F323076

General Info

Members Datasets Scaffolds Average Seq Length
212 169 424 267

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0116768|Ga0395899_0116768_825_1733
Length 302
Sequence MSQRRVDLPPESSSYTSANAPSEGRLPLFILVQLWRFGWQEALSCLFPAAIFAALLLLRIAPIPHVPAYDAMLVVCIVLQWVMVRTKLETLDELKVICVFHLIGLALELYKVHMGSWTYPQDAYTKIGGVPLYSGFMYASVASYLCQAWRRLDVALLHWPRSYWTVPLGAAIYLNFMTHHYIPDLRWWLTALLFVVFFRTVVTFRVGDARYRMPLTLGFLLIGFFVWIAENIGTFLGAWRYPNQEHAWNLVSIGKISSWFLLVIVSFIIVAQLKHVKQGRKQAPGTDAGRSSEASYPRDMGG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
101 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
104 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
105 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
106 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
107 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
108 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
109 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
110 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
111 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
112 2643221731 Bacillus sp. Root147 Isolate Unclassified
113 2643221732 Bacillus sp. Root239 Isolate Unclassified
114 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
115 2671180694 Paenibacillus sp. A3 Isolate Unclassified
116 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
117 2738543010 Bacillus sp. YR335 Isolate Unclassified
118 2738543017 Bacillus sp. OV186 Isolate Unclassified
119 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
120 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
121 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
122 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
123 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
124 2818991441 Niallia circulans 3243 Isolate Rhizosphere
125 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
126 2842682962 Bacillus sp. R-72492 Isolate Unclassified
127 2842882022 Bacillus sp. R-71893 Isolate Unclassified
128 2849139964 Bacillus sp. R-71875 Isolate Unclassified
129 2857581216 Bacillus sp. R-71922 Isolate Unclassified
130 2857586860 Bacillus sp. R-71935 Isolate Unclassified
131 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
132 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
133 2860837431 Bacillus sp. WR11 Isolate Unclassified
134 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
135 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
136 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
137 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
138 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
139 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
140 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
141 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
142 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
143 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
144 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
145 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
146 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
147 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
148 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
149 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
150 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
151 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
