F323735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 90 | 426 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100212465|Ga0070714_1002124652 |
| Length | 148 |
| Sequence | LRPANATAFEGATTNLKLVIHVDGGARGNPGPAAIGVVVSDGDGEVVEEIAEPIGLATNNVAEYRAVLKALERAAALGATELELIGDSELVARQLTGAYKVKHPSMKPLHAEATSALSAFDRWSIRSVPRAQNARADALVNAALDDGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 3 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 4 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 9 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 13 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 15 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 16 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 26 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 27 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 28 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 29 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 30 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 31 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 32 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 33 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 34 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 35 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 36 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 37 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 38 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 39 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 40 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 41 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 42 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 43 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 44 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 45 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 46 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 47 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 79 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 81 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 82 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 83 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 84 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 85 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 86 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.69 |
| Rhizosphere | 74.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100212465 | 3300005435 | Bacteria | 1774 |
| 2 | Ga0070709_10046976 | 3300005434 | Bacteria | 2687 |
| 3 | Ga0070714_100073616 | 3300005435 | Bacteria | 2960 |
| 4 | Ga0070714_100090564 | 3300005435 | Bacteria | 2679 |
| 5 | Ga0070714_100951511 | 3300005435 | Bacteria | 835 |
| 6 | Ga0070713_100000054 | 3300005436 | Bacteria | 71191 |
| 7 | Ga0070713_100609677 | 3300005436 | Bacteria | 1037 |
| 8 | Ga0070713_100894145 | 3300005436 | Bacteria | 854 |
| 9 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 10 | Ga0070710_10006362 | 3300005437 | Bacteria | 5669 |
| 11 | Ga0070701_10764635 | 3300005438 | Bacteria | 656 |
| 12 | Ga0070711_100046290 | 3300005439 | Bacteria | 2963 |
| 13 | Ga0070684_100092258 | 3300005535 | Bacteria | 2694 |
| 14 | Ga0068862_100685186 | 3300005844 | Bacteria | 992 |
| 15 | Ga0070717_10062770 | 3300006028 | Bacteria | 3082 |
| 16 | Ga0070717_10147439 | 3300006028 | Bacteria | 2034 |
| 17 | Ga0070717_10192972 | 3300006028 | Bacteria | 1780 |
| 18 | Ga0070716_100105133 | 3300006173 | Bacteria | 1739 |
| 19 | Ga0070716_100208172 | 3300006173 | Bacteria | 1305 |
| 20 | Ga0070712_100006817 | 3300006175 | Bacteria | 7112 |
| 21 | Ga0075431_101155683 | 3300006847 | Bacteria | 738 |
| 22 | Ga0114129_10078917 | 3300009147 | Bacteria | 4578 |
| 23 | Ga0213876_10011780 | 3300021384 | Bacteria | 4662 |
| 24 | Ga0213876_10049170 | 3300021384 | Bacteria | 2228 |
| 25 | Ga0213876_10049235 | 3300021384 | Bacteria | 2226 |
| 26 | Ga0213876_10155811 | 3300021384 | Bacteria | 1215 |
| 27 | Ga0213875_10000295 | 3300021388 | Bacteria | 48180 |
| 28 | Ga0213875_10025510 | 3300021388 | Unclassified | 2816 |
| 29 | Ga0213875_10050609 | 3300021388 | Bacteria | 1946 |
| 30 | Ga0213875_10050888 | 3300021388 | Bacteria | 1940 |
| 31 | Ga0213875_10477268 | 3300021388 | Archaea | 598 |
| 32 | Ga0207692_10000009 | 3300025898 | Bacteria | 159859 |
| 33 | Ga0207692_10009787 | 3300025898 | Bacteria | 4016 |
| 34 | Ga0207692_10693048 | 3300025898 | Bacteria | 661 |
| 35 | Ga0207699_10061784 | 3300025906 | Bacteria | 2255 |
| 36 | Ga0207693_10004443 | 3300025915 | Bacteria | 11851 |
| 37 | Ga0207663_10028798 | 3300025916 | Bacteria | 3255 |
| 38 | Ga0207663_10272280 | 3300025916 | Bacteria | 1255 |
| 39 | Ga0207663_10847823 | 3300025916 | Bacteria | 729 |
| 40 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 41 | Ga0207700_10036003 | 3300025928 | Bacteria | 3571 |
| 42 | Ga0207700_10851340 | 3300025928 | Bacteria | 816 |
| 43 | Ga0207700_10943202 | 3300025928 | Unclassified | 772 |
| 44 | Ga0207700_11469581 | 3300025928 | Bacteria | 605 |
| 45 | Ga0207664_10023403 | 3300025929 | Bacteria | 4628 |
| 46 | Ga0207664_10126026 | 3300025929 | Bacteria | 2150 |
| 47 | Ga0207664_10790617 | 3300025929 | Bacteria | 854 |
| 48 | Ga0207665_10252853 | 3300025939 | Bacteria | 1303 |
| 49 | Ga0207661_10038631 | 3300025944 | Bacteria | 3743 |
| 50 | Ga0207674_10304602 | 3300026116 | Bacteria | 1542 |
| 51 | Ga0265319_1061625 | 3300028563 | Bacteria | 1216 |
| 52 | Ga0265327_10038164 | 3300031251 | Bacteria | 2624 |
| 53 | Ga0373934_0222794 | 3300035086 | Bacteria | 778 |
| 54 | Ga0373954_0030512 | 3300035118 | Bacteria | 2486 |
| 55 | Ga0373924_0203194 | 3300035410 | Bacteria | 874 |
| 56 | Ga0373933_0077088 | 3300035724 | Bacteria | 2037 |
| 57 | Ga0373937_0006697 | 3300036401 | Bacteria | 9941 |
| 58 | Ga0373937_0035006 | 3300036401 | Bacteria | 4568 |
