F326071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 215 | 125 | 215 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10151851|Ga0070691_101518512 |
| Length | 246 |
| Sequence | MSRESPEPILRCAGVGKSFGPPSRRVEVLRGLDLAVARGEMVAVLGESGTGKTTLLHLVGAIDRPDSGVILFRGRDIGAAPPQERAVYRNRDLGFVFQLHHLLPEFSAVENAMMPLLIRGEDRGKARDRSLALLQELGLKDCADRRPSELSGGEQQRVAIARAIAGSPALLLADEPTGNLDERNAEVVFGLLSELHRRRGMTTLFVTHSARLAEKCSRILKMEHGSLTDPAGTRYNVEASTTQAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 79 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 82 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 83 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 84 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 85 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 86 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 88 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 89 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 90 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 91 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 92 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 93 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 94 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 95 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 96 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 97 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 98 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 101 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 102 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 103 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 114 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 119 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 125 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 1.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1818550 | 2162886012 | Bacteria | 2437 |
| 2 | Ga0055530_10009671 | 3300003791 | Bacteria | 3672 |
| 3 | Ga0065715_10103349 | 3300005293 | Bacteria | 3040 |
| 4 | Ga0070658_10357824 | 3300005327 | Bacteria | 1250 |
| 5 | Ga0070683_100003160 | 3300005329 | Bacteria | 13282 |
| 6 | Ga0070683_100245692 | 3300005329 | Bacteria | 1702 |
| 7 | Ga0070670_100290969 | 3300005331 | Bacteria | 1427 |
| 8 | Ga0070666_10383650 | 3300005335 | Bacteria | 1009 |
| 9 | Ga0070680_100108300 | 3300005336 | Bacteria | 2311 |
| 10 | Ga0070689_100104086 | 3300005340 | Bacteria | 2250 |
| 11 | Ga0070691_10151851 | 3300005341 | Bacteria | 1188 |
| 12 | Ga0070661_100025689 | 3300005344 | Bacteria | 4234 |
| 13 | Ga0070692_10000168 | 3300005345 | Bacteria | 16725 |
| 14 | Ga0070668_100536694 | 3300005347 | Unclassified | 1016 |
| 15 | Ga0070675_100569694 | 3300005354 | Bacteria | 1025 |
| 16 | Ga0070671_100205333 | 3300005355 | Bacteria | 1671 |
| 17 | Ga0070671_100280130 | 3300005355 | Bacteria | 1418 |
| 18 | Ga0070659_100015027 | 3300005366 | Bacteria | 5791 |
| 19 | Ga0070694_100000745 | 3300005444 | Bacteria | 18251 |
| 20 | Ga0070694_100124340 | 3300005444 | Bacteria | 1855 |
| 21 | Ga0070694_100596575 | 3300005444 | Bacteria | 889 |
| 22 | Ga0070678_100331322 | 3300005456 | Bacteria | 1303 |
| 23 | Ga0070681_10030653 | 3300005458 | Bacteria | 5397 |
| 24 | Ga0070707_100001993 | 3300005468 | Bacteria | 19536 |
| 25 | Ga0070707_100225152 | 3300005468 | Bacteria | 1826 |
| 26 | Ga0070698_100032644 | 3300005471 | Bacteria | 5391 |
| 27 | Ga0070698_100131410 | 3300005471 | Bacteria | 2459 |
| 28 | Ga0070699_100001628 | 3300005518 | Bacteria | 20479 |
| 29 | Ga0070679_100068491 | 3300005530 | Bacteria | 3540 |
| 30 | Ga0070679_100077406 | 3300005530 | Bacteria | 3315 |
| 31 | Ga0070684_100034464 | 3300005535 | Bacteria | 4329 |
| 32 | Ga0070684_100048349 | 3300005535 | Bacteria | 3690 |
| 33 | Ga0070697_100000254 | 3300005536 | Bacteria | 43120 |
| 34 | Ga0070697_100016630 | 3300005536 | Bacteria | 5786 |
| 35 | Ga0070697_100096632 | 3300005536 | Bacteria | 2451 |
| 36 | Ga0068853_100000003 | 3300005539 | Bacteria | 434636 |
