F324376

General Info

Members Datasets Scaffolds Average Seq Length
213 112 180 230

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0276540|Ga0495603_0276540_175_912
Length 245
Sequence MNTKMTNTKKKTARTTLPPGIGKVLKRLHHPLDVILLCVRWYVAYSLSLRNLEEMMAERGLEIDHSSVHRWVIKLVPLFEKAFRKHKRPVGKSWRMDETYVKVRGQWKYLYRAVDKAGNTVEFLLRAHRDKAAARRYFEKAIDRNGEPKTITVDKSGANLAALEALNADRSTPIKVRQSKYLNNVVEQDHRAIKRIIKPMMGFKDFRCARIILAGIEVMHMIRKGQMRDDGIARNPAEQFYSVVI

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2527291627 Frankia casuarinae Thr Isolate Nodule
5 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2619619003 Frankia sp. CpI1-P Isolate Nodule
8 2687453737 Frankia sp. BMG5.36 Isolate Nodule
9 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
10 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
11 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
12 2773857924 Frankia sp. CgIS1 Isolate Nodule
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
15 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
16 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
42 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
43 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
44 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
45 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
46 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
47 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
48 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
49 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
50 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
51 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
52 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
53 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
54 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
58 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
59 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
70 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
71 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
88 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
89 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
111 637000116 Frankia casuarinae CcI3 Isolate Nodule
112 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.98
Metatranscriptomes 0
Isolates 15.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 6.1
Rhizoplane 9.39
Rhizosphere 79.34
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10047720 3300001989 Bacteria 1396
2 Ga0070687_100312916 3300005343 Bacteria 1000
3 Ga0070700_100265433 3300005441 Unclassified 1238
4 Ga0070686_100586865 3300005544 Unclassified 876
5 Ga0068862_100259233 3300005844 Bacteria 1587
6 Ga0081455_10113600 3300005937 Bacteria 2148
7 Ga0075431_100363361 3300006847 Bacteria 1453
8 Ga0105251_10110143 3300009011 Bacteria 1255
9 Ga0105245_10438620 3300009098 Bacteria 1312
10 Ga0163162_11064370 3300013306 Unclassified 916
11 Ga0207681_10793241 3300025923 Unclassified 791
12 Ga0207703_10825206 3300026035 Bacteria 886
13 Ga0207708_10241567 3300026075 Bacteria 1453
14 Ga0268265_10668063 3300028380 Unclassified 1000
15 Ga0265316_10323646 3300031344 Bacteria 1120