| 59 | Ga0373937_1262583 | 3300036401 | Bacteria | 687 |
| 60 | Ga0436364_0162095 | 3300037853 | Bacteria | 965 |
| 61 | Ga0436364_0253846 | 3300037853 | Bacteria | 2240 |
| 62 | Ga0436364_0315879 | 3300037853 | Bacteria | 4376 |
| 63 | Ga0436364_0442148 | 3300037853 | Bacteria | 3905 |
| 64 | Ga0436364_0598093 | 3300037853 | Bacteria | 5011 |
| 65 | Ga0436364_0631287 | 3300037853 | Bacteria | 1502 |
| 66 | Ga0436364_0714562 | 3300037853 | Bacteria | 1503 |
| 67 | Ga0436364_0744587 | 3300037853 | Archaea | 1051 |
| 68 | Ga0436364_0818586 | 3300037853 | Bacteria | 35613 |
| 69 | Ga0436364_0839845 | 3300037853 | Unclassified | 1789 |
| 70 | Ga0436364_1040378 | 3300037853 | Bacteria | 1075 |
| 71 | Ga0436364_1241338 | 3300037853 | Unclassified | 1509 |
| 72 | Ga0436364_1246015 | 3300037853 | Bacteria | 9764 |
| 73 | Ga0436364_1510503 | 3300037853 | Bacteria | 555 |
| 74 | Ga0436365_0163049 | 3300039437 | Bacteria | 21631 |
| 75 | Ga0436365_0284305 | 3300039437 | Bacteria | 716 |
| 76 | Ga0436365_0647108 | 3300039437 | Bacteria | 4184 |
| 77 | Ga0436365_0769121 | 3300039437 | Bacteria | 6262 |
| 78 | Ga0436365_0771186 | 3300039437 | Bacteria | 3736 |
| 79 | Ga0436365_0850482 | 3300039437 | Bacteria | 2702 |
| 80 | Ga0436365_0936457 | 3300039437 | Bacteria | 1184 |
| 81 | Ga0436365_1299385 | 3300039437 | Bacteria | 7931 |
| 82 | Ga0436365_1391403 | 3300039437 | Bacteria | 4664 |
| 83 | Ga0436365_1431910 | 3300039437 | Bacteria | 22184 |
| 84 | Ga0436365_1566558 | 3300039437 | Archaea | 617 |
| 85 | Ga0436365_1609374 | 3300039437 | Bacteria | 689 |
| 86 | Ga0436365_1880796 | 3300039437 | Bacteria | 5914 |
| 87 | Ga0436365_1933145 | 3300039437 | Bacteria | 3583 |
| 88 | Ga0436363_0312381 | 3300039450 | Unclassified | 731 |
| 89 | Ga0436363_0712204 | 3300039450 | Bacteria | 10061 |
| 90 | Ga0436363_0770708 | 3300039450 | Bacteria | 3355 |
| 91 | Ga0436363_0831202 | 3300039450 | Bacteria | 716 |
| 92 | Ga0436363_0863709 | 3300039450 | Bacteria | 21656 |
| 93 | Ga0436363_1459379 | 3300039450 | Bacteria | 2376 |
| 94 | Ga0436363_1581029 | 3300039450 | Bacteria | 5619 |
| 95 | Ga0436362_0592435 | 3300039453 | Bacteria | 740 |
| 96 | Ga0436362_0897257 | 3300039453 | Bacteria | 1538 |
| 97 | Ga0436362_0986102 | 3300039453 | Bacteria | 1670 |
| 98 | Ga0436362_1025176 | 3300039453 | Bacteria | 1547 |
| 99 | Ga0466969_0171655 | 3300044656 | Unclassified | 994 |
| 100 | Ga0466969_0253927 | 3300044656 | Bacteria | 797 |
| 101 | Ga0466966_0044981 | 3300044684 | Bacteria | 2824 |
| 102 | Ga0466966_0328589 | 3300044684 | Unclassified | 919 |
| 103 | Ga0466966_0332990 | 3300044684 | Bacteria | 912 |
| 104 | Ga0466966_0380806 | 3300044684 | Bacteria | 848 |
| 105 | Ga0466966_0470522 | 3300044684 | Bacteria | 756 |
| 106 | Ga0466961_0012381 | 3300044693 | Bacteria | 5454 |
| 107 | Ga0466961_0100590 | 3300044693 | Bacteria | 1821 |
| 108 | Ga0466961_0118260 | 3300044693 | Bacteria | 1665 |