| 37 | Ga0068853_100192893 | 3300005539 | Bacteria | 1852 |
| 38 | Ga0070686_100149119 | 3300005544 | Bacteria | 1636 |
| 39 | Ga0070665_100076743 | 3300005548 | Bacteria | 3348 |
| 40 | Ga0070704_100018304 | 3300005549 | Bacteria | 4476 |
| 41 | Ga0068855_100002890 | 3300005563 | Bacteria | 21019 |
| 42 | Ga0068855_100356132 | 3300005563 | Bacteria | 1611 |
| 43 | Ga0070664_100161157 | 3300005564 | Bacteria | 1985 |
| 44 | Ga0068854_100695201 | 3300005578 | Bacteria | 877 |
| 45 | Ga0068856_100011401 | 3300005614 | Bacteria | 8622 |
| 46 | Ga0068858_100185632 | 3300005842 | Bacteria | 1964 |
| 47 | Ga0081455_10100100 | 3300005937 | Bacteria | 2329 |
| 48 | Ga0081540_1037338 | 3300005983 | Unclassified | 2577 |
| 49 | Ga0075366_10239965 | 3300006195 | Bacteria | 1105 |
| 50 | Ga0075428_100000455 | 3300006844 | Bacteria | 41001 |
| 51 | Ga0075428_100010681 | 3300006844 | Bacteria | 10206 |
| 52 | Ga0075430_100337908 | 3300006846 | Bacteria | 1244 |
| 53 | Ga0075431_100020527 | 3300006847 | Bacteria | 6750 |
| 54 | Ga0075431_100041398 | 3300006847 | Bacteria | 4749 |
| 55 | Ga0075431_100189447 | 3300006847 | Bacteria | 2108 |
| 56 | Ga0075431_100287111 | 3300006847 | Bacteria | 1665 |
| 57 | Ga0075431_100415934 | 3300006847 | Bacteria | 1344 |
| 58 | Ga0075433_10598536 | 3300006852 | Bacteria | 968 |
| 59 | Ga0075434_100515657 | 3300006871 | Bacteria | 1216 |
| 60 | Ga0075429_100097197 | 3300006880 | Bacteria | 2569 |
| 61 | Ga0105240_10000007 | 3300009093 | Bacteria | 619357 |
| 62 | Ga0105240_10206140 | 3300009093 | Bacteria | 2301 |
| 63 | Ga0105240_10677586 | 3300009093 | Bacteria | 1128 |
| 64 | Ga0114129_10010305 | 3300009147 | Bacteria | 13336 |
| 65 | Ga0114129_10035854 | 3300009147 | Bacteria | 7005 |
| 66 | Ga0114129_10064863 | 3300009147 | Bacteria | 5098 |
| 67 | Ga0114129_10330226 | 3300009147 | Bacteria | 2025 |
| 68 | Ga0105238_10166087 | 3300009551 | Bacteria | 2183 |
| 69 | Ga0105239_10055384 | 3300010375 | Bacteria | 4349 |
| 70 | Ga0105239_10163574 | 3300010375 | Bacteria | 2488 |
| 71 | Ga0157370_10031047 | 3300013104 | Bacteria | 5230 |
| 72 | Ga0157369_10172531 | 3300013105 | Bacteria | 2278 |
| 73 | Ga0157372_10047293 | 3300013307 | Bacteria | 4780 |
| 74 | Ga0157375_10540551 | 3300013308 | Bacteria | 1327 |
| 75 | Ga0182008_10363027 | 3300014497 | Bacteria | 771 |
| 76 | Ga0206354_11397771 | 3300020081 | Bacteria | 901 |
| 77 | Ga0206353_10929808 | 3300020082 | Bacteria | 11176 |
| 78 | Ga0213876_10051808 | 3300021384 | Bacteria | 2169 |
| 79 | Ga0209050_1000369 | 3300025298 | Bacteria | 86187 |
| 80 | Ga0207684_10002161 | 3300025910 | Bacteria | 20150 |
| 81 | Ga0207707_10289550 | 3300025912 | Bacteria | 1417 |
| 82 | Ga0207707_10770424 | 3300025912 | Bacteria | 803 |
| 83 | Ga0207695_10000099 | 3300025913 | Bacteria | 259595 |
| 84 | Ga0207695_10255169 | 3300025913 | Bacteria | 1652 |
| 85 | Ga0207660_10109463 | 3300025917 | Bacteria | 2076 |
| 86 | Ga0207657_10045391 | 3300025919 | Bacteria | 3857 |
| 87 | Ga0207652_10047309 | 3300025921 | Bacteria | 3674 |
| 88 | Ga0207652_10150284 | 3300025921 | Bacteria | 2085 |
| 89 | Ga0207646_10007793 | 3300025922 | Bacteria | 10831 |
| 90 | Ga0207646_10195632 | 3300025922 | Bacteria | 1826 |
| 91 | Ga0207650_10505473 | 3300025925 | Bacteria | 1010 |
| 92 | Ga0207690_10193936 | 3300025932 | Bacteria | 1538 |
| 93 | Ga0207670_10079610 | 3300025936 | Bacteria | 2288 |
| 94 | Ga0207691_10557460 | 3300025940 | Bacteria | 971 |
| 95 | Ga0207661_10039394 | 3300025944 | Bacteria | 3709 |
| 96 | Ga0207661_10087576 | 3300025944 | Bacteria | 2586 |
| 97 | Ga0207679_10782263 | 3300025945 | Bacteria | 869 |
| 98 | Ga0207667_10009827 | 3300025949 | Bacteria | 11244 |
| 99 | Ga0207703_10182020 | 3300026035 | Bacteria | 1855 |
| 100 | Ga0207639_10000002 | 3300026041 | Bacteria | 903066 |
| 101 | Ga0207639_10314592 | 3300026041 | Bacteria | 1388 |
| 102 | Ga0207702_10003346 | 3300026078 | Bacteria | 14701 |
| 103 | Ga0207702_10821724 | 3300026078 | Bacteria | 919 |
