F325666

General Info

Members Datasets Scaffolds Average Seq Length
214 142 210 188

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0302365|Ga0496121_0302365_209_892
Length 227
Sequence MSATRLPLTMEKAVTDCWLEQSPTIVGDRKEALTMLDTSSYERCSWAQDDPMMRGYHDVEWGVPQRDPRMLWEMLMLEGFQAGLAWIIILRKRDAFRAAFADFDPVKVAAFDERDIERLMADPGIVRARAKIEATIKGAQIYCEMQDRGEDFSEFCWSFTKGIPVLGDGKSWLATTPLSETISKELKRRGFKFVGPTITYAWMQAVGIVNDHSLSCFRRHVETGCRR

Samples

Sample ID Description Type Environment
1 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
2 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
3 3004167301 Mesorhizobium loti 582 Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
64 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
65 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
95 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
137 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
138 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 0.47
Rhizoplane 2.34
Rhizosphere 80.37
Stem 0
Stem Tuber 0
Unclassified 6.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013422 3300001989 Bacteria 2992
2 JGI24739J22299_10032313 3300001989 Bacteria 1802
3 JGI24737J22298_10046129 3300001990 Bacteria 1330
4 JGI24735J21928_10016734 3300002067 Bacteria 2271
5 JGI24735J21928_10023188 3300002067 Bacteria 1884
6 Ga0055529_1001903 3300003763 Bacteria 4796
7 Ga0058692_1016067 3300003856 Bacteria 1673
8 Ga0065165_1000001 3300005262 Bacteria 494087
9 Ga0070658_10697669 3300005327 Bacteria 881
10 Ga0070661_100013711 3300005344 Bacteria 5694
11 Ga0070668_100001993 3300005347 Bacteria 14929
12 Ga0070668_100102261 3300005347 Bacteria 2272
13 Ga0070668_100225251 3300005347 Bacteria 1548
14 Ga0070671_100218700 3300005355 Bacteria 1616
15 Ga0070667_100002460 3300005367 Bacteria 16164
16 Ga0070662_100007864 3300005457 Bacteria 6926
17 Ga0070706_100774528 3300005467 Bacteria 889
18 Ga0070672_100986154 3300005543 Bacteria 746
19 Ga0070686_100000034 3300005544 Bacteria 112341
20 Ga0070665_100295025 3300005548 Bacteria 1624
21 Ga0068863_100002812 3300005841 Bacteria 17228
22 Ga0068860_100328509 3300005843 Bacteria 1502
23 Ga0068862_100000510 3300005844 Bacteria 41329
24 Ga0075370_10296782 3300006353 Bacteria 961
25 Ga0075434_100165038 3300006871 Bacteria 2234
26 Ga0075436_100881421 3300006914 Bacteria 669
27 Ga0105247_10003010 3300009101 Bacteria 11168
28 Ga0105241_10394205 3300009174 Bacteria 1213
29 Ga0105248_10005918 3300009177 Bacteria 13443
30 Ga0105248_10126583 3300009177 Bacteria 2881
31 Ga0105248_10528256 3300009177 Bacteria 1331
32 Ga0105249_10010774 3300009553 Bacteria 8033
33 Ga0157326_1006125 3300012513 Bacteria 1279
34 Ga0157373_10467584 3300013100 Bacteria 909
35 Ga0157370_10101521 3300013104 Bacteria 2694
36 Ga0157369_10800181 3300013105 Bacteria 969
37 Ga0157374_10018251 3300013296 Bacteria 6189
38 Ga0157372_10014716 3300013307 Bacteria 8371
39 Ga0157372_10587757 3300013307 Bacteria 1298
40 Ga0157379_10040393 3300014968 Bacteria 4164
41 Ga0182006_1000005 3300015261 Bacteria 621201
42 Ga0163161_10003322 3300017792 Bacteria 11279
43 Ga0163161_10058811 3300017792 Bacteria 2794
44 Ga0163161_10087940 3300017792 Bacteria 2296
45 Ga0209674_101090 3300025226 Bacteria 8044