152 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
153 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
154 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
155 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
156 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
157 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
158 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
159 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
160 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
161 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
162 8022653035 Bacillus sp. Rc4 Isolate Unclassified
163 8022792930 Bacillus sp. Xin Isolate Rhizosphere
164 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
165 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
166 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
167 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
168 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
169 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.98
Metatranscriptomes 0
Isolates 33.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0.47
Rhizoplane 8.02
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0116768 3300037312 Bacteria 1914
2 JGI24739J22299_10023063 3300001989 Bacteria 2202
3 JGI24739J22299_10024176 3300001989 Bacteria 2144
4 JGI24737J22298_10000984 3300001990 Bacteria 10125
5 JGI24735J21928_10000004 3300002067 Bacteria 381713
6 JGI25162J39368_1000089 3300002737 Bacteria 104054
7 JGI25162J39368_1000614 3300002737 Bacteria 25616
8 JGI25151J46595_10002839 3300003187 Bacteria 9978
9 JGI25151J46595_10004504 3300003187 Bacteria 7362
10 JGI25151J46595_10027142 3300003187 Bacteria 2301
11 JGI25151J46595_10029484 3300003187 Bacteria 2172
12 JGI25165J46597_1002726 3300003214 Bacteria 5214
13 rootH1_10047779 3300003316 Bacteria 4816
14 rootH2_10323693 3300003320 Bacteria 2757
15 rootL2_10087581 3300003322 Bacteria 2686
16 Ga0055532_1000126 3300003758 Bacteria 76489
17 Ga0055532_1001188 3300003758 Bacteria 7826
18 Ga0055532_1003499 3300003758 Bacteria 2662
19 Ga0055535_1005377 3300003761 Bacteria 2825
20 Ga0055541_1000226 3300003841 Bacteria 21639
21 Ga0070658_10000956 3300005327 Bacteria 24688
22 Ga0070660_100196288 3300005339 Unclassified 1636
23 Ga0070663_100000310 3300005455 Bacteria 25165
24 Ga0068853_100000022 3300005539 Bacteria 142647
25 Ga0068857_100149779 3300005577 Bacteria 2113
26 Ga0068854_100012299 3300005578 Bacteria 5601
27 Ga0068856_100028642 3300005614 Bacteria 5441
28 Ga0068860_100144510 3300005843 Unclassified 2288
29 Ga0105244_10095657 3300009036 Bacteria 1457
30 Ga0105240_10364585 3300009093 Bacteria 1635
31 Ga0105237_10001497 3300009545 Bacteria 30756
32 Ga0105237_10009703 3300009545 Bacteria 10299
33 Ga0105239_10000999 3300010375 Bacteria 39639
34 Ga0157371_10002190 3300013102 Bacteria 18963
35 Ga0157371_10019909 3300013102 Bacteria 4944
36 Ga0157369_10000393 3300013105 Bacteria 58167
37 Ga0157374_10464663 3300013296 Bacteria 1267
38 Ga0157372_10000034 3300013307 Bacteria 174784
39 Ga0157372_10010741 3300013307 Bacteria 9747
40 Ga0157372_10016679 3300013307 Bacteria 7884
41 Ga0157377_10078463 3300014745 Bacteria 1925
42 Ga0157379_10019083 3300014968 Bacteria 6055
43 Ga0163161_10025903 3300017792 Bacteria 4153
44 Ga0209566_100035 3300025225 Bacteria 314893
45 Ga0209147_100042 3300025229 Bacteria 301263
46 Ga0209147_100182 3300025229 Bacteria 76541