| 104 | Ga0207683_10175501 | 3300026121 | Bacteria | 1942 |
| 105 | Ga0207698_10106956 | 3300026142 | Bacteria | 2334 |
| 106 | Ga0268266_10075540 | 3300028379 | Bacteria | 2927 |
| 107 | Ga0268264_10086008 | 3300028381 | Bacteria | 2700 |
| 108 | Ga0310981_1059735 | 3300029285 | Bacteria | 885 |
| 109 | Ga0265339_10148591 | 3300031249 | Bacteria | 1187 |
| 110 | Ga0265327_10000729 | 3300031251 | Bacteria | 51312 |
| 111 | Ga0265327_10011681 | 3300031251 | Bacteria | 6019 |
| 112 | Ga0265327_10081056 | 3300031251 | Bacteria | 1603 |
| 113 | Ga0265316_10320023 | 3300031344 | Bacteria | 1127 |
| 114 | Ga0316579_10181612 | 3300031691 | Bacteria | 1017 |
| 115 | Ga0316576_10071564 | 3300031727 | Bacteria | 2558 |
| 116 | Ga0316576_10112319 | 3300031727 | Unclassified | 2043 |
| 117 | Ga0316576_10123177 | 3300031727 | Unclassified | 1948 |
| 118 | Ga0316576_10167344 | 3300031727 | Bacteria | 1659 |
| 119 | Ga0316576_10209301 | 3300031727 | Bacteria | 1468 |
| 120 | Ga0316576_10263908 | 3300031727 | Bacteria | 1292 |
| 121 | Ga0316577_10002938 | 3300031733 | Bacteria | 8527 |
| 122 | Ga0316577_10235738 | 3300031733 | Bacteria | 1035 |
| 123 | Ga0373946_0073124 | 3300035171 | Bacteria | 1485 |
| 124 | Ga0373961_0021018 | 3300035241 | Bacteria | 1732 |
| 125 | Ga0316574_0234873 | 3300035398 | Bacteria | 1173 |
| 126 | Ga0373931_0278035 | 3300035691 | Bacteria | 1027 |
| 127 | Ga0373927_0151758 | 3300035695 | Bacteria | 1517 |
| 128 | Ga0316582_0069819 | 3300036647 | Bacteria | 2272 |
| 129 | Ga0316582_0139511 | 3300036647 | Bacteria | 1634 |
| 130 | Ga0316582_0349023 | 3300036647 | Bacteria | 1018 |
| 131 | Ga0316584_0045828 | 3300036712 | Bacteria | 3265 |
| 132 | Ga0316584_0084042 | 3300036712 | Bacteria | 2384 |
| 133 | Ga0316584_0154207 | 3300036712 | Bacteria | 1709 |
| 134 | Ga0316584_0285147 | 3300036712 | Unclassified | 1199 |
| 135 | Ga0395905_0221155 | 3300037471 | Bacteria | 1772 |
| 136 | Ga0400489_24770 | 3300039093 | Bacteria | 3840 |
| 137 | Ga0436365_0496829 | 3300039437 | Bacteria | 2324 |
| 138 | Ga0451577_0000379 | 3300042876 | Bacteria | 82741 |
| 139 | Ga0451577_0007816 | 3300042876 | Bacteria | 10463 |
| 140 | Ga0451577_0016627 | 3300042876 | Bacteria | 6806 |
| 141 | Ga0451577_0022557 | 3300042876 | Bacteria | 5748 |
| 142 | Ga0451577_0029177 | 3300042876 | Bacteria | 4986 |
| 143 | Ga0451577_0146026 | 3300042876 | Bacteria | 2127 |
| 144 | Ga0451577_0196907 | 3300042876 | Unclassified | 1819 |
| 145 | Ga0451577_0346063 | 3300042876 | Bacteria | 1349 |
| 146 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 147 | Ga0453683_0000195 | 3300044673 | Bacteria | 82741 |
| 148 | Ga0453683_0002345 | 3300044673 | Bacteria | 14846 |
| 149 | Ga0453683_0003763 | 3300044673 | Bacteria | 11067 |
| 150 | Ga0453683_0008318 | 3300044673 | Bacteria | 6973 |
| 151 | Ga0453683_0011300 | 3300044673 | Bacteria | 5890 |
| 152 | Ga0453683_0038376 | 3300044673 | Bacteria | 3011 |
| 153 | Ga0453683_0081922 | 3300044673 | Bacteria | 2022 |
| 154 | Ga0453683_0283644 | 3300044673 | Bacteria | 1058 |
| 155 | Ga0453683_0314102 | 3300044673 | Bacteria | 1003 |
| 156 | Ga0453683_0555871 | 3300044673 | Bacteria | 747 |
| 157 | Ga0466963_0067435 | 3300044694 | Bacteria | 2401 |
| 158 | Ga0453684_0000603 | 3300044712 | Bacteria | 132340 |
| 159 | Ga0453684_0001143 | 3300044712 | Bacteria | 82832 |
| 160 | Ga0453684_0001147 | 3300044712 | Bacteria | 82741 |
| 161 | Ga0453684_0001234 | 3300044712 | Bacteria | 77976 |
| 162 | Ga0453684_0016697 | 3300044712 | Bacteria | 11448 |
| 163 | Ga0453684_0017624 | 3300044712 | Bacteria | 11042 |
| 164 | Ga0453684_0110514 | 3300044712 | Bacteria | 3341 |
| 165 | Ga0453684_0129141 | 3300044712 | Bacteria | 3035 |
| 166 | Ga0453684_0201726 | 3300044712 | Bacteria | 2318 |
| 167 | Ga0453684_0206438 | 3300044712 | Bacteria | 2286 |
| 168 | Ga0453684_0254692 | 3300044712 | Bacteria | 2014 |
| 169 | Ga0453684_0895954 | 3300044712 | Bacteria | 950 |
| 170 | Ga0466959_0022143 | 3300045049 | Bacteria | 4695 |