46 Ga0209437_101430 3300025233 Bacteria 5854
47 Ga0209258_102850 3300025242 Bacteria 4121
48 Ga0209148_1001060 3300025254 Bacteria 16929
49 Ga0209455_1001991 3300025272 Bacteria 8378
50 Ga0209673_1033047 3300025273 Bacteria 1584
51 Ga0209256_1012440 3300025299 Bacteria 3261
52 Ga0207426_1068650 3300025302 Bacteria 996
53 Ga0209051_1057371 3300025303 Bacteria 1248
54 Ga0207647_10182248 3300025904 Bacteria 1219
55 Ga0207705_10815215 3300025909 Bacteria 724
56 Ga0207657_10346316 3300025919 Bacteria 1172
57 Ga0207649_10005725 3300025920 Bacteria 6729
58 Ga0207681_10318868 3300025923 Bacteria 1235
59 Ga0207681_10607339 3300025923 Bacteria 904
60 Ga0207644_10320608 3300025931 Bacteria 1253
61 Ga0207706_10004946 3300025933 Bacteria 12450
62 Ga0207711_10003119 3300025941 Bacteria 14451
63 Ga0207711_10133412 3300025941 Bacteria 2228
64 Ga0207711_10341502 3300025941 Bacteria 1386
65 Ga0207668_10012609 3300025972 Bacteria 5180
66 Ga0207641_10002460 3300026088 Bacteria 17117
67 Ga0268266_11069391 3300028379 Bacteria 781
68 Ga0268264_10007841 3300028381 Bacteria 8888
69 Ga0373957_0151690 3300035120 Bacteria 951
70 Ga0373955_0016121 3300035172 Bacteria 3673
71 Ga0373933_0013866 3300035724 Bacteria 4472
72 Ga0451837_1760151 3300041494 Bacteria 1052
73 Ga0451845_0197061 3300041501 Bacteria 769
74 Ga0451843_0193364 3300041509 Bacteria 1087
75 Ga0439448_0002443 3300042005 Bacteria 5059
76 Ga0439455_0001126 3300042012 Bacteria 4293
77 Ga0439455_0060993 3300042012 Bacteria 1000
78 Ga0439458_0000207 3300042157 Bacteria 13733
79 Ga0466971_0069580 3300044719 Bacteria 1597
80 Ga0466957_0011261 3300044842 Bacteria 5152
81 Ga0466957_0450748 3300044842 Bacteria 887
82 Ga0466958_0083151 3300045836 Bacteria 1973
83 Ga0495617_000183 3300046452 Bacteria 39626
84 Ga0495617_000394 3300046452 Bacteria 24169
85 Ga0495638_0000422 3300046460 Bacteria 51201
86 Ga0495585_0000780 3300046492 Bacteria 28158
87 Ga0495607_0000003 3300046501 Bacteria 366900
88 Ga0495607_0000010 3300046501 Bacteria 206525
89 Ga0495583_0055268 3300046506 Bacteria 1794
90 Ga0495606_0000469 3300046507 Bacteria 66319
91 Ga0495606_0018574 3300046507 Bacteria 5205
92 Ga0495610_0000199 3300046512 Bacteria 67146
93 Ga0495610_0047203 3300046512 Bacteria 2120
94 Ga0495610_0171483 3300046512 Bacteria 909
95 Ga0495616_0000022 3300046513 Bacteria 149720
96 Ga0495616_0013621 3300046513 Bacteria 4580
97 Ga0495620_0000397 3300046515 Bacteria 29197
98 Ga0495631_0000137 3300046518 Bacteria 49790
99 Ga0495631_0000728 3300046518 Bacteria 21163
100 Ga0495632_0000011 3300046519 Bacteria 266804
101 Ga0495632_0058371 3300046519 Bacteria 1881
102 Ga0495648_0000798 3300046524 Bacteria 33314
103 Ga0495609_0003385 3300046538 Bacteria 9165
104 Ga0495611_0000001 3300046648 Bacteria 2628469
105 Ga0495611_0000068 3300046648 Bacteria 71983
106 Ga0495611_0134553 3300046648 Bacteria 1153
107 Ga0495625_0000001 3300046660 Bacteria 1641829
108 Ga0495625_0257141 3300046660 Bacteria 1131
109 Ga0495661_0000885 3300046665 Bacteria 27597
110 Ga0495661_0058660 3300046665 Bacteria 2293
111 Ga0495670_0000719 3300046691 Bacteria 15775
112 Ga0495671_0003422 3300046692 Bacteria 9752
113 Ga0495589_0000016 3300046794 Bacteria 209027
114 Ga0495660_0000116 3300046810 Bacteria 85798
115 Ga0495660_0000357 3300046810 Bacteria 40440
116 Ga0495672_0134655 3300047320 Bacteria 1296
117 Ga0495679_000001 3300047446 Bacteria 1607568
118 Ga0495673_0000001 3300047469 Bacteria 1630730
119 Ga0495673_0001025 3300047469 Bacteria 24644
120 Ga0495681_0000038 3300047470 Bacteria 121100
121 Ga0495686_0000115 3300047472 Bacteria 166876
122 Ga0495686_0000824 3300047472 Bacteria 39973
123 Ga0495686_0164606 3300047472 Bacteria 1293
124 Ga0496100_0010911 3300048903 Bacteria 5158
125 Ga0496101_0007860 3300048904 Bacteria 6938
126 Ga0496102_1152097 3300048905 Bacteria 695
127 Ga0496106_0000705 3300048909 Bacteria 24064
128 Ga0496106_0170668 3300048909 Bacteria 1724
129 Ga0496119_0029944 3300048922 Bacteria 3679
130 Ga0496121_0001558 3300048924 Bacteria 38344
131 Ga0496121_0009781 3300048924 Bacteria 10958
132 Ga0496121_0302365 3300048924 Bacteria 1085
133 Ga0496122_0007120 3300048925 Bacteria 12554
134 Ga0496122_0019903 3300048925 Bacteria 6102
135 Ga0496123_0015361 3300048926 Bacteria 6284
136 Ga0496123_0040968 3300048926 Bacteria 3217
137 Ga0496126_0000150 3300048929 Bacteria 162748
138 Ga0495678_000332 3300049459 Bacteria 49495
139 Ga0495682_0001413 3300049460 Bacteria 13055
140 Ga0495682_0040098 3300049460 Bacteria 1717
141 Ga0501032_0000984 3300049569 Bacteria 22979
142 Ga0501032_0014950 3300049569 Bacteria 5490
143 Ga0501033_0018711 3300049570 Bacteria 5235
144 Ga0501034_0001368 3300049571 Bacteria 32875
145 Ga0501034_0034730 3300049571 Bacteria 5112
146 Ga0501034_0106983 3300049571 Bacteria 2789
147 Ga0501034_0215374 3300049571 Bacteria 1874
148 Ga0501036_0068745 3300049572 Bacteria 2997
149 Ga0501036_0092605 3300049572 Bacteria 2553
150 Ga0501037_0028610 3300049573 Bacteria 4116
151 Ga0501037_0205713 3300049573 Bacteria 1389
152 Ga0501038_0008435 3300049574 Bacteria 9477
153 Ga0501038_0016687 3300049574 Bacteria 6654
154 Ga0501039_0051425 3300049575 Bacteria 3188
155 Ga0501043_0023469 3300049579 Bacteria 4837
156 Ga0501043_0060200 3300049579 Bacteria 2980
157 Ga0501043_0062988 3300049579 Bacteria 2912
158 Ga0501043_0607210 3300049579 Bacteria 807
159 Ga0501046_0005406 3300049580 Bacteria 11418
160 Ga0501046_0157416 3300049580 Bacteria 1710
161 Ga0501046_0327866 3300049580 Bacteria 1114
162 Ga0501046_0447173 3300049580 Bacteria 929
163 Ga0501047_0001819 3300049581 Bacteria 20607
164 Ga0501047_0016867 3300049581 Bacteria 6980
165 Ga0501047_0239474 3300049581 Bacteria 1665
166 Ga0501047_0437934 3300049581 Bacteria 1137
167 Ga0501048_0325795 3300049582 Bacteria 1094
168 Ga0501067_0019554 3300049583 Bacteria 3751
169 Ga0501067_0051087 3300049583 Bacteria 2292
170 Ga0501067_0206355 3300049583 Bacteria 1094
171 Ga0501068_0003916 3300049584 Bacteria 8095
172 Ga0501068_0004249 3300049584 Bacteria 7773
173 Ga0501068_0058705 3300049584 Bacteria 2335
174 Ga0501070_0347929 3300049586 Bacteria 1203
175 Ga0501072_0024002 3300049588 Bacteria 4741
176 Ga0501072_0371252 3300049588 Bacteria 1135
177 Ga0501073_0006654 3300049589 Bacteria 8610
178 Ga0501073_0042228 3300049589 Bacteria 3219
179 Ga0501073_0141105 3300049589 Bacteria 1669
180 Ga0501073_0248638 3300049589 Bacteria 1227
