F325525

General Info

Members Datasets Scaffolds Average Seq Length
214 184 428 109

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0014959|Ga0466972_0014959_1446_1808
Length 120
Sequence LEREHPKEAVLIFITAKFRVLPEHADAWPEISRSFTEATRAEPGCLWFDWSRSLDDDTEYVLVEAFRDGEAGGAHVQSEHFRTAQKELPPYLAETPRIVNATLEQDDWSLLGEMEVAPRG

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2501939600 Micromonospora sp. L5 Isolate Unclassified
160 2739367898 Nocardioides sp. CF479 Isolate Unclassified
161 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
162 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
163 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
164 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
165 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
166 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
167 2858882152 Micromonospora noduli MED15 Isolate Nodule
168 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
169 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
170 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
171 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
172 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
173 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
174 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
175 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
176 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
177 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
178 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
179 649633069 Micromonospora sp. L5 Isolate Unclassified
180 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
181 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
182 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
183 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
184 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.92
Metatranscriptomes 0.93
Isolates 12.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 2.34
Rhizoplane 7.94
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0014959 3300044658 Bacteria 3881
2 JGI24738J21930_10002660 3300002075 Bacteria 4608
3 Ga0070658_10930950 3300005327 Bacteria 756
4 Ga0070683_100557160 3300005329 Bacteria 1096
5 Ga0068869_100114801 3300005334 Bacteria 2053
6 Ga0070674_100041899 3300005356 Bacteria 3107
7 Ga0070673_100275329 3300005364 Bacteria 1474
8 Ga0070659_101256910 3300005366 Bacteria 656
9 Ga0070709_10001387 3300005434 Bacteria 13173
10 Ga0070714_100009888 3300005435 Bacteria 7521
11 Ga0070714_100034595 3300005435 Bacteria 4231
12 Ga0070713_100002899 3300005436 Bacteria 11221
13 Ga0070713_101575946 3300005436 Bacteria 637
14 Ga0070710_10000317 3300005437 Bacteria 23027
15 Ga0070710_10001646 3300005437 Bacteria 10554
16 Ga0070711_100015510 3300005439 Bacteria 4825
17 Ga0070711_101736885 3300005439 Bacteria 547
18 Ga0070708_100371407 3300005445 Bacteria 1348
19 Ga0068867_100032336 3300005459 Bacteria 3783
20 Ga0070707_100028350 3300005468 Bacteria 5329
21 Ga0070698_100114828 3300005471 Bacteria 2657
22 Ga0070699_100324677 3300005518 Bacteria 1384
23 Ga0070684_100035853 3300005535 Bacteria 4248
24 Ga0070697_100030458 3300005536 Bacteria 4335
25 Ga0068853_100039704 3300005539 Bacteria 4015
26 Ga0070672_100087556 3300005543 Bacteria 2506
27 Ga0068856_100748908 3300005614 Bacteria 997
28 Ga0068852_100005085 3300005616 Bacteria 9361
29 Ga0068860_101169852 3300005843 Bacteria 789
30 Ga0068862_102740215 3300005844 Bacteria 504
31 Ga0081455_10000038 3300005937 Bacteria 135510
32 Ga0081455_10484872 3300005937 Bacteria 835