47 Ga0209147_101079 3300025229 Bacteria 11475
48 Ga0207427_100103 3300025231 Bacteria 119618
49 Ga0209437_100101 3300025233 Bacteria 226668
50 Ga0209437_100221 3300025233 Bacteria 104135
51 Ga0209258_106561 3300025242 Bacteria 1811
52 Ga0209233_1000124 3300025261 Bacteria 226743
53 Ga0209673_1014765 3300025273 Bacteria 3007
54 Ga0209025_1003012 3300025294 Bacteria 16658
55 Ga0209025_1006283 3300025294 Bacteria 9290
56 Ga0209025_1006685 3300025294 Bacteria 8853
57 Ga0209025_1011774 3300025294 Bacteria 5705
58 Ga0209025_1013788 3300025294 Bacteria 5044
59 Ga0209025_1041071 3300025294 Bacteria 1988
60 Ga0207655_1008935 3300025728 Bacteria 6288
61 Ga0207713_1009677 3300025735 Bacteria 5404
62 Ga0207685_10242786 3300025905 Bacteria 867
63 Ga0207705_10002841 3300025909 Bacteria 13243
64 Ga0207695_10270225 3300025913 Bacteria 1596
65 Ga0207671_10002034 3300025914 Bacteria 22208
66 Ga0207671_10005705 3300025914 Bacteria 11371
67 Ga0207671_10006458 3300025914 Bacteria 10439
68 Ga0207667_10017757 3300025949 Bacteria 8002
69 Ga0207640_10054901 3300025981 Bacteria 2607
70 Ga0207639_10000002 3300026041 Bacteria 903066
71 Ga0207702_10227966 3300026078 Bacteria 1739
72 Ga0207674_10169782 3300026116 Bacteria 2135
73 Ga0268264_10190166 3300028381 Unclassified 1871
74 Ga0307517_10043849 3300028786 Bacteria 4750
75 Ga0307408_100000542 3300031548 Bacteria 32556
76 Ga0307408_100373649 3300031548 Bacteria 1216
77 Ga0307405_10562195 3300031731 Bacteria 925
78 Ga0307416_100042727 3300032002 Bacteria 3542
79 Ga0307416_100200021 3300032002 Bacteria 1895
80 Ga0307416_100481751 3300032002 Bacteria 1301
81 Ga0307510_10029794 3300033180 Bacteria 6203
82 Ga0395899_0000182 3300037312 Bacteria 92470
83 Ga0395899_0101075 3300037312 Bacteria 2081
84 Ga0395900_0199606 3300037418 Bacteria 2025
85 Ga0439449_0081636 3300042007 Bacteria 1192
86 Ga0466969_0003049 3300044656 Bacteria 8931
87 Ga0466966_0011419 3300044684 Bacteria 5891
88 Ga0466961_0018532 3300044693 Bacteria 4479
89 Ga0466959_0015655 3300045049 Bacteria 5529
90 Ga0495650_0000132 3300046471 Bacteria 174226
91 Ga0495583_0042257 3300046506 Bacteria 2130
92 Ga0495606_0000100 3300046507 Bacteria 147592
93 Ga0495606_0004289 3300046507 Bacteria 14369
94 Ga0495610_0001613 3300046512 Bacteria 19831
95 Ga0495610_0015285 3300046512 Bacteria 4467
96 Ga0495616_0004320 3300046513 Bacteria 8974
97 Ga0495631_0091566 3300046518 Bacteria 1309
98 Ga0495632_0079611 3300046519 Bacteria 1564
99 Ga0495633_0008919 3300046558 Bacteria 5591
100 Ga0495668_0056520 3300046616 Bacteria 2166
101 Ga0495625_0000036 3300046660 Bacteria 221680
102 Ga0495625_0027565 3300046660 Bacteria 4274
103 Ga0495625_0261314 3300046660 Bacteria 1120
104 Ga0495669_0164792 3300046684 Bacteria 1053
105 Ga0495671_0082107 3300046692 Bacteria 1579
106 Ga0495649_0000017 3300046694 Bacteria 221685
107 Ga0495683_0052236 3300047323 Bacteria 2041
108 Ga0495683_0149602 3300047323 Bacteria 1088
109 Ga0495687_001261 3300047443 Bacteria 23987
110 Ga0496100_0029946 3300048903 Bacteria 3371
111 Ga0496102_0109023 3300048905 Bacteria 2579
112 Ga0496103_0045097 3300048906 Bacteria 2719
113 Ga0496104_0070430 3300048907 Bacteria 3324
114 Ga0496104_0216284 3300048907 Bacteria 1828
115 Ga0496105_0001971 3300048908 Bacteria 14768
116 Ga0496106_0004898 3300048909 Bacteria 9913
117 Ga0496107_0008218 3300048910 Bacteria 7218