16 Ga0307408_100840721 3300031548 Bacteria 836
17 Ga0307405_10283500 3300031731 Bacteria 1248
18 Ga0307413_10304466 3300031824 Bacteria 1210
19 Ga0307412_10392921 3300031911 Bacteria 1127
20 Ga0307409_100168054 3300031995 Bacteria 1927
21 Ga0307416_100002694 3300032002 Bacteria 10289
22 Ga0395900_0281517 3300037418 Bacteria 1655
23 Ga0395898_0121260 3300037466 Bacteria 2505
24 Ga0395901_0436675 3300038443 Bacteria 1340
25 Ga0495603_0021356 3300046455 Bacteria 3920
26 Ga0495603_0273413 3300046455 Bacteria 971
27 Ga0495603_0276540 3300046455 Bacteria 965
28 Ga0495590_0018865 3300046457 Bacteria 2464
29 Ga0495590_0023577 3300046457 Bacteria 2171
30 Ga0495590_0140880 3300046457 Bacteria 870
31 Ga0495629_0006912 3300046459 Bacteria 8371
32 Ga0495629_0313793 3300046459 Bacteria 1072
33 Ga0495638_0143200 3300046460 Bacteria 1393
34 Ga0495653_0008577 3300046463 Bacteria 8379
35 Ga0495653_0023351 3300046463 Bacteria 4998
36 Ga0495650_0002493 3300046471 Bacteria 14789
37 Ga0495580_0001988 3300046472 Bacteria 17988
38 Ga0495580_0002902 3300046472 Bacteria 14733
39 Ga0495580_0005155 3300046472 Bacteria 10871
40 Ga0495580_0020127 3300046472 Bacteria 4945
41 Ga0495580_0029651 3300046472 Bacteria 3969
42 Ga0495580_0033165 3300046472 Bacteria 3721
43 Ga0495580_0055660 3300046472 Bacteria 2786
44 Ga0495580_0211191 3300046472 Bacteria 1335
45 Ga0495580_0372412 3300046472 Bacteria 965
46 Ga0495582_0465147 3300046473 Bacteria 730
47 Ga0495605_0014755 3300046474 Bacteria 4267
48 Ga0495605_0029014 3300046474 Bacteria 2852
49 Ga0495605_0045184 3300046474 Bacteria 2172
50 Ga0495605_0109920 3300046474 Bacteria 1259
51 Ga0495664_0096660 3300046477 Bacteria 1778
52 Ga0495583_0050030 3300046506 Bacteria 1911
53 Ga0495583_0091191 3300046506 Bacteria 1311
54 Ga0495610_0120516 3300046512 Bacteria 1150
55 Ga0495616_0071473 3300046513 Bacteria 1678
56 Ga0495616_0141928 3300046513 Bacteria 1093
57 Ga0495618_0003243 3300046514 Bacteria 10189
58 Ga0495628_0002690 3300046516 Bacteria 15898
59 Ga0495628_0079211 3300046516 Bacteria 2554
60 Ga0495630_0390296 3300046517 Bacteria 1066
61 Ga0495631_0294461 3300046518 Bacteria 691
62 Ga0495643_0011916 3300046522 Bacteria 5266
63 Ga0495648_0003687 3300046524 Bacteria 13391
64 Ga0495648_0016918 3300046524 Bacteria 5239
65 Ga0495648_0026219 3300046524 Bacteria 3927
66 Ga0495648_0060774 3300046524 Bacteria 2246
67 Ga0495648_0074010 3300046524 Bacteria 1964
68 Ga0495648_0087573 3300046524 Bacteria 1753
69 Ga0495648_0271365 3300046524 Bacteria 808
70 Ga0495648_0352069 3300046524 Bacteria 672
71 Ga0495666_0170188 3300046526 Bacteria 1008
72 Ga0495642_0007350 3300046528 Bacteria 4226
73 Ga0495642_0144392 3300046528 Bacteria 1028
74 Ga0495652_0001537 3300046529 Bacteria 25329
75 Ga0495665_0000289 3300046531 Bacteria 25499
76 Ga0495665_0026461 3300046531 Bacteria 3115
77 Ga0495665_0056745 3300046531 Bacteria 2067
78 Ga0495665_0059037 3300046531 Bacteria 2025
79 Ga0495665_0167975 3300046531 Bacteria 1142
80 Ga0495586_0000513 3300046535 Bacteria 22869
81 Ga0495586_0127612 3300046535 Bacteria 1423
82 Ga0495587_0026125 3300046536 Bacteria 3562
83 Ga0495645_0145862 3300046543 Bacteria 1648
84 Ga0495634_0249487 3300046642 Bacteria 1086
85 Ga0495635_0372091 3300046663 Bacteria 951
86 Ga0495661_0071512 3300046665 Bacteria 2027
87 Ga0495599_0171977 3300046678 Bacteria 1336
88 Ga0495599_0257315 3300046678 Bacteria 1061
89 Ga0495646_0002596 3300046680 Bacteria 11133
90 Ga0495646_0146659 3300046680 Bacteria 1315
91 Ga0495646_0248846 3300046680 Bacteria 953
92 Ga0495646_0444881 3300046680 Bacteria 670
93 Ga0495624_0000496 3300046690 Bacteria 30665
94 Ga0495624_0006364 3300046690 Bacteria 8385
95 Ga0495649_0151722 3300046694 Bacteria 1217
96 Ga0495589_0066365 3300046794 Bacteria 1767
97 Ga0495589_0081530 3300046794 Bacteria 1574
98 Ga0495600_0284434 3300046809 Bacteria 1046
99 Ga0495660_0185633 3300046810 Bacteria 1003
100 Ga0495660_0202101 3300046810 Bacteria 948
101 Ga0495581_0118764 3300047315 Bacteria 1538
102 Ga0495674_0012782 3300047319 Bacteria 7905
103 Ga0495674_0013038 3300047319 Bacteria 7824
104 Ga0495674_0060629 3300047319 Bacteria 3301
105 Ga0495674_0073394 3300047319 Bacteria 2949
106 Ga0495674_0074952 3300047319 Bacteria 2912
107 Ga0495674_0281778 3300047319 Bacteria 1361
108 Ga0495672_0001512 3300047320 Bacteria 22782
109 Ga0495672_0029937 3300047320 Bacteria 3422
110 Ga0495672_0061177 3300047320 Bacteria 2171
111 Ga0495672_0087036 3300047320 Bacteria 1726
112 Ga0495672_0135717 3300047320 Bacteria 1290
113 Ga0495672_0233553 3300047320 Bacteria 901
114 Ga0495676_0295223 3300047321 Bacteria 1094
115 Ga0495676_0492158 3300047321 Bacteria 805
116 Ga0495680_0085398 3300047322 Bacteria 2376
117 Ga0495680_0514805 3300047322 Bacteria 810
118 Ga0495683_0008043 3300047323 Bacteria 5660
119 Ga0495683_0016341 3300047323 Bacteria 3855
120 Ga0495683_0028748 3300047323 Bacteria 2841
121 Ga0495683_0030788 3300047323 Bacteria 2736
122 Ga0495683_0031473 3300047323 Bacteria 2704
123 Ga0495683_0191788 3300047323 Bacteria 926
124 Ga0495687_061046 3300047443 Bacteria 1552
125 Ga0495687_069995 3300047443 Bacteria 1410
126 Ga0495687_142897 3300047443 Bacteria 829
127 Ga0495675_0159096 3300047444 Bacteria 1392
128 Ga0495675_0192442 3300047444 Bacteria 1244
129 Ga0495677_0026504 3300047445 Bacteria 2103
130 Ga0495677_0131269 3300047445 Bacteria 959
131 Ga0495679_002757 3300047446 Bacteria 8744
132 Ga0495679_130272 3300047446 Bacteria 683
133 Ga0495685_035189 3300047447 Bacteria 1721
134 Ga0495685_141105 3300047447 Bacteria 785
135 Ga0495673_0026150 3300047469 Bacteria 2794
136 Ga0495673_0026870 3300047469 Bacteria 2745
137 Ga0495673_0037521 3300047469 Bacteria 2212
138 Ga0495673_0051209 3300047469 Bacteria 1809
139 Ga0495673_0157091 3300047469 Bacteria 875
140 Ga0495673_0209977 3300047469 Bacteria 725
141 Ga0495681_0130230 3300047470 Bacteria 1071
142 Ga0495686_0028210 3300047472 Bacteria 3657
143 Ga0495593_0004408 3300047673 Bacteria 8366
144 Ga0495602_0065271 3300048088 Bacteria 3142
145 Ga0495614_0032306 3300048089 Bacteria 2252
146 Ga0495626_0025601 3300048091 Bacteria 2884
147 Ga0496100_0055124 3300048903 Bacteria 2596
148 Ga0496100_0440480 3300048903 Bacteria 997
149 Ga0496101_0081681 3300048904 Bacteria 2391
150 Ga0496101_0270889 3300048904 Bacteria 1325
151 Ga0496103_0326866 3300048906 Bacteria 986
152 Ga0496103_0539056 3300048906 Bacteria 745
153 Ga0496104_0017290 3300048907 Bacteria 6563
154 Ga0496104_0251400 3300048907 Bacteria 1680
155 Ga0496104_0676241 3300048907 Bacteria 940
156 Ga0496105_0015420 3300048908 Bacteria 6090
157 Ga0496105_0025933 3300048908 Bacteria 4775
158 Ga0496105_0327341 3300048908 Bacteria 1227
159 Ga0496105_0494780 3300048908 Bacteria 960
160 Ga0496106_0001762 3300048909 Bacteria 16157
161 Ga0496112_0655873 3300048915 Bacteria 979
162 Ga0496113_0007087 3300048916 Bacteria 7175
163 Ga0496113_0154206 3300048916 Bacteria 1813
164 Ga0496115_0586801 3300048918 Bacteria 887
165 Ga0496120_0233310 3300048923 Bacteria 873
166 Ga0496121_0006038 3300048924 Bacteria 15260
167 Ga0496121_0020913 3300048924 Bacteria 6442
168 Ga0496121_0026554 3300048924 Bacteria 5450
169 Ga0496121_0042882 3300048924 Bacteria 3927
170 Ga0496121_0090012 3300048924 Bacteria 2400
171 Ga0495678_172917 3300049459 Bacteria 682
172 Ga0495682_0000873 3300049460 Bacteria 18718
173 Ga0495682_0012906 3300049460 Bacteria 3189
174 Ga0495682_0015542 3300049460 Bacteria 2884
175 Ga0495682_0031641 3300049460 Bacteria 1955
176 Ga0495682_0099867 3300049460 Bacteria 1040
177 nmdc:mga06r32_356754_c1 3300050510 Bacteria 1446
178 nmdc:mga06r32_447307_c1 3300050510 Bacteria 1272
179 nmdc:mga08y16_71961_c1 3300050511 Bacteria 3603
180 Ga0495655_0120670 3300053083 Bacteria 797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2562617112 2563064534 186
2 3300046474 Ga0495605_0109920 Ga0495605_0109920_94_885 191
3 3300046513 Ga0495616_0141928 Ga0495616_0141928_169_882 191
4 3300046522 Ga0495643_0011916 Ga0495643_0011916_2331_3044 191
5 3300046528 Ga0495642_0007350 Ga0495642_0007350_3123_3836 191
6 iso_pu_bacteria 2546825537 2546951658 193
7 3300047447 Ga0495685_035189 Ga0495685_035189_615_1328 194
8 iso_pu_bacteria 2904615490 2904625473 196
9 3300047446 Ga0495679_130272 Ga0495679_130272_30_626 198
10 iso_pu_bacteria 2527291627 2528206841 198
11 iso_pu_bacteria 2546825537 2546950545 198
12 iso_pu_bacteria 2773857924 2774866466 198
13 iso_pu_bacteria 637000116 637879116 198
14 3300046473 Ga0495582_0465147 Ga0495582_0465147_88_690 199
15 3300046455 Ga0495603_0021356 Ga0495603_0021356_3287_3895 202
16 3300046460 Ga0495638_0143200 Ga0495638_0143200_183_791 202
17 3300046472 Ga0495580_0002902 Ga0495580_0002902_13975_14583 202
18 3300046526 Ga0495666_0170188 Ga0495666_0170188_125_733 202
19 3300046680 Ga0495646_0444881 Ga0495646_0444881_28_636 202
20 3300047323 Ga0495683_0008043 Ga0495683_0008043_2752_3360 202
21 3300047443 Ga0495687_061046 Ga0495687_061046_856_1464 202
22 3300048924 Ga0496121_0020913 Ga0496121_0020913_4602_5210 202
23 3300046514 Ga0495618_0003243 Ga0495618_0003243_9532_10143 203
24 3300046543 Ga0495645_0145862 Ga0495645_0145862_1010_1621 203
25 3300047319 Ga0495674_0013038 Ga0495674_0013038_4572_5246 203
26 3300047322 Ga0495680_0514805 Ga0495680_0514805_172_783 203
27 3300047469 Ga0495673_0209977 Ga0495673_0209977_89_700 203
28 3300048906 Ga0496103_0539056 Ga0496103_0539056_30_641 203
29 3300049459 Ga0495678_172917 Ga0495678_172917_16_627 203
30 iso_pu_bacteria 8003955200 8003963190 203
31 3300005844 Ga0068862_100259233 Ga0068862_1002592331 204
32 3300025923 Ga0207681_10793241 Ga0207681_107932411 204
33 iso_pu_bacteria 2510065045 2510246087 205
34 iso_pu_bacteria 2718217991 2719637459 205
35 3300046459 Ga0495629_0006912 Ga0495629_0006912_1739_2365 207
36 3300046463 Ga0495653_0008577 Ga0495653_0008577_6013_6639 207
37 3300046472 Ga0495580_0055660 Ga0495580_0055660_1911_2537 207
38 3300046516 Ga0495628_0002690 Ga0495628_0002690_6070_6696 207
39 3300046524 Ga0495648_0352069 Ga0495648_0352069_27_650 207
40 3300046531 Ga0495665_0026461 Ga0495665_0026461_1204_1830 207
41 3300046531 Ga0495665_0059037 Ga0495665_0059037_24_647 207
42 3300046680 Ga0495646_0002596 Ga0495646_0002596_5933_6559 207
43 3300046690 Ga0495624_0006364 Ga0495624_0006364_6013_6639 207
44 3300047319 Ga0495674_0073394 Ga0495674_0073394_1475_2101 207
45 3300047673 Ga0495593_0004408 Ga0495593_0004408_1747_2373 207
46 iso_pu_bacteria 2711768613 2713472915 208
47 iso_pu_bacteria 2904615490 2904616489 209
48 iso_pu_bacteria 2619619003 2620352655 210
49 iso_pu_bacteria 2895880812 2895891042 210
50 3300046457 Ga0495590_0023577 Ga0495590_0023577_686_1324 211
51 3300046518 Ga0495631_0294461 Ga0495631_0294461_14_652 211
52 3300046680 Ga0495646_0248846 Ga0495646_0248846_303_941 211
53 3300047447 Ga0495685_141105 Ga0495685_141105_12_650 211
54 3300048904 Ga0496101_0081681 Ga0496101_0081681_1102_1740 212
55 3300048906 Ga0496103_0326866 Ga0496103_0326866_197_850 212
56 3300048907 Ga0496104_0251400 Ga0496104_0251400_653_1318 212
57 3300048908 Ga0496105_0327341 Ga0496105_0327341_350_988 212
58 3300048924 Ga0496121_0006038 Ga0496121_0006038_9196_9834 212
59 3300046457 Ga0495590_0140880 Ga0495590_0140880_45_689 214
60 3300047445 Ga0495677_0131269 Ga0495677_0131269_16_660 214
61 iso_pu_bacteria 2687453737 2689956525 217
62 3300046663 Ga0495635_0372091 Ga0495635_0372091_265_921 218
63 3300031344 Ga0265316_10323646 Ga0265316_103236462 222
64 3300005441 Ga0070700_100265433 Ga0070700_1002654331 223
65 3300026035 Ga0207703_10825206 Ga0207703_108252061 223
66 3300005937 Ga0081455_10113600 Ga0081455_101136001 224
67 3300006847 Ga0075431_100363361 Ga0075431_1003633612 224
68 3300013306 Ga0163162_11064370 Ga0163162_110643702 224
69 3300026075 Ga0207708_10241567 Ga0207708_102415672 224
70 3300028380 Ga0268265_10668063 Ga0268265_106680631 224
71 3300031548 Ga0307408_100840721 Ga0307408_1008407211 224
72 3300047472 Ga0495686_0028210 Ga0495686_0028210_218_910 224
73 3300050510 nmdc:mga06r32_356754_c1 nmdc:mga06r32_356754_c1_308_985 224
74 3300050510 nmdc:mga06r32_447307_c1 nmdc:mga06r32_447307_c1_264_941 224
75 3300050511 nmdc:mga08y16_71961_c1 nmdc:mga08y16_71961_c1_1364_2041 224
76 3300005343 Ga0070687_100312916 Ga0070687_1003129161 225
77 3300005544 Ga0070686_100586865 Ga0070686_1005868651 225
78 iso_pu_bacteria 2718217991 2719642535 228
79 iso_pu_bacteria 2921643360 2921656991 228
80 3300046517 Ga0495630_0390296 Ga0495630_0390296_219_911 229
81 3300046524 Ga0495648_0087573 Ga0495648_0087573_259_948 229
82 3300049460 Ga0495682_0031641 Ga0495682_0031641_766_1455 229
83 iso_pu_bacteria 2513237082 2513558585 229
84 3300046477 Ga0495664_0096660 Ga0495664_0096660_567_1274 234
85 3300047319 Ga0495674_0012782 Ga0495674_0012782_125_832 234
86 3300046512 Ga0495610_0120516 Ga0495610_0120516_404_1123 235
87 3300046794 Ga0495589_0066365 Ga0495589_0066365_479_1198 235
88 3300046810 Ga0495660_0202101 Ga0495660_0202101_24_743 235
89 3300047320 Ga0495672_0233553 Ga0495672_0233553_112_831 235
90 3300047445 Ga0495677_0026504 Ga0495677_0026504_1082_1801 235
91 3300047469 Ga0495673_0051209 Ga0495673_0051209_935_1654 235
92 3300048091 Ga0495626_0025601 Ga0495626_0025601_749_1468 235
93 3300048915 Ga0496112_0655873 Ga0496112_0655873_228_947 235
94 iso_pu_bacteria 2902682994 2902686820 235
95 3300048907 Ga0496104_0017290 Ga0496104_0017290_4576_5286 236
96 3300048908 Ga0496105_0025933 Ga0496105_0025933_1216_1926 236
97 3300048916 Ga0496113_0007087 Ga0496113_0007087_973_1683 236
98 iso_pu_bacteria 2562617112 2563064028 236
99 iso_pu_bacteria 2562617112 2563064418 236
100 iso_pu_bacteria 2711768613 2713472303 236
101 iso_pu_bacteria 2711768613 2713472714 236
102 iso_pu_bacteria 2711768613 2713472823 236
103 iso_pu_bacteria 2711768613 2713472835 236
104 3300046474 Ga0495605_0014755 Ga0495605_0014755_83_796 237
105 3300046506 Ga0495583_0050030 Ga0495583_0050030_225_938 237
106 3300046524 Ga0495648_0060774 Ga0495648_0060774_1478_2191 237
107 3300046694 Ga0495649_0151722 Ga0495649_0151722_397_1110 237
108 3300047320 Ga0495672_0135717 Ga0495672_0135717_558_1271 237
109 3300047321 Ga0495676_0492158 Ga0495676_0492158_31_744 237
110 3300047323 Ga0495683_0031473 Ga0495683_0031473_319_1032 237
111 3300047443 Ga0495687_069995 Ga0495687_069995_383_1096 237
112 3300047469 Ga0495673_0026870 Ga0495673_0026870_686_1399 237
113 3300049460 Ga0495682_0012906 Ga0495682_0012906_654_1367 237
114 iso_pu_bacteria 2562617112 2563058112 237
115 iso_pu_bacteria 2711768613 2713473182 237
116 3300046471 Ga0495650_0002493 Ga0495650_0002493_1712_2431 238
117 3300046665 Ga0495661_0071512 Ga0495661_0071512_1137_1853 238
118 3300047319 Ga0495674_0060629 Ga0495674_0060629_1479_2195 238
119 3300009098 Ga0105245_10438620 Ga0105245_104386202 239
120 3300031731 Ga0307405_10283500 Ga0307405_102835002 239
121 3300031824 Ga0307413_10304466 Ga0307413_103044662 239
122 3300031911 Ga0307412_10392921 Ga0307412_103929212 239
123 3300031995 Ga0307409_100168054 Ga0307409_1001680542 239
124 3300032002 Ga0307416_100002694 Ga0307416_1000026944 239
125 3300037418 Ga0395900_0281517 Ga0395900_0281517_444_1166 239
126 3300037466 Ga0395898_0121260 Ga0395898_0121260_518_1240 239
127 3300038443 Ga0395901_0436675 Ga0395901_0436675_376_1098 239
128 3300046459 Ga0495629_0313793 Ga0495629_0313793_147_869 239
129 3300046472 Ga0495580_0001988 Ga0495580_0001988_15764_16489 239
130 3300046472 Ga0495580_0033165 Ga0495580_0033165_1565_2296 239
131 3300046472 Ga0495580_0211191 Ga0495580_0211191_564_1286 239
132 3300046516 Ga0495628_0002690 Ga0495628_0002690_11148_11879 239
133 3300046516 Ga0495628_0079211 Ga0495628_0079211_112_843 239
134 3300046524 Ga0495648_0026219 Ga0495648_0026219_2611_3333 239
135 3300046524 Ga0495648_0271365 Ga0495648_0271365_14_736 239
136 3300046531 Ga0495665_0056745 Ga0495665_0056745_93_815 239
137 3300046531 Ga0495665_0167975 Ga0495665_0167975_37_768 239
138 3300046535 Ga0495586_0127612 Ga0495586_0127612_623_1354 239
139 3300046678 Ga0495599_0257315 Ga0495599_0257315_179_901 239
140 3300046680 Ga0495646_0146659 Ga0495646_0146659_309_1031 239
141 3300046809 Ga0495600_0284434 Ga0495600_0284434_162_893 239
142 3300047319 Ga0495674_0074952 Ga0495674_0074952_357_1088 239
143 3300047319 Ga0495674_0281778 Ga0495674_0281778_85_807 239
144 3300047320 Ga0495672_0001512 Ga0495672_0001512_16954_17676 239
145 3300047320 Ga0495672_0029937 Ga0495672_0029937_194_919 239
146 3300047321 Ga0495676_0295223 Ga0495676_0295223_234_956 239
147 3300047323 Ga0495683_0191788 Ga0495683_0191788_96_818 239
148 3300047469 Ga0495673_0037521 Ga0495673_0037521_906_1631 239
149 3300047470 Ga0495681_0130230 Ga0495681_0130230_119_841 239
150 3300048909 Ga0496106_0001762 Ga0496106_0001762_493_1215 239
151 3300048924 Ga0496121_0042882 Ga0496121_0042882_517_1239 239
152 3300048924 Ga0496121_0090012 Ga0496121_0090012_579_1301 239
153 3300049460 Ga0495682_0000873 Ga0495682_0000873_17174_17893 239
154 3300053083 Ga0495655_0120670 Ga0495655_0120670_57_779 239
155 3300001989 JGI24739J22299_10047720 JGI24739J22299_100477201 240
156 3300009011 Ga0105251_10110143 Ga0105251_101101432 240
157 3300046455 Ga0495603_0273413 Ga0495603_0273413_56_778 240
158 3300046455 Ga0495603_0276540 Ga0495603_0276540_175_912 240
159 3300046457 Ga0495590_0018865 Ga0495590_0018865_712_1446 240
160 3300046463 Ga0495653_0023351 Ga0495653_0023351_269_991 240
161 3300046472 Ga0495580_0005155 Ga0495580_0005155_9879_10601 240
162 3300046472 Ga0495580_0020127 Ga0495580_0020127_3861_4595 240
163 3300046472 Ga0495580_0029651 Ga0495580_0029651_356_1090 240
164 3300046472 Ga0495580_0372412 Ga0495580_0372412_209_931 240
165 3300046474 Ga0495605_0029014 Ga0495605_0029014_1863_2597 240
166 3300046474 Ga0495605_0045184 Ga0495605_0045184_108_830 240
167 3300046506 Ga0495583_0091191 Ga0495583_0091191_405_1127 240
168 3300046513 Ga0495616_0071473 Ga0495616_0071473_929_1663 240
169 3300046524 Ga0495648_0003687 Ga0495648_0003687_3255_3989 240
170 3300046524 Ga0495648_0016918 Ga0495648_0016918_4443_5165 240
171 3300046524 Ga0495648_0074010 Ga0495648_0074010_1046_1768 240
172 3300046528 Ga0495642_0144392 Ga0495642_0144392_17_739 240
173 3300046529 Ga0495652_0001537 Ga0495652_0001537_1882_2604 240
174 3300046531 Ga0495665_0000289 Ga0495665_0000289_22471_23193 240
175 3300046535 Ga0495586_0000513 Ga0495586_0000513_514_1236 240
176 3300046536 Ga0495587_0026125 Ga0495587_0026125_2021_2743 240
177 3300046642 Ga0495634_0249487 Ga0495634_0249487_244_966 240
178 3300046678 Ga0495599_0171977 Ga0495599_0171977_441_1163 240
179 3300046690 Ga0495624_0000496 Ga0495624_0000496_22731_23453 240
180 3300046794 Ga0495589_0081530 Ga0495589_0081530_396_1118 240
181 3300046810 Ga0495660_0185633 Ga0495660_0185633_169_891 240
182 3300047315 Ga0495581_0118764 Ga0495581_0118764_776_1498 240
183 3300047320 Ga0495672_0061177 Ga0495672_0061177_1242_1976 240
184 3300047320 Ga0495672_0087036 Ga0495672_0087036_148_870 240
185 3300047322 Ga0495680_0085398 Ga0495680_0085398_725_1447 240
186 3300047323 Ga0495683_0016341 Ga0495683_0016341_44_778 240
187 3300047323 Ga0495683_0028748 Ga0495683_0028748_2047_2769 240
188 3300047323 Ga0495683_0030788 Ga0495683_0030788_568_1302 240
189 3300047443 Ga0495687_142897 Ga0495687_142897_78_812 240
190 3300047444 Ga0495675_0159096 Ga0495675_0159096_491_1213 240
191 3300047444 Ga0495675_0192442 Ga0495675_0192442_388_1113 240
192 3300047446 Ga0495679_002757 Ga0495679_002757_7247_7969 240
193 3300047469 Ga0495673_0026150 Ga0495673_0026150_871_1593 240
194 3300047469 Ga0495673_0157091 Ga0495673_0157091_12_746 240
195 3300048088 Ga0495602_0065271 Ga0495602_0065271_2346_3068 240
196 3300048089 Ga0495614_0032306 Ga0495614_0032306_202_924 240
197 3300048903 Ga0496100_0055124 Ga0496100_0055124_446_1180 240
198 3300048903 Ga0496100_0440480 Ga0496100_0440480_164_886 240
199 3300048904 Ga0496101_0270889 Ga0496101_0270889_43_765 240
200 3300048907 Ga0496104_0676241 Ga0496104_0676241_130_864 240
201 3300048908 Ga0496105_0015420 Ga0496105_0015420_4901_5623 240
202 3300048908 Ga0496105_0494780 Ga0496105_0494780_66_800 240
203 3300048916 Ga0496113_0154206 Ga0496113_0154206_119_856 240
204 3300048918 Ga0496115_0586801 Ga0496115_0586801_91_813 240
205 3300048923 Ga0496120_0233310 Ga0496120_0233310_104_841 240
206 3300048924 Ga0496121_0026554 Ga0496121_0026554_322_1056 240
207 3300049460 Ga0495682_0015542 Ga0495682_0015542_1668_2390 240
208 3300049460 Ga0495682_0099867 Ga0495682_0099867_218_952 240
209 iso_pu_bacteria 2513237083 2513567164 240
210 iso_pu_bacteria 2562617112 2563055112 240
211 iso_pu_bacteria 2711768613 2713472957 240
212 iso_pu_bacteria 2751185846 2753571875 240
213 iso_pu_bacteria 8003955200 8003963352 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13610

DDE_Tnp_IS240

DDE domain

91

226

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l4n-assembly1.cif.gz_B domain swapped dimer of monellin loop1 mutant with qvpag motif 0.8183 88 119
8ahx-assembly1.cif.gz_G cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.753 91 125
2x6s-assembly1.cif.gz_F human foamy virus integrase - catalytic core. magnesium-bound structure. 0.6872 82 196
2x6n-assembly2.cif.gz_F human foamy virus integrase - catalytic core. manganese-bound structure. 0.6815 82 196
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.6796 83 214
ID Description Score Start End Superfamily
af_Q60323_71_203_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7753 82 201 3.30.420.10
af_A0A1R3MIT0_239_500_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7704 88 120 2.130.10.10
af_Q6ZNJ1_2601_2754_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7611 91 126 2.40.128.630
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7577 79 142 3.30.420.10
af_Q9NZR2_204_465_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7536 90 120 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A6J5F889-F1-model_v4 DDE domain-containing protein 0.9225 90 179
AF-A0A1X6ZVW2-F1-model_v4 DDE domain-containing protein 0.9188 88 161 GO:0003676
AF-A0A2C4PWZ9-F1-model_v4 IS6 family transposase 0.9168 87 155 GO:0003676
AF-A0A2A8GVB4-F1-model_v4 IS6 family transposase 0.9072 91 193 GO:0003677
GO:0006310
GO:0032196
AF-A0A2S5CFX2-F1-model_v4 IS6 family transposase 0.9014 92 176 GO:0003676

Feature Viewer

pLDDT pTM Quality
82 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map