| 171 | Ga0451576_0000397 | 3300045051 | Bacteria | 101182 |
| 172 | Ga0451576_0000528 | 3300045051 | Bacteria | 82741 |
| 173 | Ga0451576_0009998 | 3300045051 | Bacteria | 10934 |
| 174 | Ga0451576_0019228 | 3300045051 | Bacteria | 7458 |
| 175 | Ga0451576_0025215 | 3300045051 | Bacteria | 6408 |
| 176 | Ga0451576_0025393 | 3300045051 | Bacteria | 6382 |
| 177 | Ga0451576_0079068 | 3300045051 | Bacteria | 3422 |
| 178 | Ga0451576_0197728 | 3300045051 | Bacteria | 2100 |
| 179 | Ga0451576_0531775 | 3300045051 | Bacteria | 1235 |
| 180 | Ga0451576_1110767 | 3300045051 | Bacteria | 827 |
| 181 | Ga0466958_0178935 | 3300045836 | Bacteria | 1345 |
| 182 | Ga0466967_0004542 | 3300045976 | Bacteria | 9392 |
| 183 | Ga0466967_0052168 | 3300045976 | Bacteria | 3588 |
| 184 | Ga0495639_0079619 | 3300046475 | Bacteria | 1524 |
| 185 | Ga0495662_0024011 | 3300046476 | Bacteria | 2942 |
| 186 | Ga0495664_0099299 | 3300046477 | Bacteria | 1753 |
| 187 | Ga0495618_0165935 | 3300046514 | Bacteria | 1406 |
| 188 | Ga0495628_0044038 | 3300046516 | Bacteria | 3552 |
| 189 | Ga0495630_0030697 | 3300046517 | Bacteria | 3999 |
| 190 | Ga0495643_0000169 | 3300046522 | Bacteria | 103635 |
| 191 | Ga0495634_0142721 | 3300046642 | Bacteria | 1519 |
| 192 | Ga0495646_0238760 | 3300046680 | Bacteria | 977 |
| 193 | Ga0495674_0502995 | 3300047319 | Bacteria | 969 |
| 194 | Ga0496121_0173806 | 3300048924 | Bacteria | 1562 |
| 195 | Ga0501034_0106033 | 3300049571 | Bacteria | 2803 |
| 196 | Ga0501047_0243839 | 3300049581 | Bacteria | 1647 |
| 197 | Ga0501047_0668972 | 3300049581 | Unclassified | 857 |
| 198 | Ga0501080_0079647 | 3300049742 | Bacteria | 3045 |
| 199 | Ga0501080_0129948 | 3300049742 | Bacteria | 2331 |
| 200 | Ga0501080_0186488 | 3300049742 | Bacteria | 1907 |
| 201 | Ga0501080_0215542 | 3300049742 | Bacteria | 1758 |
| 202 | Ga0501044_0612634 | 3300049823 | Bacteria | 981 |
| 203 | nmdc:mga0k408_222951_c1 | 3300050493 | Bacteria | 1125 |
| 204 | nmdc:mga05p37_1040719_c1 | 3300050507 | Bacteria | 865 |
| 205 | nmdc:mga05p37_646443_c1 | 3300050507 | Bacteria | 1185 |
| 206 | nmdc:mga05p37_96672_c1 | 3300050507 | Bacteria | 3639 |
| 207 | nmdc:mga0qj67_18757_c1 | 3300050509 | Bacteria | 5274 |
| 208 | nmdc:mga06r32_125180_c1 | 3300050510 | Bacteria | 2538 |
| 209 | nmdc:mga06r32_188972_c1 | 3300050510 | Bacteria | 2047 |
| 210 | nmdc:mga06r32_268537_c1 | 3300050510 | Bacteria | 1693 |
| 211 | nmdc:mga06r32_516051_c1 | 3300050510 | Bacteria | 1171 |
| 212 | nmdc:mga08y16_50238_c1 | 3300050511 | Bacteria | 4364 |
| 213 | Ga0495619_0000155 | 3300053085 | Bacteria | 50682 |
| 214 | Ga0500568_0004096 | 3300053139 | Bacteria | 7892 |
| 215 | Ga0500616_0013065 | 3300053153 | Bacteria | 4835 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0895954 | Ga0453684_0895954_358_915 | 183 |
| 2 | 3300047319 | Ga0495674_0502995 | Ga0495674_0502995_23_637 | 203 |
| 3 | 3300050493 | nmdc:mga0k408_222951_c1 | nmdc:mga0k408_222951_c1_487_1110 | 203 |
| 4 | 3300050507 | nmdc:mga05p37_646443_c1 | nmdc:mga05p37_646443_c1_495_1133 | 206 |
| 5 | 3300044712 | Ga0453684_0001143 | Ga0453684_0001143_5738_6403 | 207 |
| 6 | 3300045976 | Ga0466967_0004542 | Ga0466967_0004542_863_1504 | 208 |
| 7 | 3300037471 | Ga0395905_0221155 | Ga0395905_0221155_983_1660 | 209 |
| 8 | 3300044673 | Ga0453683_0038376 | Ga0453683_0038376_1532_2197 | 209 |
| 9 | 3300042876 | Ga0451577_0029177 | Ga0451577_0029177_2859_3524 | 211 |
| 10 | 3300044712 | Ga0453684_0206438 | Ga0453684_0206438_18_686 | 212 |
| 11 | 3300044694 | Ga0466963_0067435 | Ga0466963_0067435_988_1659 | 213 |
| 12 | 3300044712 | Ga0453684_0001234 | Ga0453684_0001234_7447_8118 | 214 |
| 13 | 3300045051 | Ga0451576_1110767 | Ga0451576_1110767_94_765 | 214 |
| 14 | 3300049571 | Ga0501034_0106033 | Ga0501034_0106033_729_1388 | 214 |
| 15 | 3300049742 | Ga0501080_0079647 | Ga0501080_0079647_2033_2692 | 214 |
| 16 | 3300044673 | Ga0453683_0555871 | Ga0453683_0555871_46_702 | 216 |
| 17 | 3300044673 | Ga0453683_0000005 | Ga0453683_0000005_344675_345334 | 217 |
| 18 | 3300042876 | Ga0451577_0022557 | Ga0451577_0022557_4907_5572 | 218 |
| 19 | 3300042876 | Ga0451577_0196907 | Ga0451577_0196907_791_1456 | 218 |
| 20 | 3300044673 | Ga0453683_0011300 | Ga0453683_0011300_1049_1714 | 218 |
| 21 | 3300044712 | Ga0453684_0000603 | Ga0453684_0000603_131499_132164 | 218 |
| 22 | 3300045051 | Ga0451576_0000397 | Ga0451576_0000397_177_842 | 218 |
| 23 | 3300031251 | Ga0265327_10000729 | Ga0265327_100007294 | 219 |
| 24 | 3300031727 | Ga0316576_10071564 | Ga0316576_100715642 | 219 |
| 25 | 3300031727 | Ga0316576_10123177 | Ga0316576_101231772 | 219 |
| 26 | 3300031727 | Ga0316576_10263908 | Ga0316576_102639082 | 219 |
| 27 | 3300044673 | Ga0453683_0002345 | Ga0453683_0002345_4386_5054 | 219 |
| 28 | 3300044673 | Ga0453683_0003763 | Ga0453683_0003763_6070_6738 | 219 |
| 29 | 3300044712 | Ga0453684_0017624 | Ga0453684_0017624_7454_8122 | 219 |
| 30 | 3300044712 | Ga0453684_0129141 | Ga0453684_0129141_301_969 | 219 |
| 31 | 3300045051 | Ga0451576_0009998 | Ga0451576_0009998_1413_2084 | 219 |
| 32 | 3300045051 | Ga0451576_0025393 | Ga0451576_0025393_4111_4779 | 219 |
| 33 | 3300045051 | Ga0451576_0197728 | Ga0451576_0197728_818_1489 | 219 |
| 34 | 3300045051 | Ga0451576_0531775 | Ga0451576_0531775_301_969 | 219 |
| 35 | 3300050511 | nmdc:mga08y16_50238_c1 | nmdc:mga08y16_50238_c1_1678_2355 | 219 |
| 36 | 3300005444 | Ga0070694_100124340 | Ga0070694_1001243402 | 220 |
| 37 | 3300005468 | Ga0070707_100225152 | Ga0070707_1002251522 | 220 |
| 38 | 3300006852 | Ga0075433_10598536 | Ga0075433_105985361 | 220 |
| 39 | 3300025922 | Ga0207646_10195632 | Ga0207646_101956322 | 220 |
| 40 | 3300026041 | Ga0207639_10000002 | Ga0207639_10000002668 | 220 |
| 41 | 3300031251 | Ga0265327_10011681 | Ga0265327_100116814 | 220 |
| 42 | 3300031251 | Ga0265327_10081056 | Ga0265327_100810562 | 220 |
| 43 | 3300031727 | Ga0316576_10167344 | Ga0316576_101673442 | 220 |
| 44 | 3300035241 | Ga0373961_0021018 | Ga0373961_0021018_831_1502 | 220 |
| 45 | 3300035398 | Ga0316574_0234873 | Ga0316574_0234873_178_852 | 220 |
| 46 | 3300035691 | Ga0373931_0278035 | Ga0373931_0278035_267_938 | 220 |
| 47 | 3300036712 | Ga0316584_0285147 | Ga0316584_0285147_68_751 | 220 |
| 48 | 3300042876 | Ga0451577_0000379 | Ga0451577_0000379_30243_30914 | 220 |
| 49 | 3300042876 | Ga0451577_0146026 | Ga0451577_0146026_768_1439 | 220 |
| 50 | 3300044673 | Ga0453683_0000195 | Ga0453683_0000195_51828_52499 | 220 |
| 51 | 3300044673 | Ga0453683_0314102 | Ga0453683_0314102_28_699 | 220 |
| 52 | 3300044712 | Ga0453684_0001147 | Ga0453684_0001147_51828_52499 | 220 |
| 53 | 3300044712 | Ga0453684_0016697 | Ga0453684_0016697_2748_3419 | 220 |
| 54 | 3300045051 | Ga0451576_0000528 | Ga0451576_0000528_51828_52499 | 220 |
| 55 | 3300003791 | Ga0055530_10009671 | Ga0055530_100096712 | 221 |
| 56 | 3300005327 | Ga0070658_10357824 | Ga0070658_103578241 | 221 |
| 57 | 3300005335 | Ga0070666_10383650 | Ga0070666_103836501 | 221 |
| 58 | 3300005340 | Ga0070689_100104086 | Ga0070689_1001040862 | 221 |
| 59 | 3300005548 | Ga0070665_100076743 | Ga0070665_1000767434 | 221 |
| 60 | 3300005563 | Ga0068855_100002890 | Ga0068855_10000289011 | 221 |
| 61 | 3300005614 | Ga0068856_100011401 | Ga0068856_1000114016 | 221 |
| 62 | 3300005842 | Ga0068858_100185632 | Ga0068858_1001856322 | 221 |
| 63 | 3300006195 | Ga0075366_10239965 | Ga0075366_102399652 | 221 |
| 64 | 3300006847 | Ga0075431_100287111 | Ga0075431_1002871112 | 221 |
| 65 | 3300025298 | Ga0209050_1000369 | Ga0209050_100036932 | 221 |
| 66 | 3300025936 | Ga0207670_10079610 | Ga0207670_100796102 | 221 |
| 67 | 3300025949 | Ga0207667_10009827 | Ga0207667_100098272 | 221 |
| 68 | 3300026035 | Ga0207703_10182020 | Ga0207703_101820202 | 221 |
| 69 | 3300026078 | Ga0207702_10003346 | Ga0207702_1000334611 | 221 |
| 70 | 3300028379 | Ga0268266_10075540 | Ga0268266_100755402 | 221 |
| 71 | 3300028381 | Ga0268264_10086008 | Ga0268264_100860082 | 221 |