181 Ga0501074_0069106 3300049590 Bacteria 2539
182 Ga0501076_0447297 3300049592 Bacteria 1064
183 Ga0501077_0383163 3300049593 Bacteria 898
184 Ga0501080_0000239 3300049742 Bacteria 41220
185 Ga0501080_0029963 3300049742 Bacteria 5066
186 Ga0501080_0232031 3300049742 Bacteria 1686
187 Ga0501080_0379647 3300049742 Bacteria 1273
188 Ga0501083_0003312 3300049744 Bacteria 11253
189 Ga0501083_0381701 3300049744 Bacteria 916
190 Ga0501035_0025288 3300049822 Bacteria 5443
191 Ga0501035_0064805 3300049822 Bacteria 3246
192 Ga0501035_0627272 3300049822 Bacteria 873
193 Ga0501044_0000070 3300049823 Bacteria 124889
194 Ga0501044_0002449 3300049823 Bacteria 21162
195 Ga0501044_0164718 3300049823 Bacteria 2192
196 Ga0501044_0328504 3300049823 Bacteria 1452
197 nmdc:mga0n895_1089409_c1 3300050512 Bacteria 777
198 Ga0500643_000002 3300053087 Bacteria 1277657
199 Ga0500643_090590 3300053087 Unclassified 834
200 Ga0500555_000854 3300053103 Bacteria 10894
201 Ga0500652_151848 3300053131 Bacteria 960
202 Ga0500559_0141835 3300053136 Bacteria 1125
203 Ga0500604_0006041 3300053151 Bacteria 3196
204 Ga0500627_0002242 3300053158 Bacteria 5669
205 Ga0500633_0122623 3300053160 Bacteria 967
206 Ga0500645_000797 3300053730 Bacteria 18886
207 Ga0500661_009113 3300055283 Bacteria 1822
208 Ga0501082_0018422 3300060353 Bacteria 6013
209 Ga0501082_0032874 3300060353 Bacteria 4474
210 Ga0501082_0048083 3300060353 Bacteria 3676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0028610 Ga0501037_0028610_2608_3192 161
2 3300049569 Ga0501032_0000984 Ga0501032_0000984_18028_18612 177
3 3300049571 Ga0501034_0001368 Ga0501034_0001368_3653_4237 177
4 3300049574 Ga0501038_0008435 Ga0501038_0008435_4438_5022 177
5 3300049580 Ga0501046_0005406 Ga0501046_0005406_6503_7087 177
6 3300049581 Ga0501047_0001819 Ga0501047_0001819_122_706 177
7 3300049583 Ga0501067_0019554 Ga0501067_0019554_3152_3736 177
8 3300049584 Ga0501068_0003916 Ga0501068_0003916_3298_3882 177
9 3300049586 Ga0501070_0347929 Ga0501070_0347929_544_1128 177
10 3300049588 Ga0501072_0371252 Ga0501072_0371252_272_856 177
11 3300049589 Ga0501073_0006654 Ga0501073_0006654_3644_4228 177
12 3300049742 Ga0501080_0000239 Ga0501080_0000239_18276_18860 177
13 3300049822 Ga0501035_0064805 Ga0501035_0064805_233_817 177
14 3300049823 Ga0501044_0002449 Ga0501044_0002449_3221_3805 177
15 3300060353 Ga0501082_0018422 Ga0501082_0018422_4705_5289 177
16 3300005841 Ga0068863_100002812 Ga0068863_1000028129 182
17 3300025273 Ga0209673_1033047 Ga0209673_10330472 182
18 3300026088 Ga0207641_10002460 Ga0207641_100024609 182
19 3300049579 Ga0501043_0060200 Ga0501043_0060200_105_677 182
20 iso_pu_bacteria 2842914999 2842916636 182
21 iso_pu_bacteria 8054302542 8054305547 182
22 3300005262 Ga0065165_1000001 Ga0065165_1000001259 183
23 3300005344 Ga0070661_100013711 Ga0070661_1000137112 183
24 3300005467 Ga0070706_100774528 Ga0070706_1007745281 183
25 3300009101 Ga0105247_10003010 Ga0105247_100030108 183
26 3300012513 Ga0157326_1006125 Ga0157326_10061252 183
27 3300013104 Ga0157370_10101521 Ga0157370_101015211 183
28 3300015261 Ga0182006_1000005 Ga0182006_1000005216 183
29 3300017792 Ga0163161_10003322 Ga0163161_100033224 183
30 3300025226 Ga0209674_101090 Ga0209674_1010903 183
31 3300025233 Ga0209437_101430 Ga0209437_1014302 183
32 3300025254 Ga0209148_1001060 Ga0209148_10010608 183
33 3300025299 Ga0209256_1012440 Ga0209256_10124403 183
34 3300025302 Ga0207426_1068650 Ga0207426_10686502 183
35 3300025303 Ga0209051_1057371 Ga0209051_10573712 183
36 3300025920 Ga0207649_10005725 Ga0207649_100057256 183
37 3300035120 Ga0373957_0151690 Ga0373957_0151690_97_711 183
38 3300035172 Ga0373955_0016121 Ga0373955_0016121_1081_1695 183
39 3300035724 Ga0373933_0013866 Ga0373933_0013866_3565_4179 183
40 3300046452 Ga0495617_000183 Ga0495617_000183_7011_7562 183
41 3300046452 Ga0495617_000394 Ga0495617_000394_11704_12255 183
42 3300046460 Ga0495638_0000422 Ga0495638_0000422_36767_37318 183
43 3300046492 Ga0495585_0000780 Ga0495585_0000780_9153_9704 183
44 3300046501 Ga0495607_0000003 Ga0495607_0000003_107039_107590 183
45 3300046501 Ga0495607_0000010 Ga0495607_0000010_16276_16827 183
46 3300046506 Ga0495583_0055268 Ga0495583_0055268_901_1452 183
47 3300046507 Ga0495606_0000469 Ga0495606_0000469_29913_30464 183
48 3300046507 Ga0495606_0018574 Ga0495606_0018574_3671_4222 183
49 3300046513 Ga0495616_0013621 Ga0495616_0013621_2168_2719 183
50 3300046515 Ga0495620_0000397 Ga0495620_0000397_11127_11678 183
51 3300046518 Ga0495631_0000137 Ga0495631_0000137_18311_18862 183
52 3300046518 Ga0495631_0000728 Ga0495631_0000728_12753_13304 183
53 3300046519 Ga0495632_0000011 Ga0495632_0000011_121451_122047 183
54 3300046519 Ga0495632_0058371 Ga0495632_0058371_1040_1591 183
55 3300046524 Ga0495648_0000798 Ga0495648_0000798_24088_24639 183
56 3300046538 Ga0495609_0003385 Ga0495609_0003385_6649_7200 183
57 3300046648 Ga0495611_0000001 Ga0495611_0000001_1343059_1343610 183
58 3300046648 Ga0495611_0000068 Ga0495611_0000068_8033_8584 183
59 3300046660 Ga0495625_0000001 Ga0495625_0000001_572427_572978 183
60 3300046660 Ga0495625_0257141 Ga0495625_0257141_331_882 183
61 3300046665 Ga0495661_0000885 Ga0495661_0000885_8593_9144 183
62 3300046665 Ga0495661_0058660 Ga0495661_0058660_786_1337 183
63 3300046691 Ga0495670_0000719 Ga0495670_0000719_12186_12737 183
64 3300046692 Ga0495671_0003422 Ga0495671_0003422_7748_8299 183
65 3300046794 Ga0495589_0000016 Ga0495589_0000016_62391_62942 183
66 3300046810 Ga0495660_0000116 Ga0495660_0000116_22942_23493 183
67 3300046810 Ga0495660_0000357 Ga0495660_0000357_25234_25785 183
68 3300047446 Ga0495679_000001 Ga0495679_000001_243345_243896 183
69 3300047469 Ga0495673_0000001 Ga0495673_0000001_572815_573366 183
70 3300047469 Ga0495673_0001025 Ga0495673_0001025_11770_12321 183
71 3300047472 Ga0495686_0000115 Ga0495686_0000115_15902_16453 183
72 3300047472 Ga0495686_0164606 Ga0495686_0164606_71_622 183
73 3300048903 Ga0496100_0010911 Ga0496100_0010911_2768_3328 183
74 3300048904 Ga0496101_0007860 Ga0496101_0007860_5768_6328 183
75 3300048905 Ga0496102_1152097 Ga0496102_1152097_89_667 183
76 3300048909 Ga0496106_0000705 Ga0496106_0000705_8812_9363 183
77 3300048924 Ga0496121_0001558 Ga0496121_0001558_17887_18438 183
78 3300048924 Ga0496121_0009781 Ga0496121_0009781_1152_1703 183
79 3300048925 Ga0496122_0019903 Ga0496122_0019903_3594_4154 183
80 3300048926 Ga0496123_0040968 Ga0496123_0040968_1626_2186 183
81 3300049459 Ga0495678_000332 Ga0495678_000332_37716_38267 183
82 3300049460 Ga0495682_0001413 Ga0495682_0001413_12370_12921 183
83 3300049460 Ga0495682_0040098 Ga0495682_0040098_266_817 183
84 3300053087 Ga0500643_000002 Ga0500643_000002_473756_474307 183
85 3300053087 Ga0500643_090590 Ga0500643_090590_214_792 183
86 3300053103 Ga0500555_000854 Ga0500555_000854_3088_3639 183
87 3300053131 Ga0500652_151848 Ga0500652_151848_118_669 183
88 3300053160 Ga0500633_0122623 Ga0500633_0122623_271_822 183
89 3300053730 Ga0500645_000797 Ga0500645_000797_8680_9231 183
90 iso_pu_bacteria 3004167301 3004168350 183
91 3300003763 Ga0055529_1001903 Ga0055529_10019034 184
92 3300005544 Ga0070686_100000034 Ga0070686_100000034134 184
93 3300006871 Ga0075434_100165038 Ga0075434_1001650382 184
94 3300009177 Ga0105248_10528256 Ga0105248_105282562 184
95 3300025242 Ga0209258_102850 Ga0209258_1028504 184
96 3300025272 Ga0209455_1001991 Ga0209455_10019912 184
97 3300025904 Ga0207647_10182248 Ga0207647_101822482 184
98 3300025909 Ga0207705_10815215 Ga0207705_108152152 184
99 3300028379 Ga0268266_11069391 Ga0268266_110693911 184
100 3300049822 Ga0501035_0025288 Ga0501035_0025288_99_665 184
101 3300049823 Ga0501044_0000070 Ga0501044_0000070_20261_20827 184
102 3300049823 Ga0501044_0164718 Ga0501044_0164718_189_746 184
103 3300050512 nmdc:mga0n895_1089409_c1 nmdc:mga0n895_1089409_c1_188_745 184
104 3300055283 Ga0500661_009113 Ga0500661_009113_58_621 184
105 iso_pu_bacteria 2791355082 2792583266 184
106 3300002067 JGI24735J21928_10016734 JGI24735J21928_100167343 185
107 3300002067 JGI24735J21928_10023188 JGI24735J21928_100231882 185
108 3300005347 Ga0070668_100001993 Ga0070668_1000019935 185
109 3300005367 Ga0070667_100002460 Ga0070667_1000024608 185
110 3300005543 Ga0070672_100986154 Ga0070672_1009861542 185
111 3300005548 Ga0070665_100295025 Ga0070665_1002950252 185
112 3300005843 Ga0068860_100328509 Ga0068860_1003285092 185
113 3300005844 Ga0068862_100000510 Ga0068862_10000051047 185
114 3300009553 Ga0105249_10010774 Ga0105249_100107743 185
115 3300014968 Ga0157379_10040393 Ga0157379_100403934 185
116 3300017792 Ga0163161_10087940 Ga0163161_100879403 185
117 3300048925 Ga0496122_0007120 Ga0496122_0007120_609_1166 185
118 3300048926 Ga0496123_0015361 Ga0496123_0015361_1076_1633 185
119 3300048929 Ga0496126_0000150 Ga0496126_0000150_79238_79795 185
120 3300001989 JGI24739J22299_10013422 JGI24739J22299_100134222 186
121 3300001989 JGI24739J22299_10032313 JGI24739J22299_100323132 186
122 3300001990 JGI24737J22298_10046129 JGI24737J22298_100461291 186
123 3300003856 Ga0058692_1016067 Ga0058692_10160671 186
124 3300005327 Ga0070658_10697669 Ga0070658_106976691 186
125 3300005347 Ga0070668_100102261 Ga0070668_1001022611 186
126 3300005347 Ga0070668_100225251 Ga0070668_1002252512 186
127 3300005355 Ga0070671_100218700 Ga0070671_1002187002 186
128 3300005457 Ga0070662_100007864 Ga0070662_1000078648 186
129 3300006353 Ga0075370_10296782 Ga0075370_102967821 186
130 3300006914 Ga0075436_100881421 Ga0075436_1008814211 186
131 3300009174 Ga0105241_10394205 Ga0105241_103942052 186
132 3300009177 Ga0105248_10005918 Ga0105248_100059185 186
133 3300009177 Ga0105248_10126583 Ga0105248_101265832 186
134 3300013100 Ga0157373_10467584 Ga0157373_104675841 186
135 3300013105 Ga0157369_10800181 Ga0157369_108001812 186
136 3300013296 Ga0157374_10018251 Ga0157374_100182514 186
137 3300013307 Ga0157372_10014716 Ga0157372_100147169 186
138 3300013307 Ga0157372_10587757 Ga0157372_105877571 186
139 3300017792 Ga0163161_10058811 Ga0163161_100588111 186
140 3300025919 Ga0207657_10346316 Ga0207657_103463162 186
141 3300025923 Ga0207681_10318868 Ga0207681_103188681 186
142 3300025923 Ga0207681_10607339 Ga0207681_106073392 186
143 3300025931 Ga0207644_10320608 Ga0207644_103206082 186
144 3300025933 Ga0207706_10004946 Ga0207706_1000494610 186
145 3300025941 Ga0207711_10003119 Ga0207711_100031196 186
146 3300025941 Ga0207711_10133412 Ga0207711_101334122 186
147 3300025941 Ga0207711_10341502 Ga0207711_103415022 186
148 3300025972 Ga0207668_10012609 Ga0207668_100126097 186
149 3300028381 Ga0268264_10007841 Ga0268264_100078414 186
150 3300041494 Ga0451837_1760151 Ga0451837_1760151_343_903 186
151 3300041501 Ga0451845_0197061 Ga0451845_0197061_77_637 186
152 3300041509 Ga0451843_0193364 Ga0451843_0193364_66_626 186
153 3300042005 Ga0439448_0002443 Ga0439448_0002443_2992_3552 186
154 3300042012 Ga0439455_0001126 Ga0439455_0001126_20_580 186
155 3300042012 Ga0439455_0060993 Ga0439455_0060993_219_779 186
156 3300042157 Ga0439458_0000207 Ga0439458_0000207_9112_9672 186
157 3300044719 Ga0466971_0069580 Ga0466971_0069580_506_1069 186
158 3300044842 Ga0466957_0011261 Ga0466957_0011261_2242_2805 186
159 3300044842 Ga0466957_0450748 Ga0466957_0450748_28_591 186
160 3300045836 Ga0466958_0083151 Ga0466958_0083151_656_1219 186
161 3300046512 Ga0495610_0000199 Ga0495610_0000199_6881_7453 186
162 3300046512 Ga0495610_0047203 Ga0495610_0047203_84_659 186
163 3300046512 Ga0495610_0171483 Ga0495610_0171483_64_633 186
164 3300046513 Ga0495616_0000022 Ga0495616_0000022_102105_102704 186
165 3300046648 Ga0495611_0134553 Ga0495611_0134553_168_731 186
166 3300047320 Ga0495672_0134655 Ga0495672_0134655_579_1151 186
167 3300047470 Ga0495681_0000038 Ga0495681_0000038_18998_19570 186
168 3300047472 Ga0495686_0000824 Ga0495686_0000824_2829_3389 186
169 3300048909 Ga0496106_0170668 Ga0496106_0170668_1044_1604 186
170 3300048922 Ga0496119_0029944 Ga0496119_0029944_2793_3362 186
171 3300048924 Ga0496121_0302365 Ga0496121_0302365_209_892 186
172 3300049569 Ga0501032_0014950 Ga0501032_0014950_2511_3125 186
173 3300049570 Ga0501033_0018711 Ga0501033_0018711_3459_4034 186
174 3300049571 Ga0501034_0034730 Ga0501034_0034730_2074_2649 186
175 3300049571 Ga0501034_0106983 Ga0501034_0106983_1169_1744 186
176 3300049571 Ga0501034_0215374 Ga0501034_0215374_1195_1809 186
177 3300049572 Ga0501036_0068745 Ga0501036_0068745_494_1108 186
178 3300049572 Ga0501036_0092605 Ga0501036_0092605_340_915 186
179 3300049573 Ga0501037_0205713 Ga0501037_0205713_665_1240 186
180 3300049574 Ga0501038_0016687 Ga0501038_0016687_1409_2023 186
181 3300049575 Ga0501039_0051425 Ga0501039_0051425_1160_1774 186
182 3300049579 Ga0501043_0023469 Ga0501043_0023469_1562_2137 186
183 3300049579 Ga0501043_0062988 Ga0501043_0062988_1603_2178 186
184 3300049579 Ga0501043_0607210 Ga0501043_0607210_184_759 186
185 3300049580 Ga0501046_0157416 Ga0501046_0157416_161_775 186
186 3300049580 Ga0501046_0327866 Ga0501046_0327866_50_625 186
187 3300049580 Ga0501046_0447173 Ga0501046_0447173_15_590 186
188 3300049581 Ga0501047_0016867 Ga0501047_0016867_4455_5069 186
189 3300049581 Ga0501047_0239474 Ga0501047_0239474_817_1392 186
190 3300049581 Ga0501047_0437934 Ga0501047_0437934_499_1074 186
191 3300049582 Ga0501048_0325795 Ga0501048_0325795_345_920 186
192 3300049583 Ga0501067_0051087 Ga0501067_0051087_1171_1785 186
193 3300049583 Ga0501067_0206355 Ga0501067_0206355_486_1061 186
194 3300049584 Ga0501068_0004249 Ga0501068_0004249_4681_5295 186
195 3300049584 Ga0501068_0058705 Ga0501068_0058705_1564_2139 186
196 3300049588 Ga0501072_0024002 Ga0501072_0024002_810_1385 186
197 3300049589 Ga0501073_0042228 Ga0501073_0042228_1867_2481 186
198 3300049589 Ga0501073_0141105 Ga0501073_0141105_821_1396 186
199 3300049589 Ga0501073_0248638 Ga0501073_0248638_379_954 186
200 3300049590 Ga0501074_0069106 Ga0501074_0069106_711_1286 186
201 3300049592 Ga0501076_0447297 Ga0501076_0447297_383_997 186
202 3300049593 Ga0501077_0383163 Ga0501077_0383163_205_819 186
203 3300049742 Ga0501080_0029963 Ga0501080_0029963_3543_4118 186
204 3300049742 Ga0501080_0232031 Ga0501080_0232031_984_1559 186
205 3300049742 Ga0501080_0379647 Ga0501080_0379647_594_1208 186
206 3300049744 Ga0501083_0003312 Ga0501083_0003312_125_700 186
207 3300049744 Ga0501083_0381701 Ga0501083_0381701_95_709 186
208 3300049822 Ga0501035_0627272 Ga0501035_0627272_25_600 186
209 3300049823 Ga0501044_0328504 Ga0501044_0328504_243_818 186
210 3300053136 Ga0500559_0141835 Ga0500559_0141835_29_598 186
211 3300053151 Ga0500604_0006041 Ga0500604_0006041_184_783 186
212 3300053158 Ga0500627_0002242 Ga0500627_0002242_4605_5204 186
213 3300060353 Ga0501082_0032874 Ga0501082_0032874_2910_3485 186
214 3300060353 Ga0501082_0048083 Ga0501082_0048083_685_1299 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

46

219

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9816 6 181
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9473 5 183
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9445 6 181
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9407 7 183
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9395 7 183
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9765 5 180 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9504 7 183 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9375 5 183 1.10.340.30
1p7mA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.93 5 180 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9246 5 181 1.10.340.30
ID Description Score Start End GO Terms
AF-G6EHB2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9964 17 183 GO:0006284
GO:0008725
GO:0046872
AF-A0A852YC63-F1-model_v4 deleted 0.9894 3 186
AF-A0A2W4I4B0-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9872 18 182 GO:0006284
GO:0008725
GO:0046872
AF-A0A7H0LMW5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.986 4 183 GO:0006284
GO:0008725
GO:0046872
AF-A0A4Q3X5K2-F1-model_v4 deleted 0.9853 18 183

Feature Viewer

pLDDT pTM Quality
95.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map