F323735

General Info

Members Datasets Scaffolds Average Seq Length
213 90 426 134

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100212465|Ga0070714_1002124652
Length 148
Sequence LRPANATAFEGATTNLKLVIHVDGGARGNPGPAAIGVVVSDGDGEVVEEIAEPIGLATNNVAEYRAVLKALERAAALGATELELIGDSELVARQLTGAYKVKHPSMKPLHAEATSALSAFDRWSIRSVPRAQNARADALVNAALDDGG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
15 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
16 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
27 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
28 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
29 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
30 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
31 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
32 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
33 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
34 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
52 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
53 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
54 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
58 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
59 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
60 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
61 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
62 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
65 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
66 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
67 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
70 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
77 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
87 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
88 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
89 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
90 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.69
Rhizosphere 74.65
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100212465 3300005435 Bacteria 1774
2 Ga0070709_10046976 3300005434 Bacteria 2687
3 Ga0070714_100073616 3300005435 Bacteria 2960
4 Ga0070714_100090564 3300005435 Bacteria 2679
5 Ga0070714_100951511 3300005435 Bacteria 835
6 Ga0070713_100000054 3300005436 Bacteria 71191
7 Ga0070713_100609677 3300005436 Bacteria 1037
8 Ga0070713_100894145 3300005436 Bacteria 854
9 Ga0070710_10000005 3300005437 Bacteria 238049
10 Ga0070710_10006362 3300005437 Bacteria 5669
11 Ga0070701_10764635 3300005438 Bacteria 656
12 Ga0070711_100046290 3300005439 Bacteria 2963
13 Ga0070684_100092258 3300005535 Bacteria 2694
14 Ga0068862_100685186 3300005844 Bacteria 992
15 Ga0070717_10062770 3300006028 Bacteria 3082
16 Ga0070717_10147439 3300006028 Bacteria 2034
17 Ga0070717_10192972 3300006028 Bacteria 1780
18 Ga0070716_100105133 3300006173 Bacteria 1739
19 Ga0070716_100208172 3300006173 Bacteria 1305
20 Ga0070712_100006817 3300006175 Bacteria 7112
21 Ga0075431_101155683 3300006847 Bacteria 738
22 Ga0114129_10078917 3300009147 Bacteria 4578
23 Ga0213876_10011780 3300021384 Bacteria 4662
24 Ga0213876_10049170 3300021384 Bacteria 2228
25 Ga0213876_10049235 3300021384 Bacteria 2226
26 Ga0213876_10155811 3300021384 Bacteria 1215
27 Ga0213875_10000295 3300021388 Bacteria 48180
28 Ga0213875_10025510 3300021388 Unclassified 2816
29 Ga0213875_10050609 3300021388 Bacteria 1946
30 Ga0213875_10050888 3300021388 Bacteria 1940
31 Ga0213875_10477268 3300021388 Archaea 598
32 Ga0207692_10000009 3300025898 Bacteria 159859
33 Ga0207692_10009787 3300025898 Bacteria 4016
34 Ga0207692_10693048 3300025898 Bacteria 661
35 Ga0207699_10061784 3300025906 Bacteria 2255
36 Ga0207693_10004443 3300025915 Bacteria 11851
37 Ga0207663_10028798 3300025916 Bacteria 3255
38 Ga0207663_10272280 3300025916 Bacteria 1255
39 Ga0207663_10847823 3300025916 Bacteria 729
40 Ga0207700_10000007 3300025928 Bacteria 345720
41 Ga0207700_10036003 3300025928 Bacteria 3571
42 Ga0207700_10851340 3300025928 Bacteria 816
43 Ga0207700_10943202 3300025928 Unclassified 772
44 Ga0207700_11469581 3300025928 Bacteria 605
45 Ga0207664_10023403 3300025929 Bacteria 4628
46 Ga0207664_10126026 3300025929 Bacteria 2150
47 Ga0207664_10790617 3300025929 Bacteria 854
48 Ga0207665_10252853 3300025939 Bacteria 1303
49 Ga0207661_10038631 3300025944 Bacteria 3743
50 Ga0207674_10304602 3300026116 Bacteria 1542
51 Ga0265319_1061625 3300028563 Bacteria 1216
52 Ga0265327_10038164 3300031251 Bacteria 2624
53 Ga0373934_0222794 3300035086 Bacteria 778
54 Ga0373954_0030512 3300035118 Bacteria 2486
55 Ga0373924_0203194 3300035410 Bacteria 874
56 Ga0373933_0077088 3300035724 Bacteria 2037
57 Ga0373937_0006697 3300036401 Bacteria 9941
58 Ga0373937_0035006 3300036401 Bacteria 4568
59 Ga0373937_1262583 3300036401 Bacteria 687
60 Ga0436364_0162095 3300037853 Bacteria 965
61 Ga0436364_0253846 3300037853 Bacteria 2240
62 Ga0436364_0315879 3300037853 Bacteria 4376
63 Ga0436364_0442148 3300037853 Bacteria 3905
64 Ga0436364_0598093 3300037853 Bacteria 5011
65 Ga0436364_0631287 3300037853 Bacteria 1502
66 Ga0436364_0714562 3300037853 Bacteria 1503
67 Ga0436364_0744587 3300037853 Archaea 1051
68 Ga0436364_0818586 3300037853 Bacteria 35613
69 Ga0436364_0839845 3300037853 Unclassified 1789
70 Ga0436364_1040378 3300037853 Bacteria 1075
71 Ga0436364_1241338 3300037853 Unclassified 1509
72 Ga0436364_1246015 3300037853 Bacteria 9764
73 Ga0436364_1510503 3300037853 Bacteria 555
74 Ga0436365_0163049 3300039437 Bacteria 21631
75 Ga0436365_0284305 3300039437 Bacteria 716
76 Ga0436365_0647108 3300039437 Bacteria 4184
77 Ga0436365_0769121 3300039437 Bacteria 6262
78 Ga0436365_0771186 3300039437 Bacteria 3736
79 Ga0436365_0850482 3300039437 Bacteria 2702
80 Ga0436365_0936457 3300039437 Bacteria 1184
81 Ga0436365_1299385 3300039437 Bacteria 7931
82 Ga0436365_1391403 3300039437 Bacteria 4664
83 Ga0436365_1431910 3300039437 Bacteria 22184
84 Ga0436365_1566558 3300039437 Archaea 617
85 Ga0436365_1609374 3300039437 Bacteria 689
86 Ga0436365_1880796 3300039437 Bacteria 5914
87 Ga0436365_1933145 3300039437 Bacteria 3583
88 Ga0436363_0312381 3300039450 Unclassified 731
89 Ga0436363_0712204 3300039450 Bacteria 10061
90 Ga0436363_0770708 3300039450 Bacteria 3355
91 Ga0436363_0831202 3300039450 Bacteria 716
92 Ga0436363_0863709 3300039450 Bacteria 21656
93 Ga0436363_1459379 3300039450 Bacteria 2376
94 Ga0436363_1581029 3300039450 Bacteria 5619
95 Ga0436362_0592435 3300039453 Bacteria 740
96 Ga0436362_0897257 3300039453 Bacteria 1538
97 Ga0436362_0986102 3300039453 Bacteria 1670
98 Ga0436362_1025176 3300039453 Bacteria 1547
99 Ga0466969_0171655 3300044656 Unclassified 994
100 Ga0466969_0253927 3300044656 Bacteria 797
101 Ga0466966_0044981 3300044684 Bacteria 2824
102 Ga0466966_0328589 3300044684 Unclassified 919
103 Ga0466966_0332990 3300044684 Bacteria 912
104 Ga0466966_0380806 3300044684 Bacteria 848
105 Ga0466966_0470522 3300044684 Bacteria 756
106 Ga0466961_0012381 3300044693 Bacteria 5454
107 Ga0466961_0100590 3300044693 Bacteria 1821
108 Ga0466961_0118260 3300044693 Bacteria 1665
109 Ga0466961_0394707 3300044693 Bacteria 840
110 Ga0466963_0001928 3300044694 Bacteria 11357
111 Ga0466963_0002720 3300044694 Bacteria 9971
112 Ga0466963_0147008 3300044694 Bacteria 1635
113 Ga0466963_0156848 3300044694 Unclassified 1583
114 Ga0466963_0189259 3300044694 Unclassified 1438
115 Ga0466971_0120856 3300044719 Bacteria 1212
116 Ga0466968_0018431 3300044735 Unclassified 2800
117 Ga0466968_0037335 3300044735 Bacteria 2038
118 Ga0466968_0042005 3300044735 Bacteria 1932
119 Ga0466968_0140000 3300044735 Unclassified 1106
120 Ga0466968_0179086 3300044735 Bacteria 985
121 Ga0466968_0193614 3300044735 Unclassified 950
122 Ga0466970_0255212 3300044765 Bacteria 983
123 Ga0466970_0261233 3300044765 Unclassified 971
124 Ga0466970_0445266 3300044765 Bacteria 742
125 Ga0466957_0013376 3300044842 Bacteria 4761
126 Ga0466957_0065478 3300044842 Bacteria 2238
127 Ga0466957_0164868 3300044842 Bacteria 1441
128 Ga0466957_0638103 3300044842 Bacteria 748
129 Ga0466957_0764855 3300044842 Bacteria 685
130 Ga0466957_0843373 3300044842 Bacteria 653
131 Ga0466959_0000366 3300045049 Bacteria 26743
132 Ga0466959_0001951 3300045049 Bacteria 12997
133 Ga0466959_0058757 3300045049 Bacteria 2801
134 Ga0466959_0104434 3300045049 Bacteria 2027
135 Ga0466959_0151489 3300045049 Bacteria 1634
136 Ga0466959_0174217 3300045049 Bacteria 1508
137 Ga0466959_0195204 3300045049 Unclassified 1411
138 Ga0466959_0202965 3300045049 Bacteria 1380
139 Ga0466958_0001874 3300045836 Bacteria 10280
140 Ga0466958_0015222 3300045836 Bacteria 4403
141 Ga0466958_0024550 3300045836 Bacteria 3548
142 Ga0466958_0080309 3300045836 Unclassified 2006
143 Ga0466958_0329871 3300045836 Bacteria 981
144 Ga0466958_0500236 3300045836 Bacteria 789
145 Ga0466958_0792396 3300045836 Bacteria 618
146 Ga0466967_0127043 3300045976 Bacteria 2363
147 Ga0466967_0840806 3300045976 Bacteria 912
148 Ga0466967_2552731 3300045976 Bacteria 506
149 Ga0466967_2586814 3300045976 Bacteria 502
150 Ga0495592_0017507 3300046454 Bacteria 5444
151 Ga0495629_0105966 3300046459 Bacteria 1961
152 Ga0495641_0221218 3300046461 Bacteria 849
153 Ga0495651_0014711 3300046462 Bacteria 6050
154 Ga0495653_0008394 3300046463 Bacteria 8467
155 Ga0495664_0216088 3300046477 Bacteria 1161
156 Ga0495664_0693645 3300046477 Bacteria 602
157 Ga0495608_0004947 3300046511 Bacteria 9542
158 Ga0495608_0038687 3300046511 Bacteria 3202
159 Ga0495618_0018503 3300046514 Bacteria 4277
160 Ga0495628_0007385 3300046516 Bacteria 9516
161 Ga0495628_0318388 3300046516 Bacteria 1148
162 Ga0495630_0339482 3300046517 Bacteria 1149
163 Ga0495652_0005691 3300046529 Bacteria 11671
164 Ga0495640_0007225 3300046533 Bacteria 8749
165 Ga0495587_0056846 3300046536 Bacteria 2301
166 Ga0495587_0386367 3300046536 Bacteria 778
167 Ga0495645_0096800 3300046543 Bacteria 2103
168 Ga0495667_0014157 3300046559 Bacteria 5384
169 Ga0495667_0810533 3300046559 Bacteria 577
170 Ga0495634_0110836 3300046642 Bacteria 1765
171 Ga0495635_0005712 3300046663 Bacteria 8668
172 Ga0495657_0002697 3300046675 Bacteria 14830
173 Ga0495599_0055550 3300046678 Bacteria 2479
174 Ga0495623_0020508 3300046679 Bacteria 4272
175 Ga0495646_0034939 3300046680 Bacteria 3119
176 Ga0495613_0000565 3300046689 Bacteria 30469
177 Ga0495613_0368821 3300046689 Bacteria 983
178 Ga0495600_0001576 3300046809 Bacteria 12681
179 Ga0495600_0035228 3300046809 Bacteria 3250
180 Ga0495581_0169176 3300047315 Bacteria 1278
181 Ga0495604_0002306 3300047317 Bacteria 15292
182 Ga0495604_0097136 3300047317 Bacteria 2173
183 Ga0495674_0012279 3300047319 Bacteria 8074
184 Ga0495674_0231669 3300047319 Bacteria 1524
185 Ga0495680_0008054 3300047322 Bacteria 9607
186 Ga0495680_0324139 3300047322 Bacteria 1078
187 Ga0495675_0033366 3300047444 Bacteria 3287
188 Ga0495684_0036759 3300047471 Bacteria 3754
189 Ga0495593_0048186 3300047673 Bacteria 2265
190 Ga0495593_0085524 3300047673 Bacteria 1627
191 Ga0495593_0282853 3300047673 Bacteria 829
192 Ga0495602_0034151 3300048088 Bacteria 4762
193 Ga0496105_0154255 3300048908 Bacteria 1887
194 Ga0496105_1055666 3300048908 Bacteria 605
195 Ga0496108_1312819 3300048911 Bacteria 608
196 Ga0496108_1670368 3300048911 Bacteria 525
197 Ga0496109_0561021 3300048912 Bacteria 1077
198 Ga0496109_0954319 3300048912 Bacteria 795
199 Ga0496111_0333839 3300048914 Bacteria 1122
200 Ga0496112_0020711 3300048915 Bacteria 6238
201 Ga0496113_0039142 3300048916 Bacteria 3489
202 Ga0496114_0166590 3300048917 Bacteria 1919
203 nmdc:mga06r32_1233645_c1 3300050510 Bacteria 693
204 Ga0495601_0024453 3300053077 Bacteria 3720
205 Ga0495601_0061286 3300053077 Bacteria 2388
206 Ga0495612_0000024 3300053078 Bacteria 115718
207 Ga0495612_0035578 3300053078 Bacteria 2019
208 Ga0495595_0001620 3300053084 Bacteria 8793
209 Ga0495595_0058783 3300053084 Bacteria 1796
210 Ga0495619_0008132 3300053085 Bacteria 6637
211 Ga0495619_0031810 3300053085 Bacteria 3420
212 Ga0466962_0008409 3300061719 Bacteria 4945
213 Ga0466962_0020481 3300061719 Bacteria 3178
214 Ga0070714_100212465
215 Ga0070709_10046976
216 Ga0070714_100073616
217 Ga0070714_100090564
218 Ga0070714_100951511
219 Ga0070713_100000054
220 Ga0070713_100609677
221 Ga0070713_100894145
222 Ga0070710_10000005
223 Ga0070710_10006362
224 Ga0070701_10764635
225 Ga0070711_100046290
226 Ga0070684_100092258
227 Ga0068862_100685186
228 Ga0070717_10062770
229 Ga0070717_10147439
230 Ga0070717_10192972
231 Ga0070716_100105133
232 Ga0070716_100208172
233 Ga0070712_100006817
234 Ga0075431_101155683
235 Ga0114129_10078917
236 Ga0213876_10011780
237 Ga0213876_10049170
238 Ga0213876_10049235
239 Ga0213876_10155811
240 Ga0213875_10000295
241 Ga0213875_10025510
242 Ga0213875_10050609
243 Ga0213875_10050888
244 Ga0213875_10477268
245 Ga0207692_10000009
246 Ga0207692_10009787
247 Ga0207692_10693048
248 Ga0207699_10061784
249 Ga0207693_10004443
250 Ga0207663_10028798
251 Ga0207663_10272280
252 Ga0207663_10847823
253 Ga0207700_10000007
254 Ga0207700_10036003
255 Ga0207700_10851340
256 Ga0207700_10943202
257 Ga0207700_11469581
258 Ga0207664_10023403
259 Ga0207664_10126026
260 Ga0207664_10790617
261 Ga0207665_10252853
262 Ga0207661_10038631
263 Ga0207674_10304602
264 Ga0265319_1061625
265 Ga0265327_10038164
266 Ga0373934_0222794
267 Ga0373954_0030512
268 Ga0373924_0203194
269 Ga0373933_0077088
270 Ga0373937_0006697
271 Ga0373937_0035006
272 Ga0373937_1262583
273 Ga0436364_0162095
274 Ga0436364_0253846
275 Ga0436364_0315879
276 Ga0436364_0442148
277 Ga0436364_0598093
278 Ga0436364_0631287
279 Ga0436364_0714562
280 Ga0436364_0744587
281 Ga0436364_0818586
282 Ga0436364_0839845
283 Ga0436364_1040378
284 Ga0436364_1241338
285 Ga0436364_1246015
286 Ga0436364_1510503
287 Ga0436365_0163049
288 Ga0436365_0284305
289 Ga0436365_0647108
290 Ga0436365_0769121
291 Ga0436365_0771186
292 Ga0436365_0850482
293 Ga0436365_0936457
294 Ga0436365_1299385
295 Ga0436365_1391403
296 Ga0436365_1431910
297 Ga0436365_1566558
298 Ga0436365_1609374
299 Ga0436365_1880796
300 Ga0436365_1933145
301 Ga0436363_0312381
302 Ga0436363_0712204
303 Ga0436363_0770708
304 Ga0436363_0831202
305 Ga0436363_0863709
306 Ga0436363_1459379
307 Ga0436363_1581029
308 Ga0436362_0592435
309 Ga0436362_0897257
310 Ga0436362_0986102
311 Ga0436362_1025176
312 Ga0466969_0171655
313 Ga0466969_0253927
314 Ga0466966_0044981
315 Ga0466966_0328589
316 Ga0466966_0332990
317 Ga0466966_0380806
318 Ga0466966_0470522
319 Ga0466961_0012381
320 Ga0466961_0100590
321 Ga0466961_0118260
322 Ga0466961_0394707
323 Ga0466963_0001928
324 Ga0466963_0002720
325 Ga0466963_0147008
326 Ga0466963_0156848
327 Ga0466963_0189259
328 Ga0466971_0120856
329 Ga0466968_0018431
330 Ga0466968_0037335
331 Ga0466968_0042005
332 Ga0466968_0140000
333 Ga0466968_0179086
334 Ga0466968_0193614
335 Ga0466970_0255212
336 Ga0466970_0261233
337 Ga0466970_0445266
338 Ga0466957_0013376
339 Ga0466957_0065478
340 Ga0466957_0164868
341 Ga0466957_0638103
342 Ga0466957_0764855
343 Ga0466957_0843373
344 Ga0466959_0000366
345 Ga0466959_0001951
346 Ga0466959_0058757
347 Ga0466959_0104434
348 Ga0466959_0151489
349 Ga0466959_0174217
350 Ga0466959_0195204
351 Ga0466959_0202965
352 Ga0466958_0001874
353 Ga0466958_0015222
354 Ga0466958_0024550
355 Ga0466958_0080309
356 Ga0466958_0329871
357 Ga0466958_0500236
358 Ga0466958_0792396
359 Ga0466967_0127043
360 Ga0466967_0840806
361 Ga0466967_2552731
362 Ga0466967_2586814
363 Ga0495592_0017507
364 Ga0495629_0105966
365 Ga0495641_0221218
366 Ga0495651_0014711
367 Ga0495653_0008394
368 Ga0495664_0216088
369 Ga0495664_0693645
370 Ga0495608_0004947
371 Ga0495608_0038687
372 Ga0495618_0018503
373 Ga0495628_0007385
374 Ga0495628_0318388
375 Ga0495630_0339482
376 Ga0495652_0005691
377 Ga0495640_0007225
378 Ga0495587_0056846
379 Ga0495587_0386367
380 Ga0495645_0096800
381 Ga0495667_0014157
382 Ga0495667_0810533
383 Ga0495634_0110836
384 Ga0495635_0005712
385 Ga0495657_0002697
386 Ga0495599_0055550
387 Ga0495623_0020508
388 Ga0495646_0034939
389 Ga0495613_0000565
390 Ga0495613_0368821
391 Ga0495600_0001576
392 Ga0495600_0035228
393 Ga0495581_0169176
394 Ga0495604_0002306
395 Ga0495604_0097136
396 Ga0495674_0012279
397 Ga0495674_0231669
398 Ga0495680_0008054
399 Ga0495680_0324139
400 Ga0495675_0033366
401 Ga0495684_0036759
402 Ga0495593_0048186
403 Ga0495593_0085524
404 Ga0495593_0282853
405 Ga0495602_0034151
406 Ga0496105_0154255
407 Ga0496105_1055666
408 Ga0496108_1312819
409 Ga0496108_1670368
410 Ga0496109_0561021
411 Ga0496109_0954319
412 Ga0496111_0333839
413 Ga0496112_0020711
414 Ga0496113_0039142
415 Ga0496114_0166590
416 nmdc:mga06r32_1233645_c1
417 Ga0495601_0024453
418 Ga0495601_0061286
419 Ga0495612_0000024
420 Ga0495612_0035578
421 Ga0495595_0001620
422 Ga0495595_0058783
423 Ga0495619_0008132
424 Ga0495619_0031810
425 Ga0466962_0008409
426 Ga0466962_0020481

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13456

RVT_3

Reverse transcriptase-like

21

143

0.98

PF00075

RNase_H

RNase H

15

145

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.986 1 131
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9773 1 130
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9726 1 132
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.9713 1 131
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9628 1 130
ID Description Score Start End Superfamily
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9842 2 131 3.30.420.10
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.983 3 130 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9773 1 130 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9628 1 130 3.30.420.10
3u3gA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9536 2 132 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1V5L929-F1-model_v4 14.7 kDa ribonuclease H-like protein 0.9983 2 130 GO:0003676
GO:0004523
AF-A0A7V2UG45-F1-model_v4 Ribonuclease HI family protein 0.9945 2 131 GO:0003676
GO:0004523
AF-A0A0F0CJ98-F1-model_v4 Ribonuclease HI 0.9929 2 132 GO:0003676
GO:0004523
AF-A0A1F2QF74-F1-model_v4 RNase H type-1 domain-containing protein 0.9929 2 130 GO:0003676
GO:0004523
AF-A0A1F8P2N9-F1-model_v4 RNase H type-1 domain-containing protein 0.9926 1 131 GO:0003676
GO:0004523

Map