| 72 | 3300029285 | Ga0310981_1059735 | Ga0310981_10597352 | 221 |
| 73 | 3300042876 | Ga0451577_0007816 | Ga0451577_0007816_8893_9567 | 221 |
| 74 | 3300045049 | Ga0466959_0022143 | Ga0466959_0022143_213_932 | 221 |
| 75 | 3300045836 | Ga0466958_0178935 | Ga0466958_0178935_494_1213 | 221 |
| 76 | 3300048924 | Ga0496121_0173806 | Ga0496121_0173806_198_881 | 221 |
| 77 | 3300050510 | nmdc:mga06r32_268537_c1 | nmdc:mga06r32_268537_c1_534_1205 | 221 |
| 78 | 3300053139 | Ga0500568_0004096 | Ga0500568_0004096_3035_3718 | 221 |
| 79 | 3300053153 | Ga0500616_0013065 | Ga0500616_0013065_2722_3405 | 221 |
| 80 | 3300005354 | Ga0070675_100569694 | Ga0070675_1005696941 | 222 |
| 81 | 3300005355 | Ga0070671_100280130 | Ga0070671_1002801302 | 222 |
| 82 | 3300035171 | Ga0373946_0073124 | Ga0373946_0073124_480_1154 | 222 |
| 83 | 3300042876 | Ga0451577_0346063 | Ga0451577_0346063_49_729 | 222 |
| 84 | 3300044712 | Ga0453684_0110514 | Ga0453684_0110514_2371_3051 | 222 |
| 85 | 3300046475 | Ga0495639_0079619 | Ga0495639_0079619_735_1409 | 222 |
| 86 | 3300046476 | Ga0495662_0024011 | Ga0495662_0024011_484_1158 | 222 |
| 87 | 3300046477 | Ga0495664_0099299 | Ga0495664_0099299_517_1191 | 222 |
| 88 | 3300046514 | Ga0495618_0165935 | Ga0495618_0165935_521_1195 | 222 |
| 89 | 3300046516 | Ga0495628_0044038 | Ga0495628_0044038_2519_3193 | 222 |
| 90 | 3300046517 | Ga0495630_0030697 | Ga0495630_0030697_2783_3457 | 222 |
| 91 | 3300046522 | Ga0495643_0000169 | Ga0495643_0000169_24924_25610 | 222 |
| 92 | 3300046642 | Ga0495634_0142721 | Ga0495634_0142721_473_1147 | 222 |
| 93 | 3300046680 | Ga0495646_0238760 | Ga0495646_0238760_116_790 | 222 |
| 94 | 3300049742 | Ga0501080_0129948 | Ga0501080_0129948_720_1406 | 222 |
| 95 | 3300049742 | Ga0501080_0186488 | Ga0501080_0186488_1013_1699 | 222 |
| 96 | 3300009093 | Ga0105240_10000007 | Ga0105240_10000007482 | 223 |
| 97 | 3300009093 | Ga0105240_10677586 | Ga0105240_106775861 | 223 |
| 98 | 3300010375 | Ga0105239_10055384 | Ga0105239_100553842 | 223 |
| 99 | 3300025913 | Ga0207695_10000099 | Ga0207695_1000009919 | 223 |
| 100 | 3300031344 | Ga0265316_10320023 | Ga0265316_103200231 | 223 |
| 101 | 3300031691 | Ga0316579_10181612 | Ga0316579_101816122 | 223 |
| 102 | 3300031727 | Ga0316576_10112319 | Ga0316576_101123191 | 223 |
| 103 | 3300031733 | Ga0316577_10235738 | Ga0316577_102357382 | 223 |
| 104 | 3300035695 | Ga0373927_0151758 | Ga0373927_0151758_193_888 | 223 |
| 105 | 3300036647 | Ga0316582_0139511 | Ga0316582_0139511_529_1218 | 223 |
| 106 | 3300036712 | Ga0316584_0084042 | Ga0316584_0084042_1573_2262 | 223 |
| 107 | 3300042876 | Ga0451577_0016627 | Ga0451577_0016627_380_1069 | 223 |
| 108 | 3300044673 | Ga0453683_0081922 | Ga0453683_0081922_1035_1721 | 223 |
| 109 | 3300044673 | Ga0453683_0283644 | Ga0453683_0283644_343_1032 | 223 |
| 110 | 3300044712 | Ga0453684_0254692 | Ga0453684_0254692_709_1398 | 223 |
| 111 | 3300045051 | Ga0451576_0019228 | Ga0451576_0019228_77_766 | 223 |
| 112 | 3300049581 | Ga0501047_0668972 | Ga0501047_0668972_86_766 | 223 |
| 113 | 3300049742 | Ga0501080_0215542 | Ga0501080_0215542_132_812 | 223 |
| 114 | 3300005983 | Ga0081540_1037338 | Ga0081540_10373382 | 224 |
| 115 | 3300036647 | Ga0316582_0069819 | Ga0316582_0069819_819_1511 | 224 |
| 116 | 3300036647 | Ga0316582_0349023 | Ga0316582_0349023_197_886 | 224 |
| 117 | 3300045051 | Ga0451576_0079068 | Ga0451576_0079068_455_1147 | 224 |
| 118 | 3300005544 | Ga0070686_100149119 | Ga0070686_1001491191 | 225 |
| 119 | 3300006847 | Ga0075431_100041398 | Ga0075431_1000413985 | 225 |
| 120 | 3300006880 | Ga0075429_100097197 | Ga0075429_1000971972 | 225 |
| 121 | 3300009147 | Ga0114129_10035854 | Ga0114129_100358545 | 225 |
| 122 | 3300031733 | Ga0316577_10002938 | Ga0316577_100029382 | 225 |
| 123 | 3300036712 | Ga0316584_0045828 | Ga0316584_0045828_245_940 | 225 |
| 124 | 3300039093 | Ga0400489_24770 | Ga0400489_24770_3018_3713 | 225 |
| 125 | 3300050507 | nmdc:mga05p37_1040719_c1 | nmdc:mga05p37_1040719_c1_121_804 | 225 |