118 Ga0496108_0001083 3300048911 Bacteria 21241
119 Ga0496109_0042809 3300048912 Bacteria 4103
120 Ga0496110_0019076 3300048913 Bacteria 5765
121 Ga0496110_0040388 3300048913 Bacteria 4066
122 Ga0496111_0000453 3300048914 Bacteria 20871
123 Ga0496111_0054561 3300048914 Bacteria 2889
124 Ga0496112_0029620 3300048915 Bacteria 5294
125 Ga0496118_0076267 3300048921 Bacteria 2385
126 Ga0496119_0009419 3300048922 Bacteria 8386
127 Ga0496119_0011249 3300048922 Bacteria 7443
128 Ga0496120_0000644 3300048923 Bacteria 51437
129 Ga0496122_0007692 3300048925 Bacteria 11879
130 Ga0496122_0060615 3300048925 Bacteria 2785
131 Ga0496123_0123341 3300048926 Bacteria 1452
132 Ga0496123_0174082 3300048926 Bacteria 1132
133 Ga0496124_0000062 3300048927 Bacteria 232676
134 Ga0496124_0138276 3300048927 Bacteria 1926
135 Ga0496125_0071578 3300048928 Bacteria 2707
136 Ga0496126_0000250 3300048929 Bacteria 116245
137 Ga0496126_0001176 3300048929 Bacteria 43034
138 Ga0496126_0032756 3300048929 Bacteria 4893
139 Ga0495678_014355 3300049459 Bacteria 3685
140 nmdc:mga0k408_17942_c1 3300050493 Bacteria 3945
141 Ga0500635_0028687 3300053080 Bacteria 1780
142 Ga0500608_000829 3300053122 Bacteria 11186
143 2511179768 2510917027 Bacteria 5287437
144 2512639110 2512564013 Bacteria 6286191
145 2524189736 2524023129 Bacteria 6762600
146 2573038952 2571042588 Bacteria 5045676
147 2578334699 2576861424 Bacteria 5270569
148 2580934772 2579778775 Bacteria 5360914
149 2595089384 2593339131 Bacteria 5116855
150 2599478374 2599185184 Bacteria 6430550
151 2621272726 2619619294 Bacteria 5575484
152 2644717886 2643221731 Bacteria 5623886
153 2644724788 2643221732 Bacteria 5756404
154 2672337523 2671180330 Bacteria 5521719
155 2673823616 2671180694 Bacteria 7506943
156 2738840073 2738541299 Bacteria 4020721
157 2739230962 2738543010 Bacteria 5583595
158 2739269099 2738543017 Bacteria 4271950
159 2757565141 2757320391 Bacteria 4746095
160 2777763419 2775507177 Bacteria 4384303
161 2809056842 2808606399 Bacteria 4021018
162 2816862066 2816332186 Bacteria 5331395
163 2817479624 2816332295 Bacteria 4352468
164 2819571633 2818991441 Bacteria 5062707
165 2819707048 2818991465 Bacteria 5388835
166 2842686646 2842682962 Bacteria 5589973
167 2842882641 2842882022 Bacteria 6158489
168 2842888140 2842882022 Bacteria 6158489
169 2849141593 2849139964 Bacteria 5613304
170 2857583964 2857581216 Bacteria 5522813
171 2857588046 2857586860 Bacteria 4354574
172 2857591524 2857591370 Bacteria 6569758
173 2857608447 2857604169 Bacteria 5111450
174 2860839474 2860837431 Bacteria 4202080
175 2864998401 2864997549 Bacteria 5139696
176 2898910051 2898907183 Bacteria 4067722
177 2904526693 2904524088 Bacteria 5887454
178 2915600848 2915597211 Bacteria 6475886
179 2915607007 2915606848 Bacteria 6032732
180 2919144713 2919143609 Bacteria 6219228
181 2925329848 2925326138 Bacteria 9652120
182 2928080575 2928078545 Bacteria 6534839
183 2928095205 2928093941 Bacteria 5965005
184 2928150800 2928147474 Bacteria 6512076
185 2929185986 2929183550 Bacteria 6377511
186 2929207965 2929206907 Bacteria 5918291
187 2932083043 2932082852 Bacteria 6563563
188 2936343428 2936340661 Bacteria 5139038
189 2956901387 2956897341 Bacteria 5447711
190 2960324234 2960319331 Bacteria 5502575
191 2960377589 2960375949 Bacteria 5361395
192 2964379617 2964375228 Bacteria 4909004
193 2969138857 2969136845 Bacteria 3923176
194 2969766910 2969765954 Bacteria 4216713
195 2969774632 2969770375 Bacteria 4271280
196 2971513675 2971511577 Bacteria 5404012
197 2971513686 2971511577 Bacteria 5404012
198 2980178516 2980176882 Bacteria 5397533
199 2980178528 2980176882 Bacteria 5397533
200 2980494659 2980492589 Bacteria 4072961
201 3006828083 3006826541 Bacteria 4678913
202 3006859955 3006858327 Bacteria 4317835
203 3006881274 3006879489 Bacteria 4064221
204 3006977537 3006973921 Bacteria 4423788
205 8022654061 8022653035 Bacteria 4035078
206 8022796047 8022792930 Bacteria 5693794
207 8022897366 8022893055 Bacteria 5300455
208 8022919108 8022914991 Bacteria 5584517
209 8022950462 8022948649 Bacteria 5366783
210 8055632971 8055632911 Bacteria 5283357
211 8057583818 8057582654 Bacteria 5218944
212 8057736158 8057733483 Bacteria 6578323
213 Ga0395899_0116768
214 JGI24739J22299_10023063
215 JGI24739J22299_10024176
216 JGI24737J22298_10000984
217 JGI24735J21928_10000004
218 JGI25162J39368_1000089
219 JGI25162J39368_1000614
220 JGI25151J46595_10002839
221 JGI25151J46595_10004504
222 JGI25151J46595_10027142
223 JGI25151J46595_10029484
224 JGI25165J46597_1002726
225 rootH1_10047779
226 rootH2_10323693
227 rootL2_10087581
228 Ga0055532_1000126
229 Ga0055532_1001188
230 Ga0055532_1003499
231 Ga0055535_1005377
232 Ga0055541_1000226
233 Ga0070658_10000956
234 Ga0070660_100196288
235 Ga0070663_100000310
236 Ga0068853_100000022
237 Ga0068857_100149779
238 Ga0068854_100012299
239 Ga0068856_100028642
240 Ga0068860_100144510
241 Ga0105244_10095657
242 Ga0105240_10364585
243 Ga0105237_10001497
244 Ga0105237_10009703
245 Ga0105239_10000999
246 Ga0157371_10002190
247 Ga0157371_10019909
248 Ga0157369_10000393
249 Ga0157374_10464663
250 Ga0157372_10000034
251 Ga0157372_10010741
252 Ga0157372_10016679
253 Ga0157377_10078463
254 Ga0157379_10019083
255 Ga0163161_10025903
256 Ga0209566_100035
257 Ga0209147_100042
258 Ga0209147_100182
259 Ga0209147_101079
260 Ga0207427_100103
261 Ga0209437_100101
262 Ga0209437_100221
263 Ga0209258_106561
264 Ga0209233_1000124
265 Ga0209673_1014765
266 Ga0209025_1003012
267 Ga0209025_1006283
268 Ga0209025_1006685
269 Ga0209025_1011774
270 Ga0209025_1013788
271 Ga0209025_1041071
272 Ga0207655_1008935
273 Ga0207713_1009677
274 Ga0207685_10242786
275 Ga0207705_10002841
276 Ga0207695_10270225
277 Ga0207671_10002034
278 Ga0207671_10005705
279 Ga0207671_10006458
280 Ga0207667_10017757
281 Ga0207640_10054901
282 Ga0207639_10000002
283 Ga0207702_10227966
284 Ga0207674_10169782
285 Ga0268264_10190166
286 Ga0307517_10043849
287 Ga0307408_100000542
288 Ga0307408_100373649
289 Ga0307405_10562195
290 Ga0307416_100042727
291 Ga0307416_100200021
292 Ga0307416_100481751
293 Ga0307510_10029794
294 Ga0395899_0000182
295 Ga0395899_0101075
296 Ga0395900_0199606
297 Ga0439449_0081636
298 Ga0466969_0003049
299 Ga0466966_0011419
300 Ga0466961_0018532
301 Ga0466959_0015655
302 Ga0495650_0000132
303 Ga0495583_0042257
304 Ga0495606_0000100
305 Ga0495606_0004289
306 Ga0495610_0001613
307 Ga0495610_0015285
308 Ga0495616_0004320
309 Ga0495631_0091566
310 Ga0495632_0079611
311 Ga0495633_0008919
312 Ga0495668_0056520
313 Ga0495625_0000036
314 Ga0495625_0027565
315 Ga0495625_0261314
316 Ga0495669_0164792
317 Ga0495671_0082107
318 Ga0495649_0000017
319 Ga0495683_0052236
320 Ga0495683_0149602
321 Ga0495687_001261
322 Ga0496100_0029946
323 Ga0496102_0109023
324 Ga0496103_0045097
325 Ga0496104_0070430
326 Ga0496104_0216284
327 Ga0496105_0001971
328 Ga0496106_0004898
329 Ga0496107_0008218
330 Ga0496108_0001083
331 Ga0496109_0042809
332 Ga0496110_0019076
333 Ga0496110_0040388
334 Ga0496111_0000453
335 Ga0496111_0054561
336 Ga0496112_0029620
337 Ga0496118_0076267
338 Ga0496119_0009419
339 Ga0496119_0011249
340 Ga0496120_0000644
341 Ga0496122_0007692
342 Ga0496122_0060615
343 Ga0496123_0123341
344 Ga0496123_0174082
345 Ga0496124_0000062
346 Ga0496124_0138276
347 Ga0496125_0071578
348 Ga0496126_0000250
349 Ga0496126_0001176
350 Ga0496126_0032756
351 Ga0495678_014355
352 nmdc:mga0k408_17942_c1
353 Ga0500635_0028687
354 Ga0500608_000829
355 2511179768
356 2512639110
357 2524189736
358 2573038952
359 2578334699
360 2580934772
361 2595089384
362 2599478374
363 2621272726
364 2644717886
365 2644724788
366 2672337523
367 2673823616
368 2738840073
369 2739230962
370 2739269099
371 2757565141
372 2777763419
373 2809056842
374 2816862066
375 2817479624
376 2819571633
377 2819707048
378 2842686646
379 2842882641
380 2842888140
381 2849141593
382 2857583964
383 2857588046
384 2857591524
385 2857608447
386 2860839474
387 2864998401
388 2898910051
389 2904526693
390 2915600848
391 2915607007
392 2919144713
393 2925329848
394 2928080575
395 2928095205
396 2928150800
397 2929185986
398 2929207965
399 2932083043
400 2936343428
401 2956901387
402 2960324234
403 2960377589
404 2964379617
405 2969138857
406 2969766910
407 2969774632
408 2971513675
409 2971513686
410 2980178516
411 2980178528
412 2980494659
413 3006828083
414 3006859955
415 3006881274
416 3006977537
417 8022654061
418 8022796047
419 8022897366
420 8022919108
421 8022950462
422 8055632971
423 8057583818
424 8057736158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05675

DUF817

Protein of unknown function (DUF817)

33

267

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xu4-assembly1.cif.gz_A crystal structure of a mycobacterial insig homolog mvins from mycobacterium vanbaalenii at 1.9a resolution 0.6375 62 241
4xu6-assembly1.cif.gz_A crystal structure of cross-linked mvins r77c trimer at 1.9a resolution 0.6326 62 255
4xu6-assembly1.cif.gz_A crystal structure of cross-linked mvins r77c trimer at 1.9a resolution 0.6176 62 255
4xu4-assembly1.cif.gz_A crystal structure of a mycobacterial insig homolog mvins from mycobacterium vanbaalenii at 1.9a resolution 0.5977 62 241
6m49-assembly1.cif.gz_A cryo-em structure of scap/insig complex in the present of 25-hydroxyl cholesterol. 0.5427 66 249
ID Description Score Start End Superfamily
af_K7U7E9_3_149_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.3854 172 253 3.30.420.40
af_Q4DSP7_48_153_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.3744 173 252 3.30.1520.10
af_Q9VK31_400_520_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.3465 173 245 3.30.1520.10
af_Q7XQV1_191_309_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.3338 173 261 3.30.200.20
3rklD00 Special;Helix non-globular;Helix Hairpins; 0.3304 176 247 6.10.140.1640
ID Description Score Start End GO Terms
AF-A0A4U3C2V6-F1-model_v4 deleted 0.9809 3 124
AF-A0A1N6V297-F1-model_v4 DUF817 domain-containing protein 0.9715 6 130 GO:0016020
AF-A0A358H288-F1-model_v4 deleted 0.9542 127 245
AF-A0A519JDZ4-F1-model_v4 DUF817 family protein 0.9506 116 247 GO:0016020
AF-A0A2N3D459-F1-model_v4 DUF817 domain-containing protein 0.9488 77 247 GO:0016020

Map