33 Ga0070717_10019811 3300006028 Bacteria 5281
34 Ga0075365_10440171 3300006038 Bacteria 920
35 Ga0075365_10468946 3300006038 Bacteria 889
36 Ga0075365_10513144 3300006038 Bacteria 847
37 Ga0075365_11143021 3300006038 Bacteria 548
38 Ga0075363_100002575 3300006048 Bacteria 7458
39 Ga0075363_100349091 3300006048 Bacteria 864
40 Ga0070715_10004801 3300006163 Bacteria 4473
41 Ga0070716_100102109 3300006173 Bacteria 1760
42 Ga0070712_100012491 3300006175 Bacteria 5399
43 Ga0075370_10103472 3300006353 Bacteria 1650
44 Ga0075430_100101798 3300006846 Bacteria 2398
45 Ga0075431_100002041 3300006847 Bacteria 19294
46 Ga0068865_100031198 3300006881 Bacteria 3552
47 Ga0105240_10114897 3300009093 Bacteria 3251
48 Ga0105242_10051837 3300009176 Bacteria 3346
49 Ga0105246_11238284 3300011119 Bacteria 689
50 Ga0105246_11581964 3300011119 Bacteria 619
51 Ga0163162_12048102 3300013306 Bacteria 656
52 Ga0163163_10117539 3300014325 Bacteria 2691
53 Ga0157377_10004155 3300014745 Bacteria 6615
54 Ga0163161_11804994 3300017792 Bacteria 544
55 Ga0206353_11389406 3300020082 Bacteria 1260
56 Ga0224712_10074293 3300022467 Bacteria 1388
57 Ga0207692_10000137 3300025898 Bacteria 22424
58 Ga0207692_10002069 3300025898 Bacteria 7666
59 Ga0207688_10038273 3300025901 Bacteria 2661
60 Ga0207647_10066816 3300025904 Bacteria 2180
61 Ga0207685_10010024 3300025905 Bacteria 2778
62 Ga0207699_10004076 3300025906 Bacteria 6988
63 Ga0207643_10280124 3300025908 Bacteria 1034
64 Ga0207705_10600453 3300025909 Bacteria 856
65 Ga0207693_10058469 3300025915 Bacteria 3020
66 Ga0207663_10033604 3300025916 Bacteria 3057
67 Ga0207657_10470106 3300025919 Bacteria 986
68 Ga0207649_10913041 3300025920 Bacteria 689
69 Ga0207646_10109766 3300025922 Bacteria 2475
70 Ga0207694_10027508 3300025924 Bacteria 4331
71 Ga0207694_10738844 3300025924 Bacteria 830
72 Ga0207650_10324964 3300025925 Bacteria 1261
73 Ga0207659_10916888 3300025926 Bacteria 753
74 Ga0207700_10000670 3300025928 Bacteria 20029
75 Ga0207700_10069245 3300025928 Bacteria 2708
76 Ga0207664_10000190 3300025929 Bacteria 46168
77 Ga0207664_10965562 3300025929 Bacteria 764
78 Ga0207706_10510853 3300025933 Bacteria 1037
79 Ga0207686_10891995 3300025934 Bacteria 717
80 Ga0207709_10030878 3300025935 Bacteria 3122
81 Ga0207669_10374898 3300025937 Bacteria 1107
82 Ga0207704_10058789 3300025938 Bacteria 2369
83 Ga0207691_10058769 3300025940 Bacteria 3497
84 Ga0207711_10941831 3300025941 Bacteria 802
85 Ga0207689_11648456 3300025942 Bacteria 533
86 Ga0207661_10129850 3300025944 Bacteria 2157
87 Ga0207651_10273055 3300025960 Bacteria 1393
88 Ga0207640_10081913 3300025981 Bacteria 2208
89 Ga0207639_10455263 3300026041 Bacteria 1162
90 Ga0207708_10006915 3300026075 Bacteria 8392
91 Ga0207648_10009394 3300026089 Bacteria 9365
92 Ga0207675_100002009 3300026118 Bacteria 20295
93 Ga0207683_10059747 3300026121 Bacteria 3349
94 Ga0207698_10349909 3300026142 Bacteria 1395
95 Ga0207428_10107044 3300027907 Bacteria 2154
96 Ga0268265_10703157 3300028380 Bacteria 977
97 Ga0316180_1129417 3300030736 Bacteria 688
98 Ga0307416_102041432 3300032002 Bacteria 676
99 Ga0307415_101580242 3300032126 Bacteria 629
100 Ga0373934_0010987 3300035086 Bacteria 3405
101 Ga0373923_0062834 3300035111 Bacteria 1581
102 Ga0373953_0033041 3300035117 Bacteria 2022
103 Ga0373954_0164099 3300035118 Bacteria 1087
104 Ga0373956_0074966 3300035119 Bacteria 1547
105 Ga0373957_0114960 3300035120 Bacteria 1086
106 Ga0373955_0180777 3300035172 Bacteria 1251
107 Ga0373924_0032676 3300035410 Bacteria 2097
108 Ga0373933_0694832 3300035724 Bacteria 669
109 Ga0373937_0039986 3300036401 Bacteria 4274