| 109 | Ga0466961_0394707 | 3300044693 | Bacteria | 840 |
| 110 | Ga0466963_0001928 | 3300044694 | Bacteria | 11357 |
| 111 | Ga0466963_0002720 | 3300044694 | Bacteria | 9971 |
| 112 | Ga0466963_0147008 | 3300044694 | Bacteria | 1635 |
| 113 | Ga0466963_0156848 | 3300044694 | Unclassified | 1583 |
| 114 | Ga0466963_0189259 | 3300044694 | Unclassified | 1438 |
| 115 | Ga0466971_0120856 | 3300044719 | Bacteria | 1212 |
| 116 | Ga0466968_0018431 | 3300044735 | Unclassified | 2800 |
| 117 | Ga0466968_0037335 | 3300044735 | Bacteria | 2038 |
| 118 | Ga0466968_0042005 | 3300044735 | Bacteria | 1932 |
| 119 | Ga0466968_0140000 | 3300044735 | Unclassified | 1106 |
| 120 | Ga0466968_0179086 | 3300044735 | Bacteria | 985 |
| 121 | Ga0466968_0193614 | 3300044735 | Unclassified | 950 |
| 122 | Ga0466970_0255212 | 3300044765 | Bacteria | 983 |
| 123 | Ga0466970_0261233 | 3300044765 | Unclassified | 971 |
| 124 | Ga0466970_0445266 | 3300044765 | Bacteria | 742 |
| 125 | Ga0466957_0013376 | 3300044842 | Bacteria | 4761 |
| 126 | Ga0466957_0065478 | 3300044842 | Bacteria | 2238 |
| 127 | Ga0466957_0164868 | 3300044842 | Bacteria | 1441 |
| 128 | Ga0466957_0638103 | 3300044842 | Bacteria | 748 |
| 129 | Ga0466957_0764855 | 3300044842 | Bacteria | 685 |
| 130 | Ga0466957_0843373 | 3300044842 | Bacteria | 653 |
| 131 | Ga0466959_0000366 | 3300045049 | Bacteria | 26743 |
| 132 | Ga0466959_0001951 | 3300045049 | Bacteria | 12997 |
| 133 | Ga0466959_0058757 | 3300045049 | Bacteria | 2801 |
| 134 | Ga0466959_0104434 | 3300045049 | Bacteria | 2027 |
| 135 | Ga0466959_0151489 | 3300045049 | Bacteria | 1634 |
| 136 | Ga0466959_0174217 | 3300045049 | Bacteria | 1508 |
| 137 | Ga0466959_0195204 | 3300045049 | Unclassified | 1411 |
| 138 | Ga0466959_0202965 | 3300045049 | Bacteria | 1380 |
| 139 | Ga0466958_0001874 | 3300045836 | Bacteria | 10280 |
| 140 | Ga0466958_0015222 | 3300045836 | Bacteria | 4403 |
| 141 | Ga0466958_0024550 | 3300045836 | Bacteria | 3548 |
| 142 | Ga0466958_0080309 | 3300045836 | Unclassified | 2006 |
| 143 | Ga0466958_0329871 | 3300045836 | Bacteria | 981 |
| 144 | Ga0466958_0500236 | 3300045836 | Bacteria | 789 |
| 145 | Ga0466958_0792396 | 3300045836 | Bacteria | 618 |
| 146 | Ga0466967_0127043 | 3300045976 | Bacteria | 2363 |
| 147 | Ga0466967_0840806 | 3300045976 | Bacteria | 912 |
| 148 | Ga0466967_2552731 | 3300045976 | Bacteria | 506 |
| 149 | Ga0466967_2586814 | 3300045976 | Bacteria | 502 |
| 150 | Ga0495592_0017507 | 3300046454 | Bacteria | 5444 |
| 151 | Ga0495629_0105966 | 3300046459 | Bacteria | 1961 |
| 152 | Ga0495641_0221218 | 3300046461 | Bacteria | 849 |
| 153 | Ga0495651_0014711 | 3300046462 | Bacteria | 6050 |
| 154 | Ga0495653_0008394 | 3300046463 | Bacteria | 8467 |
| 155 | Ga0495664_0216088 | 3300046477 | Bacteria | 1161 |
| 156 | Ga0495664_0693645 | 3300046477 | Bacteria | 602 |
| 157 | Ga0495608_0004947 | 3300046511 | Bacteria | 9542 |
| 158 | Ga0495608_0038687 | 3300046511 | Bacteria | 3202 |
| 159 | Ga0495618_0018503 | 3300046514 | Bacteria | 4277 |
| 160 | Ga0495628_0007385 | 3300046516 | Bacteria | 9516 |
| 161 | Ga0495628_0318388 | 3300046516 | Bacteria | 1148 |
| 162 | Ga0495630_0339482 | 3300046517 | Bacteria | 1149 |
| 163 | Ga0495652_0005691 | 3300046529 | Bacteria | 11671 |
| 164 | Ga0495640_0007225 | 3300046533 | Bacteria | 8749 |
| 165 | Ga0495587_0056846 | 3300046536 | Bacteria | 2301 |
| 166 | Ga0495587_0386367 | 3300046536 | Bacteria | 778 |
| 167 | Ga0495645_0096800 | 3300046543 | Bacteria | 2103 |
| 168 | Ga0495667_0014157 | 3300046559 | Bacteria | 5384 |
| 169 | Ga0495667_0810533 | 3300046559 | Bacteria | 577 |
| 170 | Ga0495634_0110836 | 3300046642 | Bacteria | 1765 |
| 171 | Ga0495635_0005712 | 3300046663 | Bacteria | 8668 |
| 172 | Ga0495657_0002697 | 3300046675 | Bacteria | 14830 |
| 173 | Ga0495599_0055550 | 3300046678 | Bacteria | 2479 |
| 174 | Ga0495623_0020508 | 3300046679 | Bacteria | 4272 |
| 175 | Ga0495646_0034939 | 3300046680 | Bacteria | 3119 |
| 176 | Ga0495613_0000565 | 3300046689 | Bacteria | 30469 |
| 177 | Ga0495613_0368821 | 3300046689 | Bacteria | 983 |
| 178 | Ga0495600_0001576 | 3300046809 | Bacteria | 12681 |
| 179 | Ga0495600_0035228 | 3300046809 | Bacteria | 3250 |
| 180 | Ga0495581_0169176 | 3300047315 | Bacteria | 1278 |
| 181 | Ga0495604_0002306 | 3300047317 | Bacteria | 15292 |
| 182 | Ga0495604_0097136 | 3300047317 | Bacteria | 2173 |
| 183 | Ga0495674_0012279 | 3300047319 | Bacteria | 8074 |
| 184 | Ga0495674_0231669 | 3300047319 | Bacteria | 1524 |
| 185 | Ga0495680_0008054 | 3300047322 | Bacteria | 9607 |
| 186 | Ga0495680_0324139 | 3300047322 | Bacteria | 1078 |
| 187 | Ga0495675_0033366 | 3300047444 | Bacteria | 3287 |
| 188 | Ga0495684_0036759 | 3300047471 | Bacteria | 3754 |
| 189 | Ga0495593_0048186 | 3300047673 | Bacteria | 2265 |
| 190 | Ga0495593_0085524 | 3300047673 | Bacteria | 1627 |
| 191 | Ga0495593_0282853 | 3300047673 | Bacteria | 829 |
| 192 | Ga0495602_0034151 | 3300048088 | Bacteria | 4762 |
| 193 | Ga0496105_0154255 | 3300048908 | Bacteria | 1887 |
| 194 | Ga0496105_1055666 | 3300048908 | Bacteria | 605 |
| 195 | Ga0496108_1312819 | 3300048911 | Bacteria | 608 |
| 196 | Ga0496108_1670368 | 3300048911 | Bacteria | 525 |
| 197 | Ga0496109_0561021 | 3300048912 | Bacteria | 1077 |
| 198 | Ga0496109_0954319 | 3300048912 | Bacteria | 795 |
| 199 | Ga0496111_0333839 | 3300048914 | Bacteria | 1122 |
| 200 | Ga0496112_0020711 | 3300048915 | Bacteria | 6238 |
| 201 | Ga0496113_0039142 | 3300048916 | Bacteria | 3489 |
| 202 | Ga0496114_0166590 | 3300048917 | Bacteria | 1919 |
| 203 | nmdc:mga06r32_1233645_c1 | 3300050510 | Bacteria | 693 |
| 204 | Ga0495601_0024453 | 3300053077 | Bacteria | 3720 |
| 205 | Ga0495601_0061286 | 3300053077 | Bacteria | 2388 |
| 206 | Ga0495612_0000024 | 3300053078 | Bacteria | 115718 |
| 207 | Ga0495612_0035578 | 3300053078 | Bacteria | 2019 |
| 208 | Ga0495595_0001620 | 3300053084 | Bacteria | 8793 |
| 209 | Ga0495595_0058783 | 3300053084 | Bacteria | 1796 |
| 210 | Ga0495619_0008132 | 3300053085 | Bacteria | 6637 |
| 211 | Ga0495619_0031810 | 3300053085 | Bacteria | 3420 |
| 212 | Ga0466962_0008409 | 3300061719 | Bacteria | 4945 |
| 213 | Ga0466962_0020481 | 3300061719 | Bacteria | 3178 |
| 214 | Ga0070714_100212465 | |||
| 215 | Ga0070709_10046976 | |||
| 216 | Ga0070714_100073616 | |||
| 217 | Ga0070714_100090564 | |||
| 218 | Ga0070714_100951511 | |||
| 219 | Ga0070713_100000054 | |||
| 220 | Ga0070713_100609677 | |||
| 221 | Ga0070713_100894145 | |||
| 222 | Ga0070710_10000005 | |||
| 223 | Ga0070710_10006362 | |||
| 224 | Ga0070701_10764635 | |||
| 225 | Ga0070711_100046290 | |||
| 226 | Ga0070684_100092258 | |||
| 227 | Ga0068862_100685186 | |||
| 228 | Ga0070717_10062770 | |||
| 229 | Ga0070717_10147439 | |||
| 230 | Ga0070717_10192972 | |||
| 231 | Ga0070716_100105133 | |||
| 232 | Ga0070716_100208172 | |||
| 233 | Ga0070712_100006817 | |||
| 234 | Ga0075431_101155683 | |||
| 235 | Ga0114129_10078917 | |||
| 236 | Ga0213876_10011780 | |||
| 237 | Ga0213876_10049170 | |||
| 238 | Ga0213876_10049235 | |||
| 239 | Ga0213876_10155811 | |||
| 240 | Ga0213875_10000295 | |||
| 241 | Ga0213875_10025510 | |||
| 242 | Ga0213875_10050609 | |||
| 243 | Ga0213875_10050888 | |||
| 244 | Ga0213875_10477268 | |||
| 245 | Ga0207692_10000009 | |||
| 246 | Ga0207692_10009787 | |||
| 247 | Ga0207692_10693048 | |||
| 248 | Ga0207699_10061784 | |||
| 249 | Ga0207693_10004443 | |||
| 250 | Ga0207663_10028798 | |||
| 251 | Ga0207663_10272280 | |||
| 252 | Ga0207663_10847823 | |||
| 253 | Ga0207700_10000007 | |||
| 254 | Ga0207700_10036003 | |||
| 255 | Ga0207700_10851340 | |||
| 256 | Ga0207700_10943202 | |||
| 257 | Ga0207700_11469581 | |||
| 258 | Ga0207664_10023403 | |||
| 259 | Ga0207664_10126026 | |||
| 260 | Ga0207664_10790617 | |||
| 261 | Ga0207665_10252853 | |||
| 262 | Ga0207661_10038631 | |||
| 263 | Ga0207674_10304602 | |||
| 264 | Ga0265319_1061625 | |||
| 265 | Ga0265327_10038164 | |||
| 266 | Ga0373934_0222794 | |||
| 267 | Ga0373954_0030512 | |||
| 268 | Ga0373924_0203194 | |||
| 269 | Ga0373933_0077088 | |||
| 270 | Ga0373937_0006697 | |||
| 271 | Ga0373937_0035006 | |||
| 272 | Ga0373937_1262583 | |||
| 273 | Ga0436364_0162095 | |||
| 274 | Ga0436364_0253846 | |||
| 275 | Ga0436364_0315879 | |||
| 276 | Ga0436364_0442148 | |||
| 277 | Ga0436364_0598093 | |||
| 278 | Ga0436364_0631287 | |||
| 279 | Ga0436364_0714562 | |||
| 280 | Ga0436364_0744587 | |||
| 281 | Ga0436364_0818586 | |||
| 282 | Ga0436364_0839845 | |||
| 283 | Ga0436364_1040378 | |||
| 284 | Ga0436364_1241338 | |||
| 285 | Ga0436364_1246015 | |||
| 286 | Ga0436364_1510503 | |||
| 287 | Ga0436365_0163049 | |||
| 288 | Ga0436365_0284305 | |||
| 289 | Ga0436365_0647108 | |||
| 290 | Ga0436365_0769121 | |||
| 291 | Ga0436365_0771186 | |||
| 292 | Ga0436365_0850482 | |||
| 293 | Ga0436365_0936457 | |||
| 294 | Ga0436365_1299385 | |||
| 295 | Ga0436365_1391403 | |||
| 296 | Ga0436365_1431910 | |||
| 297 | Ga0436365_1566558 | |||
| 298 | Ga0436365_1609374 | |||
| 299 | Ga0436365_1880796 | |||
| 300 | Ga0436365_1933145 | |||
| 301 | Ga0436363_0312381 | |||
| 302 | Ga0436363_0712204 | |||
| 303 | Ga0436363_0770708 | |||
| 304 | Ga0436363_0831202 | |||
| 305 | Ga0436363_0863709 | |||
| 306 | Ga0436363_1459379 | |||
| 307 | Ga0436363_1581029 | |||
| 308 | Ga0436362_0592435 | |||
| 309 | Ga0436362_0897257 | |||
| 310 | Ga0436362_0986102 | |||
| 311 | Ga0436362_1025176 | |||
| 312 | Ga0466969_0171655 | |||
| 313 | Ga0466969_0253927 | |||
| 314 | Ga0466966_0044981 | |||
| 315 | Ga0466966_0328589 | |||
| 316 | Ga0466966_0332990 | |||
| 317 | Ga0466966_0380806 | |||
| 318 | Ga0466966_0470522 | |||
| 319 | Ga0466961_0012381 | |||
| 320 | Ga0466961_0100590 | |||
| 321 | Ga0466961_0118260 | |||
| 322 | Ga0466961_0394707 | |||
| 323 | Ga0466963_0001928 | |||
| 324 | Ga0466963_0002720 | |||
| 325 | Ga0466963_0147008 | |||
| 326 | Ga0466963_0156848 | |||
| 327 | Ga0466963_0189259 | |||
| 328 | Ga0466971_0120856 | |||
| 329 | Ga0466968_0018431 | |||
| 330 | Ga0466968_0037335 | |||
| 331 | Ga0466968_0042005 | |||
| 332 | Ga0466968_0140000 | |||
| 333 | Ga0466968_0179086 | |||
| 334 | Ga0466968_0193614 | |||
| 335 | Ga0466970_0255212 | |||
| 336 | Ga0466970_0261233 | |||
| 337 | Ga0466970_0445266 | |||
| 338 | Ga0466957_0013376 | |||
| 339 | Ga0466957_0065478 | |||
| 340 | Ga0466957_0164868 | |||
| 341 | Ga0466957_0638103 | |||
| 342 | Ga0466957_0764855 | |||
| 343 | Ga0466957_0843373 | |||
| 344 | Ga0466959_0000366 | |||
| 345 | Ga0466959_0001951 | |||
| 346 | Ga0466959_0058757 | |||
| 347 | Ga0466959_0104434 | |||
| 348 | Ga0466959_0151489 | |||
| 349 | Ga0466959_0174217 | |||
| 350 | Ga0466959_0195204 | |||
| 351 | Ga0466959_0202965 | |||
| 352 | Ga0466958_0001874 | |||
| 353 | Ga0466958_0015222 | |||
| 354 | Ga0466958_0024550 | |||
| 355 | Ga0466958_0080309 | |||
| 356 | Ga0466958_0329871 | |||
| 357 | Ga0466958_0500236 | |||
| 358 | Ga0466958_0792396 | |||
| 359 | Ga0466967_0127043 | |||
| 360 | Ga0466967_0840806 | |||
| 361 | Ga0466967_2552731 | |||
| 362 | Ga0466967_2586814 | |||
| 363 | Ga0495592_0017507 | |||
| 364 | Ga0495629_0105966 | |||
| 365 | Ga0495641_0221218 | |||
| 366 | Ga0495651_0014711 | |||
| 367 | Ga0495653_0008394 | |||
| 368 | Ga0495664_0216088 | |||
| 369 | Ga0495664_0693645 | |||
| 370 | Ga0495608_0004947 | |||
| 371 | Ga0495608_0038687 | |||
| 372 | Ga0495618_0018503 | |||
| 373 | Ga0495628_0007385 | |||
| 374 | Ga0495628_0318388 | |||
| 375 | Ga0495630_0339482 | |||
| 376 | Ga0495652_0005691 | |||
| 377 | Ga0495640_0007225 | |||
| 378 | Ga0495587_0056846 | |||
| 379 | Ga0495587_0386367 | |||
| 380 | Ga0495645_0096800 | |||
| 381 | Ga0495667_0014157 | |||
| 382 | Ga0495667_0810533 | |||
| 383 | Ga0495634_0110836 | |||
| 384 | Ga0495635_0005712 | |||
| 385 | Ga0495657_0002697 | |||
| 386 | Ga0495599_0055550 | |||
| 387 | Ga0495623_0020508 | |||
| 388 | Ga0495646_0034939 | |||
| 389 | Ga0495613_0000565 | |||
| 390 | Ga0495613_0368821 | |||
| 391 | Ga0495600_0001576 | |||
| 392 | Ga0495600_0035228 | |||
| 393 | Ga0495581_0169176 | |||
| 394 | Ga0495604_0002306 | |||
| 395 | Ga0495604_0097136 | |||
| 396 | Ga0495674_0012279 | |||
| 397 | Ga0495674_0231669 | |||
| 398 | Ga0495680_0008054 | |||
| 399 | Ga0495680_0324139 | |||
| 400 | Ga0495675_0033366 | |||
| 401 | Ga0495684_0036759 | |||
| 402 | Ga0495593_0048186 | |||
| 403 | Ga0495593_0085524 | |||
| 404 | Ga0495593_0282853 | |||
| 405 | Ga0495602_0034151 | |||
| 406 | Ga0496105_0154255 | |||
| 407 | Ga0496105_1055666 | |||
| 408 | Ga0496108_1312819 | |||
| 409 | Ga0496108_1670368 | |||
| 410 | Ga0496109_0561021 | |||
| 411 | Ga0496109_0954319 | |||
| 412 | Ga0496111_0333839 | |||
| 413 | Ga0496112_0020711 | |||
| 414 | Ga0496113_0039142 | |||
| 415 | Ga0496114_0166590 | |||
| 416 | nmdc:mga06r32_1233645_c1 | |||
| 417 | Ga0495601_0024453 | |||
| 418 | Ga0495601_0061286 | |||
| 419 | Ga0495612_0000024 | |||
| 420 | Ga0495612_0035578 | |||
| 421 | Ga0495595_0001620 | |||
| 422 | Ga0495595_0058783 | |||
| 423 | Ga0495619_0008132 | |||
| 424 | Ga0495619_0031810 | |||
| 425 | Ga0466962_0008409 | |||
| 426 | Ga0466962_0020481 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e19-assembly2.cif.gz_B | crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 | 0.986 | 1 | 131 |
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9773 | 1 | 130 |
| 3hst-assembly2.cif.gz_B | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9726 | 1 | 132 |
| 4e19-assembly2.cif.gz_B | crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 | 0.9713 | 1 | 131 |
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9628 | 1 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e19A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9842 | 2 | 131 | 3.30.420.10 |
| af_A0A0R0FBC1_213_345_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.983 | 3 | 130 | 3.30.420.10 |
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9773 | 1 | 130 | 3.30.420.10 |
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9628 | 1 | 130 | 3.30.420.10 |
| 3u3gA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9536 | 2 | 132 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V5L929-F1-model_v4 | 14.7 kDa ribonuclease H-like protein | 0.9983 | 2 | 130 |
GO:0003676
GO:0004523 |
| AF-A0A7V2UG45-F1-model_v4 | Ribonuclease HI family protein | 0.9945 | 2 | 131 |
GO:0003676
GO:0004523 |
| AF-A0A0F0CJ98-F1-model_v4 | Ribonuclease HI | 0.9929 | 2 | 132 |
GO:0003676
GO:0004523 |
| AF-A0A1F2QF74-F1-model_v4 | RNase H type-1 domain-containing protein | 0.9929 | 2 | 130 |
GO:0003676
GO:0004523 |
| AF-A0A1F8P2N9-F1-model_v4 | RNase H type-1 domain-containing protein | 0.9926 | 1 | 131 |
GO:0003676
GO:0004523 |