F325334

General Info

Members Datasets Scaffolds Average Seq Length
214 131 202 454

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10001997|Ga0307515_1000199736
Length 485
Sequence MLCLHSFLPGVLYRYIKFQETYMQIITRSVFILMALLISLNTFAQQNIKPIGLKALLSQVNANAPALITDSAAIGIRQAQAAETRSNWLPNLKLNYQADIGTNNNVAGPYFGFGIIPSDSRGVRTQSNTTAVSANVGVAALDWEVYNFGAYDAQNKVANSDIRVQQSQFANSKYQLQAYAIGNYLLLMRLQNFLDIQSRNIQRNVEIRRSVQSLAKSGVRAGVDTSIAEAELSKARLNYIELANQVKQVQLQLSAVSGLPYQSIVPDTAAETALIDQPAALQPIEQDTVNHPIINYYRSVYQNSLQRENLVKKSYNPKIMLEGAVWGRGSSVDANDHFNSLSTGWGFDRNNYLVGVGISYNLFDLRRKQLKLRTQKAETSYNARKLQEQKQMLAVNANQADVELETARQRLQEIPHQLRAANDGYRQKLSLYKNGLTDIIELNAALNILYRAETDFAQAKYSYSSALFQKAVTDNQVNAVLNLLK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
129 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 0.47
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013928 3300001979 Bacteria 2982
2 JGI24737J22298_10003557 3300001990 Bacteria 5493
3 JGI24737J22298_10013459 3300001990 Bacteria 2662
4 JGI24735J21928_10000005 3300002067 Bacteria 356755
5 JGI25162J39368_1000008 3300002737 Bacteria 397212
6 JGI25162J39368_1001031 3300002737 Bacteria 17224
7 JGI25157J39369_1002587 3300002741 Bacteria 4312
8 JGI25165J46597_1000869 3300003214 Bacteria 21479
9 rootH1_10074478 3300003316 Bacteria 4231
10 rootH2_10002814 3300003320 Bacteria 49344
11 rootH2_10022503 3300003320 Bacteria 3548
12 rootH2_10044515 3300003320 Bacteria 11301
13 rootH1_10003212 3300003323 Bacteria 182359
14 rootH1_10087397 3300003323 Bacteria 3868
15 rootH1_10103532 3300003323 Bacteria 1524
16 Ga0055536_1000001 3300003781 Bacteria 630663
17 Ga0070658_10000011 3300005327 Bacteria 294396
18 Ga0070676_10003202 3300005328 Bacteria 8487
19 Ga0070683_100012824 3300005329 Bacteria 7294
20 Ga0070660_100008880 3300005339 Bacteria 7048
21 Ga0070673_100022762 3300005364 Bacteria 4566
22 Ga0070659_100000016 3300005366 Bacteria 169522
23 Ga0070678_100007302 3300005456 Bacteria 6545
24 Ga0070662_100000032 3300005457 Bacteria 78824
25 Ga0070681_10008778 3300005458 Bacteria 9921
26 Ga0070679_100082294 3300005530 Bacteria 3209
27 Ga0070684_100120506 3300005535 Bacteria 2360
28 Ga0068853_100047010 3300005539 Bacteria 3703
29 Ga0070665_100000003 3300005548 Bacteria 811857
30 Ga0068855_100000226 3300005563 Bacteria 72130
31 Ga0068855_100005580 3300005563 Bacteria 15354
32 Ga0068855_100009512 3300005563 Bacteria 11738
33 Ga0068855_100025360 3300005563 Bacteria 7095
34 Ga0068855_100113699 3300005563 Bacteria 3105
35 Ga0068855_100382855 3300005563 Bacteria 1544
36 Ga0068856_100000262 3300005614 Bacteria 57470
37 Ga0068856_100017009 3300005614 Bacteria 7048
38 Ga0068856_100069380 3300005614 Bacteria 3485
39 Ga0068852_100006795 3300005616 Bacteria 8304
40 Ga0068858_100019093 3300005842 Bacteria 6412
41 Ga0097621_100000827 3300006237 Bacteria 21866
42 Ga0097621_100084574 3300006237 Bacteria 2645
43 Ga0068871_100001149 3300006358 Bacteria 17749
44 Ga0068865_100000574 3300006881 Bacteria 20568
45 Ga0105240_10000294 3300009093 Bacteria 97108
46 Ga0105240_10058999 3300009093 Bacteria 4790
47 Ga0105240_10080032 3300009093 Bacteria 4019
48 Ga0105240_10085008 3300009093 Bacteria 3878
49 Ga0105240_10087953 3300009093 Bacteria 3803
50 Ga0105240_10114637 3300009093 Bacteria 3255
51 Ga0105241_10000398 3300009174 Bacteria 32826
52 Ga0105241_10024255 3300009174 Bacteria 4504
53 Ga0105241_10032645 3300009174 Bacteria 3905
54 Ga0105242_10020317 3300009176 Bacteria 5207
55 Ga0105237_10000109 3300009545 Bacteria 115699
56 Ga0105237_10001914 3300009545 Bacteria 26581
57 Ga0105237_10003009 3300009545 Bacteria 20347
58 Ga0105237_10006380 3300009545 Bacteria 13087
59 Ga0105237_10010022 3300009545 Bacteria 10112
60 Ga0105237_10056039 3300009545 Bacteria 3947
61 Ga0105238_10025080 3300009551 Bacteria 6077
62 Ga0105239_10000013 3300010375 Bacteria 327371
63 Ga0105239_10000068 3300010375 Bacteria 144666
64 Ga0105239_10000162 3300010375 Bacteria 95804
65 Ga0105239_10002839 3300010375 Bacteria 21676
66 Ga0105239_10017010 3300010375 Bacteria 8040
67 Ga0105239_10045225 3300010375 Bacteria 4825
68 Ga0105239_10051698 3300010375 Bacteria 4504
69 Ga0105239_10096725 3300010375 Bacteria 3262
70 Ga0157373_10000087 3300013100 Bacteria 80308
71 Ga0157373_10004610 3300013100 Bacteria 10368
72 Ga0157373_10063754 3300013100 Bacteria 2609
73 Ga0157371_10000155 3300013102 Bacteria 100230
74 Ga0157371_10015316 3300013102 Bacteria 5758
75 Ga0157371_10059525 3300013102 Bacteria 2708
76 Ga0157370_10002867 3300013104 Bacteria 20568
77 Ga0157370_10005261 3300013104 Bacteria 14556
78 Ga0157370_10016508 3300013104 Bacteria 7471
79 Ga0157370_10238890 3300013104 Bacteria 1681
80 Ga0157369_10002036 3300013105 Bacteria 24366
81 Ga0157369_10042719 3300013105 Bacteria 4944
82 Ga0157369_10053743 3300013105 Bacteria 4351
83 Ga0157374_10001012 3300013296 Bacteria 24372
84 Ga0157374_10002228 3300013296 Bacteria 16336
85 Ga0157374_10020201 3300013296 Bacteria 5907
86 Ga0163162_10000031 3300013306 Bacteria 157666
87 Ga0163162_10006055 3300013306 Bacteria 11707
88 Ga0157372_10000400 3300013307 Bacteria 47864
89 Ga0157372_10000874 3300013307 Bacteria 32723
90 Ga0157372_10002085 3300013307 Bacteria 21727
91 Ga0157372_10003009 3300013307 Bacteria 18174
92 Ga0157372_10073688 3300013307 Bacteria 3849
93 Ga0157375_10082580 3300013308 Bacteria 3255
94 Ga0182008_10000565 3300014497 Bacteria 27364
95 Ga0182006_1000168 3300015261 Bacteria 69340
96 Ga0182006_1001374 3300015261 Bacteria 14812
97 Ga0182005_1000290 3300015265 Bacteria 31414
98 Ga0163161_10018532 3300017792 Bacteria 4877
99 Ga0207427_100085 3300025231 Bacteria 142561
100 Ga0209437_100030 3300025233 Bacteria 532466
101 Ga0209437_100052 3300025233 Bacteria 380548
102 Ga0209026_1000840 3300025250 Bacteria 16216
103 Ga0209026_1005609 3300025250 Bacteria 3318
104 Ga0209233_1000067 3300025261 Bacteria 380554
105 Ga0209233_1000495 3300025261 Bacteria 23831
106 Ga0209233_1005605 3300025261 Bacteria 4152
107 Ga0209455_1011257 3300025272 Bacteria 2214
108 Ga0209676_1000008 3300025292 Bacteria 991778
109 Ga0209050_1000045 3300025298 Bacteria 388022
110 Ga0207426_1016190 3300025302 Bacteria 2685
111 Ga0207647_10000207 3300025904 Bacteria 48256
112 Ga0207647_10000948 3300025904 Bacteria 22427
113 Ga0207645_10000082 3300025907 Bacteria 68372
114 Ga0207705_10000015 3300025909 Bacteria 382901
115 Ga0207654_10003575 3300025911 Bacteria 7858
116 Ga0207654_10018119 3300025911 Bacteria 3691
117 Ga0207707_10023588 3300025912 Bacteria 5381
118 Ga0207695_10000142 3300025913 Bacteria 214715
119 Ga0207695_10004328 3300025913 Bacteria 19447
120 Ga0207695_10030109 3300025913 Bacteria 5981
121 Ga0207695_10137776 3300025913 Bacteria 2392
122 Ga0207671_10000110 3300025914 Bacteria 126480
123 Ga0207671_10005361 3300025914 Bacteria 11857
124 Ga0207671_10012941 3300025914 Bacteria 6677
125 Ga0207671_10052693 3300025914 Bacteria 3015
126 Ga0207660_10014223 3300025917 Bacteria 5227
127 Ga0207657_10021261 3300025919 Bacteria 6112
128 Ga0207652_10175749 3300025921 Bacteria 1923
129 Ga0207694_10097980 3300025924 Bacteria 2321
130 Ga0207690_10000495 3300025932 Bacteria 25433
131 Ga0207690_10014207 3300025932 Bacteria 4805
132 Ga0207690_10063873 3300025932 Bacteria 2512
133 Ga0207706_10000191 3300025933 Bacteria 68535
134 Ga0207704_10000053 3300025938 Bacteria 79904
135 Ga0207667_10000039 3300025949 Bacteria 278843
136 Ga0207667_10000896 3300025949 Bacteria 37967
137 Ga0207667_10006347 3300025949 Bacteria 14333
138 Ga0207667_10009992 3300025949 Bacteria 11130
139 Ga0207667_10042272 3300025949 Bacteria 4846
140 Ga0207651_10003179 3300025960 Bacteria 8017
141 Ga0207677_10066941 3300026023 Bacteria 2514
142 Ga0207703_10026721 3300026035 Bacteria 4546
143 Ga0207639_10031156 3300026041 Bacteria 3918
144 Ga0207639_10052007 3300026041 Bacteria 3119
145 Ga0207702_10000492 3300026078 Bacteria 44456
146 Ga0207702_10021697 3300026078 Bacteria 5317
147 Ga0207648_10009920 3300026089 Bacteria 9079
148 Ga0207683_10015163 3300026121 Bacteria 6558
149 Ga0207698_10003515 3300026142 Bacteria 9450
150 Ga0268266_10000052 3300028379 Bacteria 296230
151 Ga0307517_10007927 3300028786 Bacteria 15349
152 Ga0307515_10001997 3300028794 Bacteria 45190
153 Ga0265338_10113214 3300028800 Bacteria 2180
154 Ga0265327_10000285 3300031251 Bacteria 99746
155 Ga0307510_10021552 3300033180 Bacteria 7508
156 Ga0395899_0000017 3300037312 Bacteria 440179
157 Ga0395899_0000055 3300037312 Bacteria 220579
158 Ga0395899_0000312 3300037312 Bacteria 62304
159 Ga0395900_0000014 3300037418 Bacteria 386513
160 Ga0395900_0000128 3300037418 Bacteria 127446
161 Ga0395900_0007404 3300037418 Bacteria 11346
162 Ga0395898_0022234 3300037466 Bacteria 6426
163 Ga0395905_0000037 3300037471 Bacteria 261808
164 Ga0395905_0002800 3300037471 Bacteria 19106
165 Ga0395901_0000166 3300038443 Bacteria 86352
166 Ga0395901_0054083 3300038443 Bacteria 4172
167 Ga0439448_0007477 3300042005 Bacteria 3170
168 Ga0466966_0024424 3300044684 Bacteria 3952
169 Ga0495650_0000050 3300046471 Bacteria 318894
170 Ga0495585_0000198 3300046492 Bacteria 62640
171 Ga0495585_0000553 3300046492 Bacteria 35342
172 Ga0495583_0022419 3300046506 Bacteria 3222
173 Ga0495610_0001134 3300046512 Bacteria 24228
174 Ga0495616_0001519 3300046513 Bacteria 15997
175 Ga0495616_0003999 3300046513 Bacteria 9373
176 Ga0495631_0012131 3300046518 Bacteria 4219
177 Ga0495637_0063232 3300046520 Bacteria 1513
178 Ga0495648_0007640 3300046524 Bacteria 8622
179 Ga0495609_0011754 3300046538 Bacteria 4163
180 Ga0495633_0009063 3300046558 Bacteria 5533
181 Ga0495668_0000032 3300046616 Bacteria 254951
182 Ga0495625_0000105 3300046660 Bacteria 126078
183 Ga0495625_0001038 3300046660 Bacteria 36510
184 Ga0495625_0008344 3300046660 Bacteria 8844
185 Ga0495625_0037377 3300046660 Bacteria 3563
186 Ga0495661_0011911 3300046665 Bacteria 5887
187 Ga0495649_0000011 3300046694 Bacteria 416695
188 Ga0495687_000552 3300047443 Bacteria 44401
189 Ga0495686_0000098 3300047472 Bacteria 183131
190 Ga0495686_0001801 3300047472 Bacteria 21688
191 Ga0495686_0015155 3300047472 Bacteria 5279
192 Ga0496121_0000011 3300048924 Bacteria 792193
193 Ga0496122_0001708 3300048925 Bacteria 34038
194 Ga0496123_0004392 3300048926 Bacteria 14872
195 Ga0496124_0020191 3300048927 Bacteria 6167
196 Ga0495678_005407 3300049459 Bacteria 7057
197 Ga0501034_0059705 3300049571 Bacteria 3830
198 Ga0501047_0118608 3300049581 Unclassified 2528
199 Ga0500608_001643 3300053122 Bacteria 8034
200 Ga0500618_000037 3300053125 Bacteria 117320
201 Ga0500559_0069347 3300053136 Bacteria 1585
202 Ga0500624_000530 3300053157 Bacteria 10893

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10056039 Ga0105237_100560395 397
2 3300010375 Ga0105239_10051698 Ga0105239_100516982 397
3 3300031251 Ga0265327_10000285 Ga0265327_1000028581 398
4 3300009093 Ga0105240_10114637 Ga0105240_101146372 409
5 3300046518 Ga0495631_0012131 Ga0495631_0012131_255_1631 417
6 3300049571 Ga0501034_0059705 Ga0501034_0059705_792_2168 419
7 3300049581 Ga0501047_0118608 Ga0501047_0118608_971_2347 419
8 3300037312 Ga0395899_0000017 Ga0395899_0000017_96008_97360 420
9 3300025272 Ga0209455_1011257 Ga0209455_10112572 425
10 3300013306 Ga0163162_10000031 Ga0163162_1000003152 426
11 3300037418 Ga0395900_0000128 Ga0395900_0000128_113697_115085 427
12 3300048927 Ga0496124_0020191 Ga0496124_0020191_488_1834 428
13 3300003320 rootH2_10044515 rootH2_100445155 429
14 3300003316 rootH1_10074478 rootH1_100744784 432
15 3300025261 Ga0209233_1005605 Ga0209233_10056054 432
16 3300025914 Ga0207671_10005361 Ga0207671_100053612 432
17 3300053122 Ga0500608_001643 Ga0500608_001643_4586_5923 432
18 3300053125 Ga0500618_000037 Ga0500618_000037_12582_13973 433
19 3300009174 Ga0105241_10024255 Ga0105241_100242553 434
20 3300010375 Ga0105239_10096725 Ga0105239_100967253 434
21 3300010375 Ga0105239_10000162 Ga0105239_1000016262 435
22 3300013104 Ga0157370_10016508 Ga0157370_100165085 436
23 iso_pu_bacteria 2919437846 2919439864 436
24 3300005458 Ga0070681_10008778 Ga0070681_100087785 437
25 3300009093 Ga0105240_10080032 Ga0105240_100800322 437
26 3300025912 Ga0207707_10023588 Ga0207707_100235882 437
27 3300025917 Ga0207660_10014223 Ga0207660_100142236 437
28 3300005563 Ga0068855_100382855 Ga0068855_1003828552 438
29 3300002737 JGI25162J39368_1001031 JGI25162J39368_10010312 439
30 3300003214 JGI25165J46597_1000869 JGI25165J46597_10008699 439
31 3300003320 rootH2_10022503 rootH2_100225034 439
32 3300005563 Ga0068855_100000226 Ga0068855_10000022668 439
33 3300025231 Ga0207427_100085 Ga0207427_1000856 439
34 3300025233 Ga0209437_100052 Ga0209437_100052238 439
35 3300025261 Ga0209233_1000067 Ga0209233_1000067238 439
36 3300025914 Ga0207671_10012941 Ga0207671_100129417 439
37 3300025949 Ga0207667_10000039 Ga0207667_10000039129 439
38 3300005614 Ga0068856_100017009 Ga0068856_1000170093 440
39 3300005614 Ga0068856_100069380 Ga0068856_1000693802 440
40 3300009093 Ga0105240_10087953 Ga0105240_100879533 440
41 3300025913 Ga0207695_10137776 Ga0207695_101377763 440
42 3300026078 Ga0207702_10021697 Ga0207702_100216972 440
43 3300047472 Ga0495686_0015155 Ga0495686_0015155_1724_3082 440
44 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005139 441
45 3300003323 rootH1_10087397 rootH1_100873972 441
46 3300009545 Ga0105237_10001914 Ga0105237_1000191420 441
47 3300010375 Ga0105239_10000013 Ga0105239_1000001313 441
48 3300013105 Ga0157369_10053743 Ga0157369_100537433 441
49 3300013307 Ga0157372_10000874 Ga0157372_1000087424 441
50 3300009093 Ga0105240_10000294 Ga0105240_1000029430 442
51 3300009545 Ga0105237_10000109 Ga0105237_1000010921 442
52 3300009551 Ga0105238_10025080 Ga0105238_100250802 442
53 3300025913 Ga0207695_10000142 Ga0207695_10000142146 442
54 3300025914 Ga0207671_10000110 Ga0207671_10000110127 442
55 3300025924 Ga0207694_10097980 Ga0207694_100979802 442
56 3300028800 Ga0265338_10113214 Ga0265338_101132142 442
57 3300013104 Ga0157370_10002867 Ga0157370_100028672 443
58 3300014497 Ga0182008_10000565 Ga0182008_1000056527 443
59 3300015261 Ga0182006_1001374 Ga0182006_10013746 443
60 3300017792 Ga0163161_10018532 Ga0163161_100185322 443
61 3300048925 Ga0496122_0001708 Ga0496122_0001708_18228_19619 443
62 3300048926 Ga0496123_0004392 Ga0496123_0004392_11917_13308 443
63 3300001990 JGI24737J22298_10013459 JGI24737J22298_100134592 444
64 3300003320 rootH2_10002814 rootH2_1000281429 444
65 3300005328 Ga0070676_10003202 Ga0070676_100032022 444
66 3300005364 Ga0070673_100022762 Ga0070673_1000227625 444
67 3300005456 Ga0070678_100007302 Ga0070678_1000073024 444
68 3300005457 Ga0070662_100000032 Ga0070662_10000003232 444
69 3300005616 Ga0068852_100006795 Ga0068852_1000067955 444
70 3300006237 Ga0097621_100000827 Ga0097621_10000082721 444
71 3300006358 Ga0068871_100001149 Ga0068871_10000114912 444
72 3300006881 Ga0068865_100000574 Ga0068865_1000005745 444
73 3300009093 Ga0105240_10058999 Ga0105240_100589992 444
74 3300009174 Ga0105241_10000398 Ga0105241_1000039825 444
75 3300009174 Ga0105241_10032645 Ga0105241_100326452 444
76 3300009176 Ga0105242_10020317 Ga0105242_100203172 444
77 3300010375 Ga0105239_10017010 Ga0105239_100170105 444
78 3300010375 Ga0105239_10045225 Ga0105239_100452255 444
79 3300013100 Ga0157373_10063754 Ga0157373_100637542 444
80 3300013102 Ga0157371_10015316 Ga0157371_100153166 444
81 3300013105 Ga0157369_10042719 Ga0157369_100427193 444
82 3300013296 Ga0157374_10001012 Ga0157374_1000101220 444
83 3300013296 Ga0157374_10002228 Ga0157374_1000222813 444
84 3300013307 Ga0157372_10073688 Ga0157372_100736883 444
85 3300025904 Ga0207647_10000948 Ga0207647_100009489 444
86 3300025907 Ga0207645_10000082 Ga0207645_1000008217 444
87 3300025911 Ga0207654_10003575 Ga0207654_100035752 444
88 3300025911 Ga0207654_10018119 Ga0207654_100181192 444
89 3300025913 Ga0207695_10030109 Ga0207695_100301096 444
90 3300025914 Ga0207671_10052693 Ga0207671_100526932 444
91 3300025932 Ga0207690_10063873 Ga0207690_100638732 444
92 3300025933 Ga0207706_10000191 Ga0207706_1000019138 444
93 3300025938 Ga0207704_10000053 Ga0207704_1000005365 444
94 3300025960 Ga0207651_10003179 Ga0207651_100031797 444
95 3300026023 Ga0207677_10066941 Ga0207677_100669412 444
96 3300026041 Ga0207639_10052007 Ga0207639_100520072 444
97 3300026089 Ga0207648_10009920 Ga0207648_100099203 444
98 3300026121 Ga0207683_10015163 Ga0207683_100151634 444
99 3300026142 Ga0207698_10003515 Ga0207698_100035153 444
100 3300047443 Ga0495687_000552 Ga0495687_000552_33238_34614 444
101 iso_pu_bacteria 2818991444 2819587310 444
102 3300003323 rootH1_10103532 rootH1_101035321 445
103 3300005539 Ga0068853_100047010 Ga0068853_1000470102 445
104 3300005563 Ga0068855_100113699 Ga0068855_1001136991 445
105 3300009093 Ga0105240_10085008 Ga0105240_100850082 445
106 3300025913 Ga0207695_10004328 Ga0207695_100043288 445
107 3300025949 Ga0207667_10006347 Ga0207667_100063474 445
108 3300026041 Ga0207639_10031156 Ga0207639_100311563 445
109 3300028786 Ga0307517_10007927 Ga0307517_1000792712 445
110 3300033180 Ga0307510_10021552 Ga0307510_100215525 445
111 3300037312 Ga0395899_0000312 Ga0395899_0000312_57433_58809 445
112 3300037418 Ga0395900_0000014 Ga0395900_0000014_74794_76170 445
113 3300037466 Ga0395898_0022234 Ga0395898_0022234_4399_5775 445
114 3300037471 Ga0395905_0000037 Ga0395905_0000037_74784_76160 445
115 3300038443 Ga0395901_0000166 Ga0395901_0000166_74648_76024 445
116 3300042005 Ga0439448_0007477 Ga0439448_0007477_507_1883 445
117 3300046660 Ga0495625_0037377 Ga0495625_0037377_1796_3175 445
118 3300005548 Ga0070665_100000003 Ga0070665_100000003642 446
119 3300013308 Ga0157375_10082580 Ga0157375_100825804 446
120 3300028379 Ga0268266_10000052 Ga0268266_10000052233 446
121 iso_pu_bacteria 2818991442 2819576196 446
122 iso_pu_bacteria 2821136567 2821142423 446
123 iso_pu_bacteria 2904467357 2904470410 446
124 3300005339 Ga0070660_100008880 Ga0070660_1000088802 447
125 3300005366 Ga0070659_100000016 Ga0070659_10000001672 447
126 3300015265 Ga0182005_1000290 Ga0182005_100029019 447
127 3300025302 Ga0207426_1016190 Ga0207426_10161902 447
128 3300025919 Ga0207657_10021261 Ga0207657_100212615 447
129 3300025932 Ga0207690_10000495 Ga0207690_1000049517 447
130 3300048924 Ga0496121_0000011 Ga0496121_0000011_304968_306377 447
131 iso_pu_bacteria 2738541283 2738756300 447
132 iso_pu_bacteria 2857627736 2857632637 447
133 iso_pu_bacteria 2977232053 2977236600 447
134 3300001990 JGI24737J22298_10003557 JGI24737J22298_100035572 448
135 3300005842 Ga0068858_100019093 Ga0068858_1000190934 448
136 3300013100 Ga0157373_10004610 Ga0157373_100046102 448
137 3300013102 Ga0157371_10000155 Ga0157371_1000015535 448
138 3300013104 Ga0157370_10005261 Ga0157370_100052618 448
139 3300013306 Ga0163162_10006055 Ga0163162_100060555 448
140 3300013307 Ga0157372_10003009 Ga0157372_100030097 448
141 3300025261 Ga0209233_1000495 Ga0209233_10004957 448
142 3300025904 Ga0207647_10000207 Ga0207647_100002072 448
143 3300025932 Ga0207690_10014207 Ga0207690_100142072 448
144 3300026035 Ga0207703_10026721 Ga0207703_100267212 448
145 3300046513 Ga0495616_0001519 Ga0495616_0001519_4524_5906 448
146 3300049459 Ga0495678_005407 Ga0495678_005407_4739_6121 448
147 3300053136 Ga0500559_0069347 Ga0500559_0069347_87_1472 448
148 iso_pu_bacteria 2599185184 2599480004 448
149 iso_pu_bacteria 2928078545 2928081135 448
150 iso_pu_bacteria 2928147474 2928152444 448
151 iso_pu_bacteria 2932082852 2932087785 448
152 3300003323 rootH1_10003212 rootH1_1000321279 449
153 3300005327 Ga0070658_10000011 Ga0070658_1000001179 449
154 3300005530 Ga0070679_100082294 Ga0070679_1000822942 449
155 3300005563 Ga0068855_100005580 Ga0068855_10000558012 449
156 3300005563 Ga0068855_100009512 Ga0068855_1000095128 449
157 3300005614 Ga0068856_100000262 Ga0068856_10000026223 449
158 3300009545 Ga0105237_10003009 Ga0105237_100030091 449
159 3300013296 Ga0157374_10020201 Ga0157374_100202012 449
160 3300025909 Ga0207705_10000015 Ga0207705_1000001579 449
161 3300025921 Ga0207652_10175749 Ga0207652_101757492 449
162 3300025949 Ga0207667_10000896 Ga0207667_1000089612 449
163 3300025949 Ga0207667_10009992 Ga0207667_100099922 449
164 3300026078 Ga0207702_10000492 Ga0207702_100004926 449
165 3300037418 Ga0395900_0007404 Ga0395900_0007404_1541_2929 449
166 3300037471 Ga0395905_0002800 Ga0395905_0002800_8332_9720 449
167 3300038443 Ga0395901_0054083 Ga0395901_0054083_1254_2642 449
168 3300002741 JGI25157J39369_1002587 JGI25157J39369_10025875 450
169 3300005329 Ga0070683_100012824 Ga0070683_1000128242 450
170 3300005535 Ga0070684_100120506 Ga0070684_1001205062 450
171 3300013100 Ga0157373_10000087 Ga0157373_100000874 450
172 3300013307 Ga0157372_10002085 Ga0157372_1000208513 450
173 3300025250 Ga0209026_1000840 Ga0209026_100084010 450
174 3300025250 Ga0209026_1005609 Ga0209026_10056093 450
175 3300046660 Ga0495625_0008344 Ga0495625_0008344_6862_8250 450
176 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008162 451
177 3300003781 Ga0055536_1000001 Ga0055536_100000185 451
178 3300005563 Ga0068855_100025360 Ga0068855_1000253602 451
179 3300006237 Ga0097621_100084574 Ga0097621_1000845742 451
180 3300009545 Ga0105237_10006380 Ga0105237_100063807 451
181 3300009545 Ga0105237_10010022 Ga0105237_100100222 451
182 3300010375 Ga0105239_10000068 Ga0105239_10000068131 451
183 3300010375 Ga0105239_10002839 Ga0105239_100028394 451
184 3300013105 Ga0157369_10002036 Ga0157369_1000203617 451
185 3300013307 Ga0157372_10000400 Ga0157372_1000040028 451
186 3300015261 Ga0182006_1000168 Ga0182006_100016813 451
187 3300025233 Ga0209437_100030 Ga0209437_100030228 451
188 3300025292 Ga0209676_1000008 Ga0209676_1000008772 451
189 3300025298 Ga0209050_1000045 Ga0209050_100004513 451
190 3300025949 Ga0207667_10042272 Ga0207667_100422722 451
191 3300028794 Ga0307515_10001997 Ga0307515_1000199736 451
192 3300037312 Ga0395899_0000055 Ga0395899_0000055_15985_17376 451
193 3300044684 Ga0466966_0024424 Ga0466966_0024424_2120_3511 451
194 3300046492 Ga0495585_0000553 Ga0495585_0000553_29422_30813 451
195 3300046524 Ga0495648_0007640 Ga0495648_0007640_4440_5831 451
196 3300046616 Ga0495668_0000032 Ga0495668_0000032_69242_70633 451
197 3300046660 Ga0495625_0001038 Ga0495625_0001038_30587_31978 451
198 3300047472 Ga0495686_0000098 Ga0495686_0000098_159281_160672 451
199 3300047472 Ga0495686_0001801 Ga0495686_0001801_16929_18320 451
200 3300053157 Ga0500624_000530 Ga0500624_000530_8711_10102 451
201 3300001979 JGI24740J21852_10013928 JGI24740J21852_100139283 452
202 3300013102 Ga0157371_10059525 Ga0157371_100595252 452
203 3300013104 Ga0157370_10238890 Ga0157370_102388902 452
204 3300046471 Ga0495650_0000050 Ga0495650_0000050_52493_53887 452
205 3300046492 Ga0495585_0000198 Ga0495585_0000198_11788_13182 452
206 3300046506 Ga0495583_0022419 Ga0495583_0022419_131_1525 452
207 3300046512 Ga0495610_0001134 Ga0495610_0001134_19175_20611 452
208 3300046513 Ga0495616_0003999 Ga0495616_0003999_5775_7169 452
209 3300046520 Ga0495637_0063232 Ga0495637_0063232_18_1454 452
210 3300046538 Ga0495609_0011754 Ga0495609_0011754_2131_3525 452
211 3300046558 Ga0495633_0009063 Ga0495633_0009063_925_2361 452
212 3300046660 Ga0495625_0000105 Ga0495625_0000105_85879_87273 452
213 3300046665 Ga0495661_0011911 Ga0495661_0011911_872_2266 452
214 3300046694 Ga0495649_0000011 Ga0495649_0000011_38785_40179 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

285

472

0.97

PF02321

OEP

Outer membrane efflux protein

53

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.785 32 441
1yc9-assembly1.cif.gz_A the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution 0.7709 32 441
4mt4-assembly1.cif.gz_C crystal structure of the campylobacter jejuni cmec outer membrane channel 0.7662 32 444
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.7639 32 440
5azs-assembly1.cif.gz_C crystal structure of a membrane protein from pseudomonas aeruginosa 0.7558 32 440
ID Description Score Start End Superfamily
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9087 367 435 1.10.287.470
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8965 367 435 1.10.287.470
2f1mA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8746 367 435 1.10.287.470
2f1mB03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8474 367 435 1.10.287.470
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8417 367 435 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A841MXC2-F1-model_v4 deleted 0.8645 267 449
AF-A0A7X7XGQ2-F1-model_v4 TolC family protein 0.8446 27 444 GO:0015562
AF-A0A651HHT1-F1-model_v4 TolC family protein 0.842 30 444 GO:0015562
AF-A0A1C4DGW6-F1-model_v4 Outer membrane protein TolC 0.8391 27 451 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A646MR91-F1-model_v4 deleted 0.8384 131 452

Feature Viewer

pLDDT pTM Quality
76.68 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map