110 Ga0373937_0240809 3300036401 Bacteria 1704
111 Ga0373937_1073680 3300036401 Unclassified 754
112 Ga0395900_1689979 3300037418 Bacteria 544
113 Ga0436364_0457546 3300037853 Bacteria 780
114 Ga0436363_1495140 3300039450 Bacteria 1436
115 Ga0451793_0570765 3300041452 Bacteria 629
116 Ga0451797_0017868 3300041453 Bacteria 517
117 Ga0451797_1446809 3300041453 Bacteria 548
118 Ga0451843_1476685 3300041509 Bacteria 565
119 Ga0466972_0048268 3300044658 Bacteria 2057
120 Ga0466965_0485084 3300044683 Bacteria 692
121 Ga0466965_0805241 3300044683 Bacteria 544
122 Ga0466961_0226724 3300044693 Bacteria 1151
123 Ga0466964_0113206 3300044706 Bacteria 1213
124 Ga0466968_0014642 3300044735 Bacteria 3102
125 Ga0466970_0200624 3300044765 Bacteria 1110
126 Ga0466957_0045924 3300044842 Bacteria 2650
127 Ga0466960_0010035 3300044901 Bacteria 3921
128 Ga0466960_0297191 3300044901 Bacteria 909
129 Ga0466959_0469845 3300045049 Bacteria 852
130 Ga0466958_1100533 3300045836 Bacteria 519
131 Ga0466967_0555470 3300045976 Bacteria 1130
132 Ga0466967_2374953 3300045976 Bacteria 525
133 Ga0495592_0603700 3300046454 Bacteria 669
134 Ga0495603_0803993 3300046455 Bacteria 536
135 Ga0495651_0477396 3300046462 Bacteria 801
136 Ga0495653_0880435 3300046463 Bacteria 534
137 Ga0495639_0341549 3300046475 Bacteria 751
138 Ga0495628_0446137 3300046516 Bacteria 940
139 Ga0495630_0584086 3300046517 Bacteria 857
140 Ga0495652_0113317 3300046529 Bacteria 2177
141 Ga0495665_0038244 3300046531 Bacteria 2559
142 Ga0495587_0088225 3300046536 Bacteria 1794
143 Ga0495667_0160235 3300046559 Bacteria 1447
144 Ga0495634_0853435 3300046642 Bacteria 517
145 Ga0495588_0128208 3300046674 Bacteria 1338
146 Ga0495599_0031734 3300046678 Bacteria 3316
147 Ga0495623_0050741 3300046679 Bacteria 2627
148 Ga0495623_0166669 3300046679 Bacteria 1290
149 Ga0495600_0487412 3300046809 Bacteria 759
150 Ga0495680_0044274 3300047322 Bacteria 3520
151 Ga0495675_0364195 3300047444 Bacteria 848
152 Ga0495593_0151015 3300047673 Bacteria 1175
153 Ga0495602_0111836 3300048088 Bacteria 2217
154 Ga0495602_0294044 3300048088 Bacteria 1191
155 Ga0496102_0135115 3300048905 Bacteria 2311
156 Ga0496102_0895067 3300048905 Bacteria 809
157 Ga0496105_0407837 3300048908 Bacteria 1078
158 Ga0496106_1144499 3300048909 Bacteria 608
159 Ga0496107_0260961 3300048910 Bacteria 1289
160 Ga0496108_0572342 3300048911 Bacteria 985
161 Ga0496109_0056433 3300048912 Bacteria 3584
162 Ga0496110_0210405 3300048913 Bacteria 1768
163 Ga0496110_0288003 3300048913 Bacteria 1496
164 Ga0496111_0566854 3300048914 Bacteria 833
165 Ga0496114_0049941 3300048917 Bacteria 3481
166 Ga0496114_0085348 3300048917 Bacteria 2674
167 Ga0496115_0041660 3300048918 Bacteria 3656
168 Ga0496115_0292408 3300048918 Bacteria 1336
169 Ga0496126_0913235 3300048929 Bacteria 665
170 Ga0501032_0448806 3300049569 Bacteria 826
171 Ga0501033_0029830 3300049570 Bacteria 4099
172 Ga0501042_0653181 3300049578 Bacteria 765
173 Ga0501048_0323443 3300049582 Bacteria 1099
174 Ga0501070_0073331 3300049586 Bacteria 2832
175 Ga0501074_0479014 3300049590 Bacteria 882
176 Ga0501035_0071181 3300049822 Bacteria 3080
177 Ga0501045_0392487 3300049824 Bacteria 1033
178 nmdc:mga03n38_2115_c1 3300050490 Bacteria 6031
179 nmdc:mga0yw44_168399_c1 3300050492 Bacteria 1437
180 nmdc:mga0yw44_441045_c1 3300050492 Bacteria 882
181 nmdc:mga07m45_118775_c1 3300050496 Bacteria 1526
182 nmdc:mga07m45_65168_c2 3300050496 Bacteria 718
183 nmdc:mga0qj67_437263_c1 3300050509 Bacteria 1054
184 nmdc:mga06r32_567_c1 3300050510 Bacteria 32210
185 nmdc:mga08y16_384221_c1 3300050511 Bacteria 1439
186 Ga0495655_0136876 3300053083 Bacteria 759
187 Ga0466962_0036412 3300061719 Bacteria 2355
188 Ga0466962_0409012 3300061719 Bacteria 680
189 2501940722 2501939600 Bacteria 6907073
190 2740167876 2739367898 Bacteria 4367674
191 2772645624 2772190715 Bacteria 6959372
192 2809591904 2808606522 Bacteria 9488490
193 2855673110 2855670206 Bacteria 7120389
194 2855681788 2855676851 Bacteria 7063653
195 2857293697 2857288857 Bacteria 7189066
196 2858851136 2858848962 Bacteria 6963058
197 2858887758 2858882152 Bacteria 7230291
198 2858893586 2858888857 Bacteria 7060307
199 2858896882 2858895516 Bacteria 7378898
200 2862516283 2862507626 Bacteria 9425308
201 2867317428 2867312974 Bacteria 7058875
202 2867325136 2867319477 Bacteria 7069771
203 2869052648 2869048445 Bacteria 6875584
204 2880491775 2880489317 Bacteria 7096270
205 2895427960 2895427314 Bacteria 13147766
206 2929222726 2929219909 Bacteria 6984360
207 2929229036 2929226422 Bacteria 7248583
208 3006500530 3006493962 Bacteria 8825450
209 649815192 649633069 Bacteria 6962533
210 8008581240 8008574985 Bacteria 7815457
211 8054705170 8054704163 Bacteria 7247792
212 8054727829 8054727385 Bacteria 7558670
213 8054736753 8054734606 Bacteria 6947278
214 8055180861 8055172936 Bacteria 9305943
215 Ga0466972_0014959
216 JGI24738J21930_10002660
217 Ga0070658_10930950
218 Ga0070683_100557160
219 Ga0068869_100114801
220 Ga0070674_100041899
221 Ga0070673_100275329
222 Ga0070659_101256910
223 Ga0070709_10001387
224 Ga0070714_100009888
225 Ga0070714_100034595
226 Ga0070713_100002899
227 Ga0070713_101575946
228 Ga0070710_10000317
229 Ga0070710_10001646
230 Ga0070711_100015510
231 Ga0070711_101736885
232 Ga0070708_100371407
233 Ga0068867_100032336
234 Ga0070707_100028350
235 Ga0070698_100114828
236 Ga0070699_100324677
237 Ga0070684_100035853
238 Ga0070697_100030458
239 Ga0068853_100039704
240 Ga0070672_100087556
241 Ga0068856_100748908
242 Ga0068852_100005085
243 Ga0068860_101169852
244 Ga0068862_102740215
245 Ga0081455_10000038
246 Ga0081455_10484872
247 Ga0070717_10019811
248 Ga0075365_10440171
249 Ga0075365_10468946
250 Ga0075365_10513144
251 Ga0075365_11143021
252 Ga0075363_100002575
253 Ga0075363_100349091
254 Ga0070715_10004801
255 Ga0070716_100102109
256 Ga0070712_100012491
257 Ga0075370_10103472
258 Ga0075430_100101798
259 Ga0075431_100002041
260 Ga0068865_100031198
261 Ga0105240_10114897
262 Ga0105242_10051837
263 Ga0105246_11238284
264 Ga0105246_11581964
265 Ga0163162_12048102
266 Ga0163163_10117539
267 Ga0157377_10004155
268 Ga0163161_11804994
269 Ga0206353_11389406
270 Ga0224712_10074293
271 Ga0207692_10000137
272 Ga0207692_10002069
273 Ga0207688_10038273
274 Ga0207647_10066816
275 Ga0207685_10010024
276 Ga0207699_10004076
277 Ga0207643_10280124
278 Ga0207705_10600453
279 Ga0207693_10058469
280 Ga0207663_10033604
281 Ga0207657_10470106
282 Ga0207649_10913041
283 Ga0207646_10109766
284 Ga0207694_10027508
285 Ga0207694_10738844
286 Ga0207650_10324964
287 Ga0207659_10916888
288 Ga0207700_10000670
289 Ga0207700_10069245
290 Ga0207664_10000190
291 Ga0207664_10965562
292 Ga0207706_10510853
293 Ga0207686_10891995
294 Ga0207709_10030878
295 Ga0207669_10374898
296 Ga0207704_10058789
297 Ga0207691_10058769
298 Ga0207711_10941831
299 Ga0207689_11648456
300 Ga0207661_10129850
301 Ga0207651_10273055
302 Ga0207640_10081913
303 Ga0207639_10455263
304 Ga0207708_10006915
305 Ga0207648_10009394
306 Ga0207675_100002009
307 Ga0207683_10059747
308 Ga0207698_10349909
309 Ga0207428_10107044
310 Ga0268265_10703157
311 Ga0316180_1129417
312 Ga0307416_102041432
313 Ga0307415_101580242
314 Ga0373934_0010987
315 Ga0373923_0062834
316 Ga0373953_0033041
317 Ga0373954_0164099
318 Ga0373956_0074966
319 Ga0373957_0114960
320 Ga0373955_0180777
321 Ga0373924_0032676
322 Ga0373933_0694832
323 Ga0373937_0039986
324 Ga0373937_0240809
325 Ga0373937_1073680
326 Ga0395900_1689979
327 Ga0436364_0457546
328 Ga0436363_1495140
329 Ga0451793_0570765
330 Ga0451797_0017868
331 Ga0451797_1446809
332 Ga0451843_1476685
333 Ga0466972_0048268
334 Ga0466965_0485084
335 Ga0466965_0805241
336 Ga0466961_0226724
337 Ga0466964_0113206
338 Ga0466968_0014642
339 Ga0466970_0200624
340 Ga0466957_0045924
341 Ga0466960_0010035
342 Ga0466960_0297191
343 Ga0466959_0469845
344 Ga0466958_1100533
345 Ga0466967_0555470
346 Ga0466967_2374953
347 Ga0495592_0603700
348 Ga0495603_0803993
349 Ga0495651_0477396
350 Ga0495653_0880435
351 Ga0495639_0341549
352 Ga0495628_0446137
353 Ga0495630_0584086
354 Ga0495652_0113317
355 Ga0495665_0038244
356 Ga0495587_0088225
357 Ga0495667_0160235
358 Ga0495634_0853435
359 Ga0495588_0128208
360 Ga0495599_0031734
361 Ga0495623_0050741
362 Ga0495623_0166669
363 Ga0495600_0487412
364 Ga0495680_0044274
365 Ga0495675_0364195
366 Ga0495593_0151015
367 Ga0495602_0111836
368 Ga0495602_0294044
369 Ga0496102_0135115
370 Ga0496102_0895067
371 Ga0496105_0407837
372 Ga0496106_1144499
373 Ga0496107_0260961
374 Ga0496108_0572342
375 Ga0496109_0056433
376 Ga0496110_0210405
377 Ga0496110_0288003
378 Ga0496111_0566854
379 Ga0496114_0049941
380 Ga0496114_0085348
381 Ga0496115_0041660
382 Ga0496115_0292408
383 Ga0496126_0913235
384 Ga0501032_0448806
385 Ga0501033_0029830
386 Ga0501042_0653181
387 Ga0501048_0323443
388 Ga0501070_0073331
389 Ga0501074_0479014
390 Ga0501035_0071181
391 Ga0501045_0392487
392 nmdc:mga03n38_2115_c1
393 nmdc:mga0yw44_168399_c1
394 nmdc:mga0yw44_441045_c1
395 nmdc:mga07m45_118775_c1
396 nmdc:mga07m45_65168_c2
397 nmdc:mga0qj67_437263_c1
398 nmdc:mga06r32_567_c1
399 nmdc:mga08y16_384221_c1
400 Ga0495655_0136876
401 Ga0466962_0036412
402 Ga0466962_0409012
403 2501940722
404 2740167876
405 2772645624
406 2809591904
407 2855673110
408 2855681788
409 2857293697
410 2858851136
411 2858887758
412 2858893586
413 2858896882
414 2862516283
415 2867317428
416 2867325136
417 2869052648
418 2880491775
419 2895427960
420 2929222726
421 2929229036
422 3006500530
423 649815192
424 8008581240
425 8054705170
426 8054727829
427 8054736753
428 8055180861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

11

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9266 2 90
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.9059 2 94
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.8961 1 94
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8947 2 94
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8941 2 93
ID Description Score Start End Superfamily
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9855 1 90 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9643 1 90 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9027 2 90 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8947 2 94 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8902 2 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A543C6H3-F1-model_v4 deleted 0.9546 1 90
AF-A0A4T0UVT3-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.943 2 90 GO:0004497
AF-A0A430AF27-F1-model_v4 ABM domain-containing protein 0.9384 1 92 GO:0003824
AF-U7V9Y0-F1-model_v4 ABM domain-containing protein 0.9375 1 92 GO:0003824
AF-A0A6P0XA45-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9363 2 90 GO:0004497

Map