F325334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 214 | 131 | 202 | 454 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10001997|Ga0307515_1000199736 |
| Length | 485 |
| Sequence | MLCLHSFLPGVLYRYIKFQETYMQIITRSVFILMALLISLNTFAQQNIKPIGLKALLSQVNANAPALITDSAAIGIRQAQAAETRSNWLPNLKLNYQADIGTNNNVAGPYFGFGIIPSDSRGVRTQSNTTAVSANVGVAALDWEVYNFGAYDAQNKVANSDIRVQQSQFANSKYQLQAYAIGNYLLLMRLQNFLDIQSRNIQRNVEIRRSVQSLAKSGVRAGVDTSIAEAELSKARLNYIELANQVKQVQLQLSAVSGLPYQSIVPDTAAETALIDQPAALQPIEQDTVNHPIINYYRSVYQNSLQRENLVKKSYNPKIMLEGAVWGRGSSVDANDHFNSLSTGWGFDRNNYLVGVGISYNLFDLRRKQLKLRTQKAETSYNARKLQEQKQMLAVNANQADVELETARQRLQEIPHQLRAANDGYRQKLSLYKNGLTDIIELNAALNILYRAETDFAQAKYSYSSALFQKAVTDNQVNAVLNLLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 6 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 7 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 8 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 9 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 10 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 11 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 12 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 123 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 129 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 130 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 131 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.39 |
| Metatranscriptomes | 0 |
| Isolates | 5.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.41 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 78.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013928 | 3300001979 | Bacteria | 2982 |
| 2 | JGI24737J22298_10003557 | 3300001990 | Bacteria | 5493 |
| 3 | JGI24737J22298_10013459 | 3300001990 | Bacteria | 2662 |
| 4 | JGI24735J21928_10000005 | 3300002067 | Bacteria | 356755 |
| 5 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 6 | JGI25162J39368_1001031 | 3300002737 | Bacteria | 17224 |
| 7 | JGI25157J39369_1002587 | 3300002741 | Bacteria | 4312 |
| 8 | JGI25165J46597_1000869 | 3300003214 | Bacteria | 21479 |
| 9 | rootH1_10074478 | 3300003316 | Bacteria | 4231 |
| 10 | rootH2_10002814 | 3300003320 | Bacteria | 49344 |
| 11 | rootH2_10022503 | 3300003320 | Bacteria | 3548 |
| 12 | rootH2_10044515 | 3300003320 | Bacteria | 11301 |
| 13 | rootH1_10003212 | 3300003323 | Bacteria | 182359 |
| 14 | rootH1_10087397 | 3300003323 | Bacteria | 3868 |
| 15 | rootH1_10103532 | 3300003323 | Bacteria | 1524 |
| 16 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 17 | Ga0070658_10000011 | 3300005327 | Bacteria | 294396 |
| 18 | Ga0070676_10003202 | 3300005328 | Bacteria | 8487 |
| 19 | Ga0070683_100012824 | 3300005329 | Bacteria | 7294 |
| 20 | Ga0070660_100008880 | 3300005339 | Bacteria | 7048 |
| 21 | Ga0070673_100022762 | 3300005364 | Bacteria | 4566 |
| 22 | Ga0070659_100000016 | 3300005366 | Bacteria | 169522 |
| 23 | Ga0070678_100007302 | 3300005456 | Bacteria | 6545 |
| 24 | Ga0070662_100000032 | 3300005457 | Bacteria | 78824 |
| 25 | Ga0070681_10008778 | 3300005458 | Bacteria | 9921 |
| 26 | Ga0070679_100082294 | 3300005530 | Bacteria | 3209 |
| 27 | Ga0070684_100120506 | 3300005535 | Bacteria | 2360 |
| 28 | Ga0068853_100047010 | 3300005539 | Bacteria | 3703 |
| 29 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 30 | Ga0068855_100000226 | 3300005563 | Bacteria | 72130 |
| 31 | Ga0068855_100005580 | 3300005563 | Bacteria | 15354 |
| 32 | Ga0068855_100009512 | 3300005563 | Bacteria | 11738 |
| 33 | Ga0068855_100025360 | 3300005563 | Bacteria | 7095 |
| 34 | Ga0068855_100113699 | 3300005563 | Bacteria | 3105 |
| 35 | Ga0068855_100382855 | 3300005563 | Bacteria | 1544 |
| 36 | Ga0068856_100000262 | 3300005614 | Bacteria | 57470 |
| 37 | Ga0068856_100017009 | 3300005614 | Bacteria | 7048 |
| 38 | Ga0068856_100069380 | 3300005614 | Bacteria | 3485 |
| 39 | Ga0068852_100006795 | 3300005616 | Bacteria | 8304 |
| 40 | Ga0068858_100019093 | 3300005842 | Bacteria | 6412 |
| 41 | Ga0097621_100000827 | 3300006237 | Bacteria | 21866 |
| 42 | Ga0097621_100084574 | 3300006237 | Bacteria | 2645 |
| 43 | Ga0068871_100001149 | 3300006358 | Bacteria | 17749 |
| 44 | Ga0068865_100000574 | 3300006881 | Bacteria | 20568 |
| 45 | Ga0105240_10000294 | 3300009093 | Bacteria | 97108 |
| 46 | Ga0105240_10058999 | 3300009093 | Bacteria | 4790 |
| 47 | Ga0105240_10080032 | 3300009093 | Bacteria | 4019 |
| 48 | Ga0105240_10085008 | 3300009093 | Bacteria | 3878 |
| 49 | Ga0105240_10087953 | 3300009093 | Bacteria | 3803 |
| 50 | Ga0105240_10114637 | 3300009093 | Bacteria | 3255 |
| 51 | Ga0105241_10000398 | 3300009174 | Bacteria | 32826 |
| 52 | Ga0105241_10024255 | 3300009174 | Bacteria | 4504 |
| 53 | Ga0105241_10032645 | 3300009174 | Bacteria | 3905 |
| 54 | Ga0105242_10020317 | 3300009176 | Bacteria | 5207 |
| 55 | Ga0105237_10000109 | 3300009545 | Bacteria | 115699 |
| 56 | Ga0105237_10001914 | 3300009545 | Bacteria | 26581 |
| 57 | Ga0105237_10003009 | 3300009545 | Bacteria | 20347 |
| 58 | Ga0105237_10006380 | 3300009545 | Bacteria | 13087 |
| 59 | Ga0105237_10010022 | 3300009545 | Bacteria | 10112 |
| 60 | Ga0105237_10056039 | 3300009545 | Bacteria | 3947 |
| 61 | Ga0105238_10025080 | 3300009551 | Bacteria | 6077 |
| 62 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 63 | Ga0105239_10000068 | 3300010375 | Bacteria | 144666 |
| 64 | Ga0105239_10000162 | 3300010375 | Bacteria | 95804 |
| 65 | Ga0105239_10002839 | 3300010375 | Bacteria | 21676 |
| 66 | Ga0105239_10017010 | 3300010375 | Bacteria | 8040 |
| 67 | Ga0105239_10045225 | 3300010375 | Bacteria | 4825 |
| 68 | Ga0105239_10051698 | 3300010375 | Bacteria | 4504 |
| 69 | Ga0105239_10096725 | 3300010375 | Bacteria | 3262 |
| 70 | Ga0157373_10000087 | 3300013100 | Bacteria | 80308 |
| 71 | Ga0157373_10004610 | 3300013100 | Bacteria | 10368 |
| 72 | Ga0157373_10063754 | 3300013100 | Bacteria | 2609 |
| 73 | Ga0157371_10000155 | 3300013102 | Bacteria | 100230 |
| 74 | Ga0157371_10015316 | 3300013102 | Bacteria | 5758 |
| 75 | Ga0157371_10059525 | 3300013102 | Bacteria | 2708 |
| 76 | Ga0157370_10002867 | 3300013104 | Bacteria | 20568 |
| 77 | Ga0157370_10005261 | 3300013104 | Bacteria | 14556 |
| 78 | Ga0157370_10016508 | 3300013104 | Bacteria | 7471 |
| 79 | Ga0157370_10238890 | 3300013104 | Bacteria | 1681 |
| 80 | Ga0157369_10002036 | 3300013105 | Bacteria | 24366 |
| 81 | Ga0157369_10042719 | 3300013105 | Bacteria | 4944 |
| 82 | Ga0157369_10053743 | 3300013105 | Bacteria | 4351 |
| 83 | Ga0157374_10001012 | 3300013296 | Bacteria | 24372 |
| 84 | Ga0157374_10002228 | 3300013296 | Bacteria | 16336 |
| 85 | Ga0157374_10020201 | 3300013296 | Bacteria | 5907 |
| 86 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 87 | Ga0163162_10006055 | 3300013306 | Bacteria | 11707 |
| 88 | Ga0157372_10000400 | 3300013307 | Bacteria | 47864 |
| 89 | Ga0157372_10000874 | 3300013307 | Bacteria | 32723 |
| 90 | Ga0157372_10002085 | 3300013307 | Bacteria | 21727 |
| 91 | Ga0157372_10003009 | 3300013307 | Bacteria | 18174 |
| 92 | Ga0157372_10073688 | 3300013307 | Bacteria | 3849 |
| 93 | Ga0157375_10082580 | 3300013308 | Bacteria | 3255 |
| 94 | Ga0182008_10000565 | 3300014497 | Bacteria | 27364 |
| 95 | Ga0182006_1000168 | 3300015261 | Bacteria | 69340 |
| 96 | Ga0182006_1001374 | 3300015261 | Bacteria | 14812 |
| 97 | Ga0182005_1000290 | 3300015265 | Bacteria | 31414 |
| 98 | Ga0163161_10018532 | 3300017792 | Bacteria | 4877 |
| 99 | Ga0207427_100085 | 3300025231 | Bacteria | 142561 |
| 100 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 101 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 102 | Ga0209026_1000840 | 3300025250 | Bacteria | 16216 |
| 103 | Ga0209026_1005609 | 3300025250 | Bacteria | 3318 |
| 104 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 105 | Ga0209233_1000495 | 3300025261 | Bacteria | 23831 |
| 106 | Ga0209233_1005605 | 3300025261 | Bacteria | 4152 |
| 107 | Ga0209455_1011257 | 3300025272 | Bacteria | 2214 |
| 108 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 109 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 110 | Ga0207426_1016190 | 3300025302 | Bacteria | 2685 |
| 111 | Ga0207647_10000207 | 3300025904 | Bacteria | 48256 |
| 112 | Ga0207647_10000948 | 3300025904 | Bacteria | 22427 |
| 113 | Ga0207645_10000082 | 3300025907 | Bacteria | 68372 |
| 114 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 115 | Ga0207654_10003575 | 3300025911 | Bacteria | 7858 |
| 116 | Ga0207654_10018119 | 3300025911 | Bacteria | 3691 |
| 117 | Ga0207707_10023588 | 3300025912 | Bacteria | 5381 |
| 118 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 119 | Ga0207695_10004328 | 3300025913 | Bacteria | 19447 |
| 120 | Ga0207695_10030109 | 3300025913 | Bacteria | 5981 |
| 121 | Ga0207695_10137776 | 3300025913 | Bacteria | 2392 |
| 122 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 123 | Ga0207671_10005361 | 3300025914 | Bacteria | 11857 |
| 124 | Ga0207671_10012941 | 3300025914 | Bacteria | 6677 |
| 125 | Ga0207671_10052693 | 3300025914 | Bacteria | 3015 |
| 126 | Ga0207660_10014223 | 3300025917 | Bacteria | 5227 |
| 127 | Ga0207657_10021261 | 3300025919 | Bacteria | 6112 |
| 128 | Ga0207652_10175749 | 3300025921 | Bacteria | 1923 |
| 129 | Ga0207694_10097980 | 3300025924 | Bacteria | 2321 |
| 130 | Ga0207690_10000495 | 3300025932 | Bacteria | 25433 |
| 131 | Ga0207690_10014207 | 3300025932 | Bacteria | 4805 |
| 132 | Ga0207690_10063873 | 3300025932 | Bacteria | 2512 |
| 133 | Ga0207706_10000191 | 3300025933 | Bacteria | 68535 |
| 134 | Ga0207704_10000053 | 3300025938 | Bacteria | 79904 |
| 135 | Ga0207667_10000039 | 3300025949 | Bacteria | 278843 |
| 136 | Ga0207667_10000896 | 3300025949 | Bacteria | 37967 |
| 137 | Ga0207667_10006347 | 3300025949 | Bacteria | 14333 |
| 138 | Ga0207667_10009992 | 3300025949 | Bacteria | 11130 |
| 139 | Ga0207667_10042272 | 3300025949 | Bacteria | 4846 |
| 140 | Ga0207651_10003179 | 3300025960 | Bacteria | 8017 |
| 141 | Ga0207677_10066941 | 3300026023 | Bacteria | 2514 |
| 142 | Ga0207703_10026721 | 3300026035 | Bacteria | 4546 |
| 143 | Ga0207639_10031156 | 3300026041 | Bacteria | 3918 |
| 144 | Ga0207639_10052007 | 3300026041 | Bacteria | 3119 |
| 145 | Ga0207702_10000492 | 3300026078 | Bacteria | 44456 |
| 146 | Ga0207702_10021697 | 3300026078 | Bacteria | 5317 |
| 147 | Ga0207648_10009920 | 3300026089 | Bacteria | 9079 |
| 148 | Ga0207683_10015163 | 3300026121 | Bacteria | 6558 |
| 149 | Ga0207698_10003515 | 3300026142 | Bacteria | 9450 |
| 150 | Ga0268266_10000052 | 3300028379 | Bacteria | 296230 |
| 151 | Ga0307517_10007927 | 3300028786 | Bacteria | 15349 |
| 152 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 153 | Ga0265338_10113214 | 3300028800 | Bacteria | 2180 |
| 154 | Ga0265327_10000285 | 3300031251 | Bacteria | 99746 |
| 155 | Ga0307510_10021552 | 3300033180 | Bacteria | 7508 |
| 156 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 157 | Ga0395899_0000055 | 3300037312 | Bacteria | 220579 |
| 158 | Ga0395899_0000312 | 3300037312 | Bacteria | 62304 |
| 159 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 160 | Ga0395900_0000128 | 3300037418 | Bacteria | 127446 |
| 161 | Ga0395900_0007404 | 3300037418 | Bacteria | 11346 |
| 162 | Ga0395898_0022234 | 3300037466 | Bacteria | 6426 |
| 163 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 164 | Ga0395905_0002800 | 3300037471 | Bacteria | 19106 |
| 165 | Ga0395901_0000166 | 3300038443 | Bacteria | 86352 |
| 166 | Ga0395901_0054083 | 3300038443 | Bacteria | 4172 |
| 167 | Ga0439448_0007477 | 3300042005 | Bacteria | 3170 |
| 168 | Ga0466966_0024424 | 3300044684 | Bacteria | 3952 |
| 169 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 170 | Ga0495585_0000198 | 3300046492 | Bacteria | 62640 |
| 171 | Ga0495585_0000553 | 3300046492 | Bacteria | 35342 |
| 172 | Ga0495583_0022419 | 3300046506 | Bacteria | 3222 |
| 173 | Ga0495610_0001134 | 3300046512 | Bacteria | 24228 |
| 174 | Ga0495616_0001519 | 3300046513 | Bacteria | 15997 |
| 175 | Ga0495616_0003999 | 3300046513 | Bacteria | 9373 |
| 176 | Ga0495631_0012131 | 3300046518 | Bacteria | 4219 |
| 177 | Ga0495637_0063232 | 3300046520 | Bacteria | 1513 |
| 178 | Ga0495648_0007640 | 3300046524 | Bacteria | 8622 |
| 179 | Ga0495609_0011754 | 3300046538 | Bacteria | 4163 |
| 180 | Ga0495633_0009063 | 3300046558 | Bacteria | 5533 |
| 181 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 182 | Ga0495625_0000105 | 3300046660 | Bacteria | 126078 |
| 183 | Ga0495625_0001038 | 3300046660 | Bacteria | 36510 |
| 184 | Ga0495625_0008344 | 3300046660 | Bacteria | 8844 |
| 185 | Ga0495625_0037377 | 3300046660 | Bacteria | 3563 |
| 186 | Ga0495661_0011911 | 3300046665 | Bacteria | 5887 |
| 187 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 188 | Ga0495687_000552 | 3300047443 | Bacteria | 44401 |
| 189 | Ga0495686_0000098 | 3300047472 | Bacteria | 183131 |
| 190 | Ga0495686_0001801 | 3300047472 | Bacteria | 21688 |
| 191 | Ga0495686_0015155 | 3300047472 | Bacteria | 5279 |
| 192 | Ga0496121_0000011 | 3300048924 | Bacteria | 792193 |
| 193 | Ga0496122_0001708 | 3300048925 | Bacteria | 34038 |
| 194 | Ga0496123_0004392 | 3300048926 | Bacteria | 14872 |
| 195 | Ga0496124_0020191 | 3300048927 | Bacteria | 6167 |
| 196 | Ga0495678_005407 | 3300049459 | Bacteria | 7057 |
| 197 | Ga0501034_0059705 | 3300049571 | Bacteria | 3830 |
| 198 | Ga0501047_0118608 | 3300049581 | Unclassified | 2528 |
| 199 | Ga0500608_001643 | 3300053122 | Bacteria | 8034 |
| 200 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 201 | Ga0500559_0069347 | 3300053136 | Bacteria | 1585 |
| 202 | Ga0500624_000530 | 3300053157 | Bacteria | 10893 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10056039 | Ga0105237_100560395 | 397 |
| 2 | 3300010375 | Ga0105239_10051698 | Ga0105239_100516982 | 397 |
| 3 | 3300031251 | Ga0265327_10000285 | Ga0265327_1000028581 | 398 |
| 4 | 3300009093 | Ga0105240_10114637 | Ga0105240_101146372 | 409 |
| 5 | 3300046518 | Ga0495631_0012131 | Ga0495631_0012131_255_1631 | 417 |
| 6 | 3300049571 | Ga0501034_0059705 | Ga0501034_0059705_792_2168 | 419 |
| 7 | 3300049581 | Ga0501047_0118608 | Ga0501047_0118608_971_2347 | 419 |
| 8 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_96008_97360 | 420 |
| 9 | 3300025272 | Ga0209455_1011257 | Ga0209455_10112572 | 425 |
| 10 | 3300013306 | Ga0163162_10000031 | Ga0163162_1000003152 | 426 |
| 11 | 3300037418 | Ga0395900_0000128 | Ga0395900_0000128_113697_115085 | 427 |
| 12 | 3300048927 | Ga0496124_0020191 | Ga0496124_0020191_488_1834 | 428 |
| 13 | 3300003320 | rootH2_10044515 | rootH2_100445155 | 429 |
| 14 | 3300003316 | rootH1_10074478 | rootH1_100744784 | 432 |
| 15 | 3300025261 | Ga0209233_1005605 | Ga0209233_10056054 | 432 |
| 16 | 3300025914 | Ga0207671_10005361 | Ga0207671_100053612 | 432 |
| 17 | 3300053122 | Ga0500608_001643 | Ga0500608_001643_4586_5923 | 432 |
| 18 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_12582_13973 | 433 |
| 19 | 3300009174 | Ga0105241_10024255 | Ga0105241_100242553 | 434 |
| 20 | 3300010375 | Ga0105239_10096725 | Ga0105239_100967253 | 434 |
| 21 | 3300010375 | Ga0105239_10000162 | Ga0105239_1000016262 | 435 |
| 22 | 3300013104 | Ga0157370_10016508 | Ga0157370_100165085 | 436 |
| 23 | iso_pu_bacteria | 2919437846 | 2919439864 | 436 |
| 24 | 3300005458 | Ga0070681_10008778 | Ga0070681_100087785 | 437 |
| 25 | 3300009093 | Ga0105240_10080032 | Ga0105240_100800322 | 437 |
| 26 | 3300025912 | Ga0207707_10023588 | Ga0207707_100235882 | 437 |
| 27 | 3300025917 | Ga0207660_10014223 | Ga0207660_100142236 | 437 |
| 28 | 3300005563 | Ga0068855_100382855 | Ga0068855_1003828552 | 438 |
| 29 | 3300002737 | JGI25162J39368_1001031 | JGI25162J39368_10010312 | 439 |
| 30 | 3300003214 | JGI25165J46597_1000869 | JGI25165J46597_10008699 | 439 |
| 31 | 3300003320 | rootH2_10022503 | rootH2_100225034 | 439 |
| 32 | 3300005563 | Ga0068855_100000226 | Ga0068855_10000022668 | 439 |
| 33 | 3300025231 | Ga0207427_100085 | Ga0207427_1000856 | 439 |
| 34 | 3300025233 | Ga0209437_100052 | Ga0209437_100052238 | 439 |
| 35 | 3300025261 | Ga0209233_1000067 | Ga0209233_1000067238 | 439 |
| 36 | 3300025914 | Ga0207671_10012941 | Ga0207671_100129417 | 439 |
| 37 | 3300025949 | Ga0207667_10000039 | Ga0207667_10000039129 | 439 |
| 38 | 3300005614 | Ga0068856_100017009 | Ga0068856_1000170093 | 440 |
| 39 | 3300005614 | Ga0068856_100069380 | Ga0068856_1000693802 | 440 |
| 40 | 3300009093 | Ga0105240_10087953 | Ga0105240_100879533 | 440 |
| 41 | 3300025913 | Ga0207695_10137776 | Ga0207695_101377763 | 440 |
| 42 | 3300026078 | Ga0207702_10021697 | Ga0207702_100216972 | 440 |
| 43 | 3300047472 | Ga0495686_0015155 | Ga0495686_0015155_1724_3082 | 440 |
| 44 | 3300002067 | JGI24735J21928_10000005 | JGI24735J21928_10000005139 | 441 |
| 45 | 3300003323 | rootH1_10087397 | rootH1_100873972 | 441 |
| 46 | 3300009545 | Ga0105237_10001914 | Ga0105237_1000191420 | 441 |
| 47 | 3300010375 | Ga0105239_10000013 | Ga0105239_1000001313 | 441 |
| 48 | 3300013105 | Ga0157369_10053743 | Ga0157369_100537433 | 441 |
| 49 | 3300013307 | Ga0157372_10000874 | Ga0157372_1000087424 | 441 |
| 50 | 3300009093 | Ga0105240_10000294 | Ga0105240_1000029430 | 442 |
| 51 | 3300009545 | Ga0105237_10000109 | Ga0105237_1000010921 | 442 |
| 52 | 3300009551 | Ga0105238_10025080 | Ga0105238_100250802 | 442 |
| 53 | 3300025913 | Ga0207695_10000142 | Ga0207695_10000142146 | 442 |
| 54 | 3300025914 | Ga0207671_10000110 | Ga0207671_10000110127 | 442 |
| 55 | 3300025924 | Ga0207694_10097980 | Ga0207694_100979802 | 442 |
| 56 | 3300028800 | Ga0265338_10113214 | Ga0265338_101132142 | 442 |
| 57 | 3300013104 | Ga0157370_10002867 | Ga0157370_100028672 | 443 |
| 58 | 3300014497 | Ga0182008_10000565 | Ga0182008_1000056527 | 443 |
| 59 | 3300015261 | Ga0182006_1001374 | Ga0182006_10013746 | 443 |
| 60 | 3300017792 | Ga0163161_10018532 | Ga0163161_100185322 | 443 |
| 61 | 3300048925 | Ga0496122_0001708 | Ga0496122_0001708_18228_19619 | 443 |
| 62 | 3300048926 | Ga0496123_0004392 | Ga0496123_0004392_11917_13308 | 443 |
| 63 | 3300001990 | JGI24737J22298_10013459 | JGI24737J22298_100134592 | 444 |
| 64 | 3300003320 | rootH2_10002814 | rootH2_1000281429 | 444 |
| 65 | 3300005328 | Ga0070676_10003202 | Ga0070676_100032022 | 444 |
| 66 | 3300005364 | Ga0070673_100022762 | Ga0070673_1000227625 | 444 |
| 67 | 3300005456 | Ga0070678_100007302 | Ga0070678_1000073024 | 444 |
| 68 | 3300005457 | Ga0070662_100000032 | Ga0070662_10000003232 | 444 |
| 69 | 3300005616 | Ga0068852_100006795 | Ga0068852_1000067955 | 444 |
| 70 | 3300006237 | Ga0097621_100000827 | Ga0097621_10000082721 | 444 |
| 71 | 3300006358 | Ga0068871_100001149 | Ga0068871_10000114912 | 444 |
| 72 | 3300006881 | Ga0068865_100000574 | Ga0068865_1000005745 | 444 |
| 73 | 3300009093 | Ga0105240_10058999 | Ga0105240_100589992 | 444 |
| 74 | 3300009174 | Ga0105241_10000398 | Ga0105241_1000039825 | 444 |
| 75 | 3300009174 | Ga0105241_10032645 | Ga0105241_100326452 | 444 |
| 76 | 3300009176 | Ga0105242_10020317 | Ga0105242_100203172 | 444 |
| 77 | 3300010375 | Ga0105239_10017010 | Ga0105239_100170105 | 444 |
| 78 | 3300010375 | Ga0105239_10045225 | Ga0105239_100452255 | 444 |
| 79 | 3300013100 | Ga0157373_10063754 | Ga0157373_100637542 | 444 |
| 80 | 3300013102 | Ga0157371_10015316 | Ga0157371_100153166 | 444 |
| 81 | 3300013105 | Ga0157369_10042719 | Ga0157369_100427193 | 444 |
| 82 | 3300013296 | Ga0157374_10001012 | Ga0157374_1000101220 | 444 |
| 83 | 3300013296 | Ga0157374_10002228 | Ga0157374_1000222813 | 444 |
| 84 | 3300013307 | Ga0157372_10073688 | Ga0157372_100736883 | 444 |
| 85 | 3300025904 | Ga0207647_10000948 | Ga0207647_100009489 | 444 |
| 86 | 3300025907 | Ga0207645_10000082 | Ga0207645_1000008217 | 444 |
| 87 | 3300025911 | Ga0207654_10003575 | Ga0207654_100035752 | 444 |
| 88 | 3300025911 | Ga0207654_10018119 | Ga0207654_100181192 | 444 |
| 89 | 3300025913 | Ga0207695_10030109 | Ga0207695_100301096 | 444 |
| 90 | 3300025914 | Ga0207671_10052693 | Ga0207671_100526932 | 444 |
| 91 | 3300025932 | Ga0207690_10063873 | Ga0207690_100638732 | 444 |
| 92 | 3300025933 | Ga0207706_10000191 | Ga0207706_1000019138 | 444 |
| 93 | 3300025938 | Ga0207704_10000053 | Ga0207704_1000005365 | 444 |
| 94 | 3300025960 | Ga0207651_10003179 | Ga0207651_100031797 | 444 |
| 95 | 3300026023 | Ga0207677_10066941 | Ga0207677_100669412 | 444 |
| 96 | 3300026041 | Ga0207639_10052007 | Ga0207639_100520072 | 444 |
| 97 | 3300026089 | Ga0207648_10009920 | Ga0207648_100099203 | 444 |
| 98 | 3300026121 | Ga0207683_10015163 | Ga0207683_100151634 | 444 |
| 99 | 3300026142 | Ga0207698_10003515 | Ga0207698_100035153 | 444 |
| 100 | 3300047443 | Ga0495687_000552 | Ga0495687_000552_33238_34614 | 444 |
| 101 | iso_pu_bacteria | 2818991444 | 2819587310 | 444 |
| 102 | 3300003323 | rootH1_10103532 | rootH1_101035321 | 445 |
| 103 | 3300005539 | Ga0068853_100047010 | Ga0068853_1000470102 | 445 |
| 104 | 3300005563 | Ga0068855_100113699 | Ga0068855_1001136991 | 445 |
| 105 | 3300009093 | Ga0105240_10085008 | Ga0105240_100850082 | 445 |
| 106 | 3300025913 | Ga0207695_10004328 | Ga0207695_100043288 | 445 |
| 107 | 3300025949 | Ga0207667_10006347 | Ga0207667_100063474 | 445 |
| 108 | 3300026041 | Ga0207639_10031156 | Ga0207639_100311563 | 445 |
| 109 | 3300028786 | Ga0307517_10007927 | Ga0307517_1000792712 | 445 |
| 110 | 3300033180 | Ga0307510_10021552 | Ga0307510_100215525 | 445 |
| 111 | 3300037312 | Ga0395899_0000312 | Ga0395899_0000312_57433_58809 | 445 |
| 112 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_74794_76170 | 445 |
| 113 | 3300037466 | Ga0395898_0022234 | Ga0395898_0022234_4399_5775 | 445 |
| 114 | 3300037471 | Ga0395905_0000037 | Ga0395905_0000037_74784_76160 | 445 |
| 115 | 3300038443 | Ga0395901_0000166 | Ga0395901_0000166_74648_76024 | 445 |
| 116 | 3300042005 | Ga0439448_0007477 | Ga0439448_0007477_507_1883 | 445 |
| 117 | 3300046660 | Ga0495625_0037377 | Ga0495625_0037377_1796_3175 | 445 |
| 118 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003642 | 446 |
| 119 | 3300013308 | Ga0157375_10082580 | Ga0157375_100825804 | 446 |
| 120 | 3300028379 | Ga0268266_10000052 | Ga0268266_10000052233 | 446 |
| 121 | iso_pu_bacteria | 2818991442 | 2819576196 | 446 |
| 122 | iso_pu_bacteria | 2821136567 | 2821142423 | 446 |
| 123 | iso_pu_bacteria | 2904467357 | 2904470410 | 446 |
| 124 | 3300005339 | Ga0070660_100008880 | Ga0070660_1000088802 | 447 |
| 125 | 3300005366 | Ga0070659_100000016 | Ga0070659_10000001672 | 447 |
| 126 | 3300015265 | Ga0182005_1000290 | Ga0182005_100029019 | 447 |
| 127 | 3300025302 | Ga0207426_1016190 | Ga0207426_10161902 | 447 |
| 128 | 3300025919 | Ga0207657_10021261 | Ga0207657_100212615 | 447 |
| 129 | 3300025932 | Ga0207690_10000495 | Ga0207690_1000049517 | 447 |
| 130 | 3300048924 | Ga0496121_0000011 | Ga0496121_0000011_304968_306377 | 447 |
| 131 | iso_pu_bacteria | 2738541283 | 2738756300 | 447 |
| 132 | iso_pu_bacteria | 2857627736 | 2857632637 | 447 |
| 133 | iso_pu_bacteria | 2977232053 | 2977236600 | 447 |
| 134 | 3300001990 | JGI24737J22298_10003557 | JGI24737J22298_100035572 | 448 |
| 135 | 3300005842 | Ga0068858_100019093 | Ga0068858_1000190934 | 448 |
| 136 | 3300013100 | Ga0157373_10004610 | Ga0157373_100046102 | 448 |
| 137 | 3300013102 | Ga0157371_10000155 | Ga0157371_1000015535 | 448 |
| 138 | 3300013104 | Ga0157370_10005261 | Ga0157370_100052618 | 448 |
| 139 | 3300013306 | Ga0163162_10006055 | Ga0163162_100060555 | 448 |
| 140 | 3300013307 | Ga0157372_10003009 | Ga0157372_100030097 | 448 |
| 141 | 3300025261 | Ga0209233_1000495 | Ga0209233_10004957 | 448 |
| 142 | 3300025904 | Ga0207647_10000207 | Ga0207647_100002072 | 448 |
| 143 | 3300025932 | Ga0207690_10014207 | Ga0207690_100142072 | 448 |
| 144 | 3300026035 | Ga0207703_10026721 | Ga0207703_100267212 | 448 |
| 145 | 3300046513 | Ga0495616_0001519 | Ga0495616_0001519_4524_5906 | 448 |
| 146 | 3300049459 | Ga0495678_005407 | Ga0495678_005407_4739_6121 | 448 |
| 147 | 3300053136 | Ga0500559_0069347 | Ga0500559_0069347_87_1472 | 448 |
| 148 | iso_pu_bacteria | 2599185184 | 2599480004 | 448 |
| 149 | iso_pu_bacteria | 2928078545 | 2928081135 | 448 |
| 150 | iso_pu_bacteria | 2928147474 | 2928152444 | 448 |
| 151 | iso_pu_bacteria | 2932082852 | 2932087785 | 448 |
| 152 | 3300003323 | rootH1_10003212 | rootH1_1000321279 | 449 |
| 153 | 3300005327 | Ga0070658_10000011 | Ga0070658_1000001179 | 449 |
| 154 | 3300005530 | Ga0070679_100082294 | Ga0070679_1000822942 | 449 |
| 155 | 3300005563 | Ga0068855_100005580 | Ga0068855_10000558012 | 449 |
| 156 | 3300005563 | Ga0068855_100009512 | Ga0068855_1000095128 | 449 |
| 157 | 3300005614 | Ga0068856_100000262 | Ga0068856_10000026223 | 449 |
| 158 | 3300009545 | Ga0105237_10003009 | Ga0105237_100030091 | 449 |
| 159 | 3300013296 | Ga0157374_10020201 | Ga0157374_100202012 | 449 |
| 160 | 3300025909 | Ga0207705_10000015 | Ga0207705_1000001579 | 449 |
| 161 | 3300025921 | Ga0207652_10175749 | Ga0207652_101757492 | 449 |
| 162 | 3300025949 | Ga0207667_10000896 | Ga0207667_1000089612 | 449 |
| 163 | 3300025949 | Ga0207667_10009992 | Ga0207667_100099922 | 449 |
| 164 | 3300026078 | Ga0207702_10000492 | Ga0207702_100004926 | 449 |
| 165 | 3300037418 | Ga0395900_0007404 | Ga0395900_0007404_1541_2929 | 449 |
| 166 | 3300037471 | Ga0395905_0002800 | Ga0395905_0002800_8332_9720 | 449 |
| 167 | 3300038443 | Ga0395901_0054083 | Ga0395901_0054083_1254_2642 | 449 |
| 168 | 3300002741 | JGI25157J39369_1002587 | JGI25157J39369_10025875 | 450 |
| 169 | 3300005329 | Ga0070683_100012824 | Ga0070683_1000128242 | 450 |
| 170 | 3300005535 | Ga0070684_100120506 | Ga0070684_1001205062 | 450 |
| 171 | 3300013100 | Ga0157373_10000087 | Ga0157373_100000874 | 450 |
| 172 | 3300013307 | Ga0157372_10002085 | Ga0157372_1000208513 | 450 |
| 173 | 3300025250 | Ga0209026_1000840 | Ga0209026_100084010 | 450 |
| 174 | 3300025250 | Ga0209026_1005609 | Ga0209026_10056093 | 450 |
| 175 | 3300046660 | Ga0495625_0008344 | Ga0495625_0008344_6862_8250 | 450 |
| 176 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008162 | 451 |
| 177 | 3300003781 | Ga0055536_1000001 | Ga0055536_100000185 | 451 |
| 178 | 3300005563 | Ga0068855_100025360 | Ga0068855_1000253602 | 451 |
| 179 | 3300006237 | Ga0097621_100084574 | Ga0097621_1000845742 | 451 |
| 180 | 3300009545 | Ga0105237_10006380 | Ga0105237_100063807 | 451 |
| 181 | 3300009545 | Ga0105237_10010022 | Ga0105237_100100222 | 451 |
| 182 | 3300010375 | Ga0105239_10000068 | Ga0105239_10000068131 | 451 |
| 183 | 3300010375 | Ga0105239_10002839 | Ga0105239_100028394 | 451 |
| 184 | 3300013105 | Ga0157369_10002036 | Ga0157369_1000203617 | 451 |
| 185 | 3300013307 | Ga0157372_10000400 | Ga0157372_1000040028 | 451 |
| 186 | 3300015261 | Ga0182006_1000168 | Ga0182006_100016813 | 451 |
| 187 | 3300025233 | Ga0209437_100030 | Ga0209437_100030228 | 451 |
| 188 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008772 | 451 |
| 189 | 3300025298 | Ga0209050_1000045 | Ga0209050_100004513 | 451 |
| 190 | 3300025949 | Ga0207667_10042272 | Ga0207667_100422722 | 451 |
| 191 | 3300028794 | Ga0307515_10001997 | Ga0307515_1000199736 | 451 |
| 192 | 3300037312 | Ga0395899_0000055 | Ga0395899_0000055_15985_17376 | 451 |
| 193 | 3300044684 | Ga0466966_0024424 | Ga0466966_0024424_2120_3511 | 451 |
| 194 | 3300046492 | Ga0495585_0000553 | Ga0495585_0000553_29422_30813 | 451 |
| 195 | 3300046524 | Ga0495648_0007640 | Ga0495648_0007640_4440_5831 | 451 |
| 196 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_69242_70633 | 451 |
| 197 | 3300046660 | Ga0495625_0001038 | Ga0495625_0001038_30587_31978 | 451 |
| 198 | 3300047472 | Ga0495686_0000098 | Ga0495686_0000098_159281_160672 | 451 |
| 199 | 3300047472 | Ga0495686_0001801 | Ga0495686_0001801_16929_18320 | 451 |
| 200 | 3300053157 | Ga0500624_000530 | Ga0500624_000530_8711_10102 | 451 |
| 201 | 3300001979 | JGI24740J21852_10013928 | JGI24740J21852_100139283 | 452 |
| 202 | 3300013102 | Ga0157371_10059525 | Ga0157371_100595252 | 452 |
| 203 | 3300013104 | Ga0157370_10238890 | Ga0157370_102388902 | 452 |
| 204 | 3300046471 | Ga0495650_0000050 | Ga0495650_0000050_52493_53887 | 452 |
| 205 | 3300046492 | Ga0495585_0000198 | Ga0495585_0000198_11788_13182 | 452 |
| 206 | 3300046506 | Ga0495583_0022419 | Ga0495583_0022419_131_1525 | 452 |
| 207 | 3300046512 | Ga0495610_0001134 | Ga0495610_0001134_19175_20611 | 452 |
| 208 | 3300046513 | Ga0495616_0003999 | Ga0495616_0003999_5775_7169 | 452 |
| 209 | 3300046520 | Ga0495637_0063232 | Ga0495637_0063232_18_1454 | 452 |
| 210 | 3300046538 | Ga0495609_0011754 | Ga0495609_0011754_2131_3525 | 452 |
| 211 | 3300046558 | Ga0495633_0009063 | Ga0495633_0009063_925_2361 | 452 |
| 212 | 3300046660 | Ga0495625_0000105 | Ga0495625_0000105_85879_87273 | 452 |
| 213 | 3300046665 | Ga0495661_0011911 | Ga0495661_0011911_872_2266 | 452 |
| 214 | 3300046694 | Ga0495649_0000011 | Ga0495649_0000011_38785_40179 | 452 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wp1-assembly2.cif.gz_B | crystal structure of the drug-discharge outer membrane protein, oprm | 0.785 | 32 | 441 |
| 1yc9-assembly1.cif.gz_A | the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution | 0.7709 | 32 | 441 |
| 4mt4-assembly1.cif.gz_C | crystal structure of the campylobacter jejuni cmec outer membrane channel | 0.7662 | 32 | 444 |
| 5azp-assembly1.cif.gz_A | crystal structure of a membrane protein from pseudomonas aeruginosa | 0.7639 | 32 | 440 |
| 5azs-assembly1.cif.gz_C | crystal structure of a membrane protein from pseudomonas aeruginosa | 0.7558 | 32 | 440 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9087 | 367 | 435 | 1.10.287.470 |
| 2f1mD03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8965 | 367 | 435 | 1.10.287.470 |
| 2f1mA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8746 | 367 | 435 | 1.10.287.470 |
| 2f1mB03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8474 | 367 | 435 | 1.10.287.470 |
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8417 | 367 | 435 | 1.10.287.470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841MXC2-F1-model_v4 | deleted | 0.8645 | 267 | 449 |
|
| AF-A0A7X7XGQ2-F1-model_v4 | TolC family protein | 0.8446 | 27 | 444 |
GO:0015562
|
| AF-A0A651HHT1-F1-model_v4 | TolC family protein | 0.842 | 30 | 444 |
GO:0015562
|
| AF-A0A1C4DGW6-F1-model_v4 | Outer membrane protein TolC | 0.8391 | 27 | 451 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A646MR91-F1-model_v4 | deleted | 0.8384 | 131 | 452 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar