | Ga0207659_10120679 | Ga0207659_101206792 | 237 |
| 176 | 3300025928 | Ga0207700_10013284 | Ga0207700_100132842 | 237 |
| 177 | 3300025929 | Ga0207664_10091892 | Ga0207664_100918923 | 237 |
| 178 | 3300025929 | Ga0207664_10247851 | Ga0207664_102478512 | 237 |
| 179 | 3300025931 | Ga0207644_10009724 | Ga0207644_100097243 | 237 |
| 180 | 3300025931 | Ga0207644_10011970 | Ga0207644_100119704 | 237 |
| 181 | 3300025933 | Ga0207706_10023356 | Ga0207706_100233564 | 237 |
| 182 | 3300025934 | Ga0207686_10278181 | Ga0207686_102781811 | 237 |
| 183 | 3300025937 | Ga0207669_10004027 | Ga0207669_100040274 | 237 |
| 184 | 3300025938 | Ga0207704_10018396 | Ga0207704_100183962 | 237 |
| 185 | 3300025939 | Ga0207665_10009733 | Ga0207665_100097333 | 237 |
| 186 | 3300025939 | Ga0207665_10183227 | Ga0207665_101832272 | 237 |
| 187 | 3300025939 | Ga0207665_10527693 | Ga0207665_105276932 | 237 |
| 188 | 3300025940 | Ga0207691_10001630 | Ga0207691_1000163017 | 237 |
| 189 | 3300025942 | Ga0207689_10353440 | Ga0207689_103534402 | 237 |
| 190 | 3300026023 | Ga0207677_10414634 | Ga0207677_104146342 | 237 |
| 191 | 3300026121 | Ga0207683_10188774 | Ga0207683_101887742 | 237 |
| 192 | 3300028379 | Ga0268266_10651787 | Ga0268266_106517872 | 237 |
| 193 | 3300035692 | Ga0373935_0106108 | Ga0373935_0106108_533_1258 | 237 |
| 194 | 3300037418 | Ga0395900_0125571 | Ga0395900_0125571_650_1369 | 237 |
| 195 | 3300037418 | Ga0395900_0637581 | Ga0395900_0637581_156_875 | 237 |
| 196 | 3300037466 | Ga0395898_0930734 | Ga0395898_0930734_63_779 | 237 |
| 197 | 3300038443 | Ga0395901_0015680 | Ga0395901_0015680_1029_1748 | 237 |
| 198 | 3300038443 | Ga0395901_0567787 | Ga0395901_0567787_368_1087 | 237 |
| 199 | 3300045976 | Ga0466967_0231855 | Ga0466967_0231855_564_1277 | 237 |
| 200 | 3300046680 | Ga0495646_0034808 | Ga0495646_0034808_1939_2655 | 237 |
| 201 | 3300048903 | Ga0496100_0320084 | Ga0496100_0320084_100_816 | 237 |
| 202 | 3300048904 | Ga0496101_0002094 | Ga0496101_0002094_10111_10833 | 237 |
| 203 | 3300048905 | Ga0496102_0019583 | Ga0496102_0019583_4689_5411 | 237 |
| 204 | 3300048907 | Ga0496104_0258247 | Ga0496104_0258247_525_1241 | 237 |
| 205 | 3300048909 | Ga0496106_0017423 | Ga0496106_0017423_1962_2684 | 237 |
| 206 | 3300048909 | Ga0496106_0375803 | Ga0496106_0375803_364_1080 | 237 |
| 207 | 3300048910 | Ga0496107_0003832 | Ga0496107_0003832_8499_9221 | 237 |
| 208 | 3300048910 | Ga0496107_0335663 | Ga0496107_0335663_339_1061 | 237 |
| 209 | 3300048912 | Ga0496109_0159864 | Ga0496109_0159864_405_1127 | 237 |
| 210 | 3300048912 | Ga0496109_0637795 | Ga0496109_0637795_175_891 | 237 |
| 211 | 3300048914 | Ga0496111_0232910 | Ga0496111_0232910_139_861 | 237 |
| 212 | 3300048917 | Ga0496114_0056797 | Ga0496114_0056797_2214_2936 | 237 |
| 213 | 3300048917 | Ga0496114_0279802 | Ga0496114_0279802_547_1263 | 237 |
| 214 | 3300048918 | Ga0496115_0001896 | Ga0496115_0001896_2542_3264 | 237 |
| 215 | 3300048918 | Ga0496115_0007762 | Ga0496115_0007762_4649_5365 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z0a-assembly1.cif.gz_E-2 | st0452(y97n)-glcnac binding form | 0.9264 | 6 | 236 |
| 2ggo-assembly1.cif.gz_A | crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii | 0.9224 | 6 | 236 |
| 5z09-assembly2.cif.gz_D-5 | st0452(y97n)-utp binding form | 0.9185 | 6 | 236 |
| 5z0a-assembly2.cif.gz_C-3 | st0452(y97n)-glcnac binding form | 0.9179 | 6 | 236 |
| 5i1f-assembly1.cif.gz_A-2 | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose | 0.9139 | 1 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.951 | 6 | 226 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9379 | 6 | 226 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9305 | 4 | 236 | 3.90.550.10 |
| 5z0aE01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9254 | 6 | 226 | 3.90.550.10 |
| 5z0aE01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9126 | 6 | 226 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6DBB4-F1-model_v4 | Nucleotidyl transferase | 0.9875 | 1 | 214 |
GO:0009058
GO:0016779 |
| AF-A0A2V6DBB4-F1-model_v4 | Nucleotidyl transferase | 0.983 | 1 | 214 |
GO:0009058
GO:0016779 |
| AF-A0A538NIT0-F1-model_v4 | Nucleotidyltransferase family protein | 0.9795 | 56 | 237 |
GO:0009058
GO:0016779 |
| AF-A0A2V6DWD3-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.9793 | 104 | 236 |
GO:0009058
GO:0016779 |
| AF-A0A2V6HG73-F1-model_v4 | Nucleotidyl transferase | 0.9763 | 1 | 165 |
GO:0009058
GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar