F323150

General Info

Members Datasets Scaffolds Average Seq Length
212 124 424 272

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0031192|Ga0451577_0031192_1730_2605
Length 291
Sequence MRSGVKTATRVPSGGLAMAMLSFERKYRVRGGTLIGGDLFDFWVGPFYVGFFGVTTLFFSVLGTALIVYGAAIGPTWNLWQISIAPPDLKYGLALAPLREGGLWQLITLCALGAFGSWALREVEICRKLGIGLHVPIAFSFAILAYFVLVVVRPFLLGAWGHGFPYGIFSHLDWVSNVGYQHLHFHYNPAHMLGVTFFFTTTLALSLHGAMILSVMNPAKGEAVKGAEHENTFFRDAIGYSIGALGIHRLGLFLAISAAFWSAVCIVISGPFWTRGWPEWWNXXLDLPIWR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
9 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
10 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
13 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
16 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
17 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
20 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
43 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
58 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
76 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
95 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
96 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
97 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
98 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
99 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
100 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
101 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
102 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
103 2512875024
104 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
105 2643221585 Pelomonas sp. Root662 Isolate Unclassified
106 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
107 2643221656 Pelomonas sp. Root405 Isolate Unclassified
108 2643221660 Methylibium sp. Root1272 Isolate Unclassified
109 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
110 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
111 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
112 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
113 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
114 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
115 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
116 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
117 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
118 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
119 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
120 2902330777 Methylobacterium sp. 2A Isolate Unclassified
121 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
122 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
123 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
124 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.79
Metatranscriptomes 2.83
Isolates 10.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 1.42
Rhizoplane 0.94
Rhizosphere 71.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0031192 3300042876 Bacteria 4810
2 rootH1_10095054 3300003316 Bacteria 3284
3 Ga0070669_100077622 3300005353 Bacteria 2468
4 Ga0070671_100043058 3300005355 Bacteria 3754
5 Ga0070678_100123993 3300005456 Bacteria 2042
6 Ga0070665_100003595 3300005548 Bacteria 16416
7 Ga0070665_100114294 3300005548 Bacteria 2702
8 Ga0075365_10013222 3300006038 Bacteria 4926
9 Ga0068871_100144015 3300006358 Bacteria 2028
10 Ga0105240_10014435 3300009093 Bacteria 10786
11 Ga0105248_10042613 3300009177 Bacteria 5091
12 Ga0105238_10533448 3300009551 Bacteria 1177
13 Ga0105239_10206957 3300010375 Bacteria 2199
14 Ga0105239_10535704 3300010375 Bacteria 1333
15 Ga0163163_10146097 3300014325 Bacteria 2408
16 Ga0163163_10395546 3300014325 Bacteria 1440
17 Ga0182008_10036083 3300014497 Bacteria 2474
18 Ga0182008_10083358 3300014497 Bacteria 1574
19 Ga0163161_10086596 3300017792 Bacteria 2312
20 Ga0213873_10014375 3300021358 Bacteria 1753
21 Ga0213874_10006325 3300021377 Bacteria 2802
22 Ga0213874_10037900 3300021377 Bacteria 1429
23 Ga0213876_10121256 3300021384 Bacteria 1388
24 Ga0213876_10138528 3300021384 Bacteria 1294
25 Ga0213875_10019028 3300021388 Bacteria 3305
26 Ga0213875_10022971 3300021388 Bacteria 2982
27 Ga0213875_10045028 3300021388 Bacteria 2071
28 Ga0213871_10010017 3300021441 Bacteria 2139
29 Ga0207657_10064741 3300025919 Bacteria 3119
30 Ga0207681_10062983 3300025923 Bacteria 2556
31 Ga0207687_10438955 3300025927 Bacteria 1081
32 Ga0207644_10016683 3300025931 Bacteria 4945
33 Ga0207711_10124701 3300025941 Bacteria 2303
34 Ga0207651_10074145 3300025960 Bacteria 2423
35 Ga0207683_10140526 3300026121 Bacteria 2176
36 Ga0209996_1002628 3300027395 Bacteria 2231
37 Ga0209995_1024790 3300027471 Bacteria 999
38 Ga0209968_1005932 3300027526 Bacteria 1838
39 Ga0209966_1000177 3300027695 Bacteria 26013
40 Ga0268266_10006125 3300028379 Bacteria 11074
41 Ga0268266_10089248 3300028379 Bacteria 2699
42 Ga0268266_10092002 3300028379 Bacteria 2661
43 Ga0268266_10365754 3300028379 Bacteria 1358
44 Ga0265326_10005747 3300028558 Bacteria 3898
45 Ga0265319_1003520 3300028563 Bacteria 8134
46 Ga0265334_10000294 3300028573 Bacteria 27911
47 Ga0265318_10000555 3300028577 Bacteria 26355
48 Ga0265338_10080856 3300028800 Bacteria 2728
49 Ga0265330_10000756 3300031235 Bacteria 20349
50 Ga0265332_10001180 3300031238 Bacteria 15121
51 Ga0265332_10007422 3300031238 Bacteria 4955
52 Ga0265328_10000030 3300031239 Bacteria 109595
53 Ga0265328_10004241 3300031239 Bacteria 6236
54 Ga0265328_10011333 3300031239 Bacteria 3567
55 Ga0265328_10024067 3300031239 Bacteria 2303
56 Ga0265320_10020683 3300031240 Bacteria 3559
57 Ga0265325_10013678 3300031241 Bacteria 4611
58 Ga0265329_10006514 3300031242 Bacteria 4623
59 Ga0265340_10000960 3300031247 Bacteria 16413
60 Ga0265339_10005061 3300031249 Bacteria 8853
61 Ga0265331_10001233 3300031250 Bacteria 19228
62 Ga0265331_10003057 3300031250 Bacteria 10981
63 Ga0265331_10004445 3300031250 Bacteria 8758
64 Ga0265327_10000613 3300031251 Bacteria 58852
65 Ga0265327_10007777 3300031251 Bacteria 8177
66 Ga0265327_10031558 3300031251 Bacteria 2974
67 Ga0265327_10094390 3300031251 Bacteria 1454
68 Ga0265316_10005010 3300031344 Bacteria 13004
69 Ga0265316_10021791 3300031344 Bacteria 5418
70 Ga0316575_10001186 3300031665 Bacteria 8215
71 Ga0316579_10012026 3300031691 Bacteria 3694
72 Ga0265314_10003681 3300031711 Bacteria 14706
73 Ga0265342_10000087 3300031712 Bacteria 100045
74 Ga0265342_10001283 3300031712 Bacteria 23626
75 Ga0316576_10000993 3300031727 Bacteria 14601
76 Ga0316576_10014613 3300031727 Bacteria 5247
77 Ga0316576_10021017 3300031727 Bacteria 4506
78 Ga0316576_10035271 3300031727 Bacteria 3570
79 Ga0316576_10035563 3300031727 Bacteria 3556
80 Ga0316576_10042225 3300031727 Bacteria 3286
81 Ga0316576_10055837 3300031727 Bacteria 2883
82 Ga0316576_10158957 3300031727 Bacteria 1704
83 Ga0316576_10183050 3300031727 Bacteria 1580
84 Ga0316578_10014007 3300031728 Bacteria 4269
85 Ga0316578_10033451 3300031728 Bacteria 2945
86 Ga0316577_10018401 3300031733 Bacteria 3863
87 Ga0316583_10001615 3300032133 Bacteria 7611
88 Ga0316585_10000307 3300032137 Bacteria 10900
89 Ga0316580_10001892 3300032139 Bacteria 5624
90 Ga0307510_10001789 3300033180 Bacteria 23995
91 Ga0307510_10011856 3300033180 Bacteria 10340
92 Ga0316592_1001336 3300033524 Bacteria 3936
93 Ga0316586_1000194 3300033527 Bacteria 5085
94 Ga0316588_1001122 3300033528 Bacteria 4253
95 Ga0316588_1001907 3300033528 Bacteria 3547
96 Ga0316588_1012519 3300033528 Bacteria 1829
97 Ga0316596_1003322 3300033541 Bacteria 3511
98 Ga0316574_0002607 3300035398 Bacteria 9084
99 Ga0316574_0006354 3300035398 Bacteria 6381
100 Ga0316574_0028830 3300035398 Bacteria 3350
101 Ga0316574_0032035 3300035398 Bacteria 3193
102 Ga0316574_0060594 3300035398 Bacteria 2376
103 Ga0316574_0074427 3300035398 Bacteria 2149
104 Ga0316574_0115250 3300035398 Bacteria 1723
105 Ga0316574_0122803 3300035398 Bacteria 1668
106 Ga0373931_0007452 3300035691 Bacteria 5155
107 Ga0316582_0001114 3300036647 Bacteria 11386
108 Ga0316584_0001453 3300036712 Bacteria 14202
109 Ga0316584_0003889 3300036712 Bacteria 9804
110 Ga0316584_0008974 3300036712 Bacteria 6915
111 Ga0316584_0012466 3300036712 Bacteria 5994
112 Ga0316584_0023352 3300036712 Bacteria 4519
113 Ga0316584_0032371 3300036712 Bacteria 3871
114 Ga0316584_0033895 3300036712 Bacteria 3783
115 Ga0316584_0137284 3300036712 Bacteria 1825
116 Ga0316584_0317385 3300036712 Bacteria 1125
117 Ga0316581_0000420 3300037588 Bacteria 7984
118 Ga0436364_0081027 3300037853 Bacteria 1304
119 Ga0436364_0283370 3300037853 Bacteria 8826
120 Ga0436364_0328296 3300037853 Bacteria 143298
121 Ga0436364_0731834 3300037853 Bacteria 14258
122 Ga0436364_1329069 3300037853 Bacteria 3023
123 Ga0400483_027220 3300039062 Bacteria 17756
124 Ga0400483_035602 3300039062 Bacteria 2195
125 Ga0400483_229332 3300039062 Bacteria 17573
126 Ga0400483_252191 3300039062 Bacteria 2777
127 Ga0400483_255247 3300039062 Bacteria 1781
128 Ga0436365_0201900 3300039437 Bacteria 6641
129 Ga0436365_1074871 3300039437 Bacteria 2632
130 Ga0436365_1159328 3300039437 Bacteria 27033
131 Ga0436365_1414258 3300039437 Bacteria 2043
132 Ga0436360_0584967 3300039438 Bacteria 5498
133 Ga0436360_0968550 3300039438 Bacteria 8130
134 Ga0436360_1011476 3300039438 Bacteria 2133
135 Ga0436363_0059956 3300039450 Bacteria 5395
136 Ga0436363_0188016 3300039450 Bacteria 1643
137 Ga0436363_1105668 3300039450 Bacteria 1714
138 Ga0436362_0710022 3300039453 Bacteria 5671
139 Ga0451835_0552553 3300041492 Bacteria 1202
140 Ga0451841_0896654 3300041498 Bacteria 974
141 Ga0451577_0000001 3300042876 Bacteria 2461803
142 Ga0451577_0003136 3300042876 Bacteria 18631
143 Ga0451577_0007153 3300042876 Bacteria 11006
144 Ga0451577_0027182 3300042876 Bacteria 5179
145 Ga0451577_0027554 3300042876 Bacteria 5143
146 Ga0451577_0047676 3300042876 Bacteria 3830
147 Ga0451577_0074600 3300042876 Bacteria 3025
148 Ga0451577_0088580 3300042876 Bacteria 2761
149 Ga0451577_0100264 3300042876 Bacteria 2587
150 Ga0451577_0192176 3300042876 Bacteria 1841
151 Ga0451577_0546317 3300042876 Bacteria 1052
152 Ga0453684_0024534 3300044712 Bacteria 8809
153 Ga0453684_0037005 3300044712 Bacteria 6708
154 Ga0453684_0113128 3300044712 Bacteria 3293
155 Ga0453684_0114553 3300044712 Bacteria 3268
156 Ga0453684_0142618 3300044712 Bacteria 2858
157 Ga0453684_0160178 3300044712 Bacteria 2663
158 Ga0453684_0176963 3300044712 Bacteria 2508
159 Ga0451576_0001939 3300045051 Bacteria 33033
160 Ga0451576_0002463 3300045051 Bacteria 27547
161 Ga0451576_0010324 3300045051 Bacteria 10723
162 Ga0451576_0064715 3300045051 Bacteria 3808
163 Ga0451576_0073567 3300045051 Bacteria 3556
164 Ga0451576_0084179 3300045051 Bacteria 3308
165 Ga0451576_0330322 3300045051 Bacteria 1596
166 Ga0451576_0748113 3300045051 Bacteria 1027
167 Ga0495651_0359963 3300046462 Bacteria 959
168 Ga0495650_0012241 3300046471 Bacteria 4628
169 Ga0495606_0222759 3300046507 Bacteria 1062
170 Ga0495608_0091528 3300046511 Bacteria 1967
171 Ga0495684_0181945 3300047471 Bacteria 1558
172 Ga0495686_0003692 3300047472 Bacteria 13079
173 Ga0496108_0015732 3300048911 Bacteria 6169
174 Ga0496113_0169266 3300048916 Bacteria 1730
175 Ga0496124_0036306 3300048927 Bacteria 4301
176 Ga0501300_001420 3300049523 Bacteria 3585
177 Ga0501070_0002177 3300049586 Bacteria 17230
178 Ga0501080_0045399 3300049742 Bacteria 4090
179 Ga0501280_000887 3300049776 Bacteria 6403
180 Ga0501035_0000398 3300049822 Bacteria 49830
181 nmdc:mga0yw44_1065_c1 3300050492 Bacteria 10532
182 Ga0500635_0000034 3300053080 Bacteria 96919
183 Ga0495595_0055330 3300053084 Bacteria 1847
184 Ga0500644_0002238 3300053088 Bacteria 4880
185 Ga0500647_0016395 3300053091 Bacteria 3404
186 Ga0500651_0038479 3300053093 Bacteria 3013
187 Ga0500594_0000395 3300053118 Bacteria 9720
188 Ga0500559_0000109 3300053136 Bacteria 65246
189 Ga0500622_0009115 3300053156 Bacteria 5509
190 Ga0500587_000283 3300053739 Bacteria 5628
191 2512963783 2512875024 Bacteria 7195110
192 2545674149 2545555834 Bacteria 8130841
193 2643937269 2643221585 Bacteria 5812563
194 2644301543 2643221654 Bacteria 5273570
195 2644318434 2643221656 Bacteria 5809961
196 2644338234 2643221660 Bacteria 4208257
197 2738708819 2738541275 Bacteria 4830863
198 2738744073 2738541281 Bacteria 5112672
199 2738847244 2738541301 Bacteria 4834102
200 2738862973 2738541304 Bacteria 4833665
201 2739295491 2738543022 Bacteria 4835059
202 2739353303 2738543032 Bacteria 5115625
203 2739357169 2738543033 Bacteria 4833336
204 2829748413 2829745981 Bacteria 5406054
205 2842700556 2842698319 Bacteria 5190321
206 2861693246 2861691609 Bacteria 5628931
207 2894773969 2894772417 Bacteria 5305674
208 2902331646 2902330777 Bacteria 6395352
209 2928102427 2928100450 Bacteria 4837635
210 2928961070 2928959182 Bacteria 4725774
211 3003666922 3003665799 Bacteria 7279786
212 641643874 641522639 Bacteria 7737025
213 Ga0451577_0031192
214 rootH1_10095054
215 Ga0070669_100077622
216 Ga0070671_100043058
217 Ga0070678_100123993
218 Ga0070665_100003595
219 Ga0070665_100114294
220 Ga0075365_10013222
221 Ga0068871_100144015
222 Ga0105240_10014435
223 Ga0105248_10042613
224 Ga0105238_10533448
225 Ga0105239_10206957
226 Ga0105239_10535704
227 Ga0163163_10146097
228 Ga0163163_10395546
229 Ga0182008_10036083
230 Ga0182008_10083358
231 Ga0163161_10086596
232 Ga0213873_10014375
233 Ga0213874_10006325
234 Ga0213874_10037900
235 Ga0213876_10121256
236 Ga0213876_10138528
237 Ga0213875_10019028
238 Ga0213875_10022971
239 Ga0213875_10045028
240 Ga0213871_10010017
241 Ga0207657_10064741
242 Ga0207681_10062983
243 Ga0207687_10438955
244 Ga0207644_10016683
245 Ga0207711_10124701
246 Ga0207651_10074145
247 Ga0207683_10140526
248 Ga0209996_1002628
249 Ga0209995_1024790
250 Ga0209968_1005932
251 Ga0209966_1000177
252 Ga0268266_10006125
253 Ga0268266_10089248
254 Ga0268266_10092002
255 Ga0268266_10365754
256 Ga0265326_10005747
257 Ga0265319_1003520
258 Ga0265334_10000294
259 Ga0265318_10000555
260 Ga0265338_10080856
261 Ga0265330_10000756
262 Ga0265332_10001180
263 Ga0265332_10007422
264 Ga0265328_10000030
265 Ga0265328_10004241
266 Ga0265328_10011333
267 Ga0265328_10024067
268 Ga0265320_10020683
269 Ga0265325_10013678
270 Ga0265329_10006514
271 Ga0265340_10000960
272 Ga0265339_10005061
273 Ga0265331_10001233
274 Ga0265331_10003057
275 Ga0265331_10004445
276 Ga0265327_10000613
277 Ga0265327_10007777
278 Ga0265327_10031558
279 Ga0265327_10094390
280 Ga0265316_10005010
281 Ga0265316_10021791
282 Ga0316575_10001186
283 Ga0316579_10012026
284 Ga0265314_10003681
285 Ga0265342_10000087
286 Ga0265342_10001283
287 Ga0316576_10000993
288 Ga0316576_10014613
289 Ga0316576_10021017
290 Ga0316576_10035271
291 Ga0316576_10035563
292 Ga0316576_10042225
293 Ga0316576_10055837
294 Ga0316576_10158957
295 Ga0316576_10183050
296 Ga0316578_10014007
297 Ga0316578_10033451
298 Ga0316577_10018401
299 Ga0316583_10001615
300 Ga0316585_10000307
301 Ga0316580_10001892
302 Ga0307510_10001789
303 Ga0307510_10011856
304 Ga0316592_1001336
305 Ga0316586_1000194
306 Ga0316588_1001122
307 Ga0316588_1001907
308 Ga0316588_1012519
309 Ga0316596_1003322
310 Ga0316574_0002607
311 Ga0316574_0006354
312 Ga0316574_0028830
313 Ga0316574_0032035
314 Ga0316574_0060594
315 Ga0316574_0074427
316 Ga0316574_0115250
317 Ga0316574_0122803
318 Ga0373931_0007452
319 Ga0316582_0001114
320 Ga0316584_0001453
321 Ga0316584_0003889
322 Ga0316584_0008974
323 Ga0316584_0012466
324 Ga0316584_0023352
325 Ga0316584_0032371
326 Ga0316584_0033895
327 Ga0316584_0137284
328 Ga0316584_0317385
329 Ga0316581_0000420
330 Ga0436364_0081027
331 Ga0436364_0283370
332 Ga0436364_0328296
333 Ga0436364_0731834
334 Ga0436364_1329069
335 Ga0400483_027220
336 Ga0400483_035602
337 Ga0400483_229332
338 Ga0400483_252191
339 Ga0400483_255247
340 Ga0436365_0201900
341 Ga0436365_1074871
342 Ga0436365_1159328
343 Ga0436365_1414258
344 Ga0436360_0584967
345 Ga0436360_0968550
346 Ga0436360_1011476
347 Ga0436363_0059956
348 Ga0436363_0188016
349 Ga0436363_1105668
350 Ga0436362_0710022
351 Ga0451835_0552553
352 Ga0451841_0896654
353 Ga0451577_0000001
354 Ga0451577_0003136
355 Ga0451577_0007153
356 Ga0451577_0027182
357 Ga0451577_0027554
358 Ga0451577_0047676
359 Ga0451577_0074600
360 Ga0451577_0088580
361 Ga0451577_0100264
362 Ga0451577_0192176
363 Ga0451577_0546317
364 Ga0453684_0024534
365 Ga0453684_0037005
366 Ga0453684_0113128
367 Ga0453684_0114553
368 Ga0453684_0142618
369 Ga0453684_0160178
370 Ga0453684_0176963
371 Ga0451576_0001939
372 Ga0451576_0002463
373 Ga0451576_0010324
374 Ga0451576_0064715
375 Ga0451576_0073567
376 Ga0451576_0084179
377 Ga0451576_0330322
378 Ga0451576_0748113
379 Ga0495651_0359963
380 Ga0495650_0012241
381 Ga0495606_0222759
382 Ga0495608_0091528
383 Ga0495684_0181945
384 Ga0495686_0003692
385 Ga0496108_0015732
386 Ga0496113_0169266
387 Ga0496124_0036306
388 Ga0501300_001420
389 Ga0501070_0002177
390 Ga0501080_0045399
391 Ga0501280_000887
392 Ga0501035_0000398
393 nmdc:mga0yw44_1065_c1
394 Ga0500635_0000034
395 Ga0495595_0055330
396 Ga0500644_0002238
397 Ga0500647_0016395
398 Ga0500651_0038479
399 Ga0500594_0000395
400 Ga0500559_0000109
401 Ga0500622_0009115
402 Ga0500587_000283
403 2512963783
404 2545674149
405 2643937269
406 2644301543
407 2644318434
408 2644338234
409 2738708819
410 2738744073
411 2738847244
412 2738862973
413 2739295491
414 2739353303
415 2739357169
416 2829748413
417 2842700556
418 2861693246
419 2894773969
420 2902331646
421 2928102427
422 2928961070
423 3003666922
424 641643874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00124

Photo_RC

Photosynthetic reaction centre protein

47

290

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eqd-assembly1.cif.gz_M structure of photosynthetic lh1-rc super-complex of rhodospirillum rubrum 0.8656 31 253
5b5m-assembly2.cif.gz_y crystal structure of the sr-substituted lh1-rc complex from tch. tepidum 0.8637 32 253
6z5s-assembly1.cif.gz_M rc-lh1(14)-w complex from rhodopseudomonas palustris 0.8625 33 254
7yml-assembly1.cif.gz_M structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus 0.8558 32 253
1eys-assembly1.cif.gz_M crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum 0.8542 32 253
ID Description Score Start End Superfamily
1aijM01 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.8959 33 115 1.20.85.10
1eysM01 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.8876 32 115 1.20.85.10
1jgxM01 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.8831 33 115 1.20.85.10
1pcrM01 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.8759 31 115 1.20.85.10
1jgzM01 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.8725 31 115 1.20.85.10
ID Description Score Start End GO Terms
AF-Q8RN97-F1-model_v4 Photosynthetic reaction center L subunit 0.9892 31 151 GO:0009772
GO:0016020
GO:0042314
GO:0045156
GO:0046872
AF-Q8RN97-F1-model_v4 Photosynthetic reaction center L subunit 0.9732 31 151 GO:0009772
GO:0016020
GO:0042314
GO:0045156
GO:0046872
AF-A0A2Z4EL82-F1-model_v4 Photosynthetic reaction centre subunit M 0.9616 39 157 GO:0009772
GO:0016020
GO:0016168
GO:0045156
GO:0046872
AF-A0A7R7G236-F1-model_v4 M subunit of the light reaction centre complex 0.9493 31 150 GO:0009772
GO:0016020
GO:0042314
GO:0045156
GO:0046872
AF-A0A1D8ELW8-F1-model_v4 Photosynthetic reaction center L subunit 0.9424 83 168 GO:0009772
GO:0016020
GO:0016168
GO:0045156
GO:0046872

Map