| 126 | 3300050510 | nmdc:mga06r32_125180_c1 | nmdc:mga06r32_125180_c1_1090_1815 | 225 |
| 127 | 3300005329 | Ga0070683_100245692 | Ga0070683_1002456921 | 226 |
| 128 | 3300005336 | Ga0070680_100108300 | Ga0070680_1001083001 | 226 |
| 129 | 3300005344 | Ga0070661_100025689 | Ga0070661_1000256892 | 226 |
| 130 | 3300005366 | Ga0070659_100015027 | Ga0070659_1000150273 | 226 |
| 131 | 3300005458 | Ga0070681_10030653 | Ga0070681_100306531 | 226 |
| 132 | 3300005530 | Ga0070679_100077406 | Ga0070679_1000774064 | 226 |
| 133 | 3300005535 | Ga0070684_100048349 | Ga0070684_1000483493 | 226 |
| 134 | 3300005539 | Ga0068853_100192893 | Ga0068853_1001928933 | 226 |
| 135 | 3300005564 | Ga0070664_100161157 | Ga0070664_1001611572 | 226 |
| 136 | 3300005578 | Ga0068854_100695201 | Ga0068854_1006952011 | 226 |
| 137 | 3300006844 | Ga0075428_100000455 | Ga0075428_10000045523 | 226 |
| 138 | 3300006844 | Ga0075428_100010681 | Ga0075428_1000106817 | 226 |
| 139 | 3300006846 | Ga0075430_100337908 | Ga0075430_1003379082 | 226 |
| 140 | 3300006847 | Ga0075431_100189447 | Ga0075431_1001894472 | 226 |
| 141 | 3300006847 | Ga0075431_100415934 | Ga0075431_1004159342 | 226 |
| 142 | 3300006871 | Ga0075434_100515657 | Ga0075434_1005156572 | 226 |
| 143 | 3300009093 | Ga0105240_10206140 | Ga0105240_102061403 | 226 |
| 144 | 3300009147 | Ga0114129_10330226 | Ga0114129_103302262 | 226 |
| 145 | 3300009551 | Ga0105238_10166087 | Ga0105238_101660872 | 226 |
| 146 | 3300010375 | Ga0105239_10163574 | Ga0105239_101635742 | 226 |
| 147 | 3300013104 | Ga0157370_10031047 | Ga0157370_100310477 | 226 |
| 148 | 3300013105 | Ga0157369_10172531 | Ga0157369_101725313 | 226 |
| 149 | 3300013307 | Ga0157372_10047293 | Ga0157372_100472935 | 226 |
| 150 | 3300020081 | Ga0206354_11397771 | Ga0206354_113977711 | 226 |
| 151 | 3300020082 | Ga0206353_10929808 | Ga0206353_109298085 | 226 |
| 152 | 3300025912 | Ga0207707_10289550 | Ga0207707_102895501 | 226 |
| 153 | 3300025912 | Ga0207707_10770424 | Ga0207707_107704241 | 226 |
| 154 | 3300025917 | Ga0207660_10109463 | Ga0207660_101094631 | 226 |
| 155 | 3300025919 | Ga0207657_10045391 | Ga0207657_100453915 | 226 |
| 156 | 3300025921 | Ga0207652_10150284 | Ga0207652_101502844 | 226 |
| 157 | 3300025932 | Ga0207690_10193936 | Ga0207690_101939361 | 226 |
| 158 | 3300025944 | Ga0207661_10087576 | Ga0207661_100875764 | 226 |
| 159 | 3300025945 | Ga0207679_10782263 | Ga0207679_107822631 | 226 |
| 160 | 3300026041 | Ga0207639_10314592 | Ga0207639_103145923 | 226 |
| 161 | 3300026078 | Ga0207702_10821724 | Ga0207702_108217242 | 226 |
| 162 | 3300026142 | Ga0207698_10106956 | Ga0207698_101069562 | 226 |
| 163 | 3300031249 | Ga0265339_10148591 | Ga0265339_101485911 | 226 |
| 164 | 3300044673 | Ga0453683_0008318 | Ga0453683_0008318_4211_4906 | 226 |
| 165 | 3300045051 | Ga0451576_0025215 | Ga0451576_0025215_3867_4562 | 226 |
| 166 | 3300045976 | Ga0466967_0052168 | Ga0466967_0052168_113_826 | 226 |
| 167 | 3300050509 | nmdc:mga0qj67_18757_c1 | nmdc:mga0qj67_18757_c1_572_1270 | 226 |
| 168 | 3300050510 | nmdc:mga06r32_516051_c1 | nmdc:mga06r32_516051_c1_125_823 | 226 |
| 169 | 3300005444 | Ga0070694_100596575 | Ga0070694_1005965752 | 227 |
| 170 | 3300005468 | Ga0070707_100001993 | Ga0070707_10000199311 | 227 |
| 171 | 3300005471 | Ga0070698_100032644 | Ga0070698_1000326446 | 227 |
| 172 | 3300005518 | Ga0070699_100001628 | Ga0070699_10000162814 | 227 |
| 173 | 3300005536 | Ga0070697_100016630 | Ga0070697_1000166302 | 227 |
| 174 | 3300021384 | Ga0213876_10051808 | Ga0213876_100518082 | 227 |
| 175 | 3300025910 | Ga0207684_10002161 | Ga0207684_100021619 | 227 |
| 176 | 3300025922 | Ga0207646_10007793 | Ga0207646_100077935 | 227 |
| 177 | 3300039437 | Ga0436365_0496829 | Ga0436365_0496829_960_1652 | 227 |
| 178 | 3300005329 | Ga0070683_100003160 | Ga0070683_1000031609 | 228 |
| 179 | 3300005530 | Ga0070679_100068491 | Ga0070679_1000684912 | 228 |
| 180 | 3300005535 | Ga0070684_100034464 | Ga0070684_1000344645 | 228 |
| 181 | 3300005539 | Ga0068853_100000003 | Ga0068853_100000003301 | 228 |
| 182 | 3300005937 | Ga0081455_10100100 | Ga0081455_101001002 | 228 |
| 183 | 3300009147 | Ga0114129_10064863 | Ga0114129_100648636 | 228 |
| 184 | 3300025921 | Ga0207652_10047309 | Ga0207652_100473092 | 228 |
| 185 | 3300025944 | Ga0207661_10039394 | Ga0207661_100393943 | 228 |
| 186 | 3300005331 | Ga0070670_100290969 | Ga0070670_1002909692 | 229 |
| 187 | 3300005347 | Ga0070668_100536694 | Ga0070668_1005366942 | 229 |
| 188 | 3300005355 | Ga0070671_100205333 | Ga0070671_1002053332 | 229 |
| 189 | 3300005456 | Ga0070678_100331322 | Ga0070678_1003313222 | 229 |
| 190 | 3300005563 | Ga0068855_100356132 | Ga0068855_1003561322 | 229 |
| 191 | 3300013308 | Ga0157375_10540551 | Ga0157375_105405512 | 229 |
| 192 | 3300025913 | Ga0207695_10255169 | Ga0207695_102551692 | 229 |
| 193 | 3300025925 | Ga0207650_10505473 | Ga0207650_105054732 | 229 |
| 194 | 3300025940 | Ga0207691_10557460 | Ga0207691_105574601 | 229 |
| 195 | 3300026121 | Ga0207683_10175501 | Ga0207683_101755012 | 229 |
| 196 | 3300053085 | Ga0495619_0000155 | Ga0495619_0000155_15241_15966 | 229 |
| 197 | 3300044712 | Ga0453684_0201726 | Ga0453684_0201726_309_1052 | 230 |
| 198 | 3300005341 | Ga0070691_10151851 | Ga0070691_101518512 | 231 |
| 199 | 3300005345 | Ga0070692_10000168 | Ga0070692_100001687 | 231 |
| 200 | 3300005444 | Ga0070694_100000745 | Ga0070694_1000007452 | 231 |
| 201 | 3300005471 | Ga0070698_100131410 | Ga0070698_1001314102 | 231 |
| 202 | 3300005536 | Ga0070697_100000254 | Ga0070697_10000025412 | 231 |
| 203 | 3300005536 | Ga0070697_100096632 | Ga0070697_1000966322 | 231 |
| 204 | 3300005549 | Ga0070704_100018304 | Ga0070704_1000183042 | 231 |
| 205 | 3300006847 | Ga0075431_100020527 | Ga0075431_1000205273 | 231 |
| 206 | 3300009147 | Ga0114129_10010305 | Ga0114129_100103059 | 231 |
| 207 | 3300050507 | nmdc:mga05p37_96672_c1 | nmdc:mga05p37_96672_c1_398_1138 | 231 |
| 208 | 3300050510 | nmdc:mga06r32_188972_c1 | nmdc:mga06r32_188972_c1_672_1412 | 231 |
| 209 | 3300014497 | Ga0182008_10363027 | Ga0182008_103630271 | 233 |
| 210 | 3300049581 | Ga0501047_0243839 | Ga0501047_0243839_696_1418 | 233 |
| 211 | 3300049823 | Ga0501044_0612634 | Ga0501044_0612634_116_838 | 233 |
| 212 | 2162886012 | MBSR1b_contig_1818550 | MBSR1b_0146.00000080 | 234 |
| 213 | 3300005293 | Ga0065715_10103349 | Ga0065715_101033492 | 234 |
| 214 | 3300031727 | Ga0316576_10209301 | Ga0316576_102093012 | 234 |
| 215 | 3300036712 | Ga0316584_0154207 | Ga0316584_0154207_795_1535 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9677 | 12 | 233 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9627 | 10 | 234 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9619 | 13 | 234 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9564 | 13 | 232 |
| 7ahc-assembly1.cif.gz_C | opua apo inward-facing | 0.9563 | 13 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9797 | 10 | 231 | 3.40.50.300 |
| af_P14175_33_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9737 | 32 | 233 | 3.40.50.300 |
| af_P9WQK5_1_219_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9733 | 13 | 226 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9692 | 12 | 234 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9671 | 39 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538RLX8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9793 | 13 | 233 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A6I5GX10-F1-model_v4 | Betaine/proline/choline family ABC transporter ATP-binding protein | 0.9793 | 46 | 232 |
GO:0005524
GO:0016020 GO:0016887 GO:0031460 |
| AF-A0A3B8L505-F1-model_v4 | ABC transporter ATP-binding protein | 0.9787 | 11 | 231 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7C3WP49-F1-model_v4 | ABC transporter ATP-binding protein | 0.9783 | 10 | 233 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A522W8K2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9777 | 10 | 234 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar