F322691

General Info

Members Datasets Scaffolds Average Seq Length
212 125 424 177

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100948286|Ga0097621_1009482861
Length 190
Sequence MTNLKSARSFAPPSGSPVMDADAIRGALRRIAHEIIERNPELASVVLAGIPSRGVEIAKRIAGFIEEFSKKPIDTGLIDVSMHRDDVGKRPDLPIVQASRLPTPLNGRTVIIVDDVFYTGRTTRAAMDAIGSFGRPARIQLATLIDRGHRELPIRADFVGKNIPTAPDERVRLRLENVDNEADAVWLIKQ

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
66 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
67 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
76 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 0.94
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100948286 3300006237 Bacteria 803
2 rootH2_10007789 3300003320 Bacteria 9572
3 Ga0070660_100312726 3300005339 Bacteria 1289
4 Ga0070687_100083879 3300005343 Bacteria 1746
5 Ga0070687_100128862 3300005343 Bacteria 1458
6 Ga0070675_100408577 3300005354 Bacteria 1212
7 Ga0070688_100213566 3300005365 Unclassified 1356
8 Ga0070714_100007927 3300005435 Bacteria 8273
9 Ga0070714_100237602 3300005435 Bacteria 1681
10 Ga0070713_100423049 3300005436 Bacteria 1247
11 Ga0070711_100006796 3300005439 Bacteria 6926
12 Ga0070681_10553161 3300005458 Bacteria 1065
13 Ga0070685_10122506 3300005466 Bacteria 1616
14 Ga0070706_101019592 3300005467 Unclassified 763
15 Ga0070679_100161935 3300005530 Bacteria 2212
16 Ga0070679_100763565 3300005530 Bacteria 910
17 Ga0070686_100245569 3300005544 Bacteria 1305
18 Ga0068855_100021790 3300005563 Bacteria 7686
19 Ga0068855_100037818 3300005563 Bacteria 5736
20 Ga0068855_100479850 3300005563 Bacteria 1354
21 Ga0068855_100502262 3300005563 Bacteria 1318
22 Ga0068855_100727980 3300005563 Bacteria 1059
23 Ga0068856_100000155 3300005614 Bacteria 70571
24 Ga0068856_100373188 3300005614 Unclassified 1445
25 Ga0068856_100548062 3300005614 Bacteria 1178
26 Ga0068858_100144945 3300005842 Bacteria 2230
27 Ga0068858_101086510 3300005842 Bacteria 785
28 Ga0068860_101224844 3300005843 Bacteria 771
29 Ga0097621_100778340 3300006237 Unclassified 885
30 Ga0068871_100052835 3300006358 Bacteria 3292
31 Ga0075434_100308002 3300006871 Bacteria 1604
32 Ga0105240_10048955 3300009093 Bacteria 5339
33 Ga0105240_10109131 3300009093 Bacteria 3352
34 Ga0105240_10124904 3300009093 Bacteria 3094
35 Ga0105240_10735226 3300009093 Unclassified 1074
36 Ga0105240_10965443 3300009093 Unclassified 913
37 Ga0105240_11782149 3300009093 Bacteria 642
38 Ga0105238_10002708 3300009551 Bacteria 17636
39 Ga0105238_10037836 3300009551 Bacteria 4903
40 Ga0157369_11713755 3300013105 Bacteria 638
41 Ga0157374_10079198 3300013296 Bacteria 3113
42 Ga0157374_10603357 3300013296 Bacteria 1108
43 Ga0157378_10423932 3300013297 Bacteria 1316
44 Ga0157372_11021015 3300013307 Bacteria 958
45 Ga0157375_10037307 3300013308 Bacteria 4656
46 Ga0163163_10499481 3300014325 Bacteria 1278
47 Ga0157376_10307520 3300014969 Bacteria 1503
48 Ga0207707_10192264 3300025912 Bacteria 1780
49 Ga0207707_10207536 3300025912 Bacteria 1707
50 Ga0207695_10152671 3300025913 Bacteria 2247
51 Ga0207695_10474873 3300025913 Bacteria 1133
52 Ga0207695_10927127 3300025913 Unclassified 750
53 Ga0207671_10289865 3300025914 Bacteria 1292
54 Ga0207663_10012610 3300025916 Bacteria 4577
55 Ga0207662_10176288 3300025918 Unclassified 1374
56 Ga0207694_10001536 3300025924 Bacteria 19620
57 Ga0207694_10010655 3300025924 Bacteria 6936
58 Ga0207694_10981767 3300025924 Bacteria 715
59 Ga0207664_10026153 3300025929 Bacteria 4407
60 Ga0207667_10042987 3300025949 Bacteria 4798
61 Ga0207667_10147855 3300025949 Bacteria 2418
62 Ga0207667_10264551 3300025949 Bacteria 1759
63 Ga0207667_10374073 3300025949 Bacteria 1452
64 Ga0207667_11109737 3300025949 Bacteria 774
65 Ga0207703_10128532 3300026035 Bacteria 2185
66 Ga0207703_10643517 3300026035 Bacteria 1005
67 Ga0207702_10031791 3300026078 Bacteria 4401
68 Ga0207702_10097852 3300026078 Bacteria 2583
69 Ga0207641_10569924 3300026088 Bacteria 1106
70 Ga0265337_1000035 3300028556 Bacteria 58448
71 Ga0265337_1033949 3300028556 Bacteria 1503
72 Ga0265337_1045999 3300028556 Bacteria 1240
73 Ga0265337_1123064 3300028556 Bacteria 703
74 Ga0265326_10007296 3300028558 Bacteria 3396
75 Ga0265326_10010387 3300028558 Bacteria 2760
76 Ga0265319_1000004 3300028563 Bacteria 305085
77 Ga0265323_10013601 3300028653 Bacteria 3242
78 Ga0265323_10046168 3300028653 Bacteria 1562
79 Ga0265323_10094730 3300028653 Bacteria 993
80 Ga0265336_10024002 3300028666 Bacteria 1930
81 Ga0265336_10031644 3300028666 Bacteria 1643
82 Ga0265338_10000208 3300028800 Bacteria 109817
83 Ga0265338_10000425 3300028800 Bacteria 75565
84 Ga0265338_10002171 3300028800 Bacteria 30148
85 Ga0265338_10006766 3300028800 Bacteria 14456
86 Ga0265338_10030063 3300028800 Bacteria 5366
87 Ga0265338_10033529 3300028800 Bacteria 4980
88 Ga0265338_10035806 3300028800 Bacteria 4761
89 Ga0265338_10197095 3300028800 Bacteria 1521
90 Ga0265338_10198931 3300028800 Bacteria 1512
91 Ga0265338_10304013 3300028800 Bacteria 1159
92 Ga0265324_10000515 3300029957 Bacteria 26598
93 Ga0265324_10000998 3300029957 Bacteria 17403
94 Ga0265324_10014984 3300029957 Bacteria 2857
95 Ga0265324_10018379 3300029957 Bacteria 2529
96 Ga0265332_10009269 3300031238 Bacteria 4398
97 Ga0265328_10214972 3300031239 Bacteria 732
98 Ga0265320_10000755 3300031240 Bacteria 24856
99 Ga0265320_10006541 3300031240 Bacteria 7337
100 Ga0265320_10017568 3300031240 Bacteria 3966
101 Ga0265320_10038894 3300031240 Bacteria 2382
102 Ga0265320_10110828 3300031240 Bacteria 1257
103 Ga0265325_10276264 3300031241 Bacteria 754
104 Ga0265329_10068519 3300031242 Bacteria 1123
105 Ga0265340_10002275 3300031247 Bacteria 10969
106 Ga0265340_10006777 3300031247 Bacteria 6269
107 Ga0265339_10004168 3300031249 Bacteria 9927
108 Ga0265339_10180144 3300031249 Bacteria 1053
109 Ga0265339_10332469 3300031249 Bacteria 719
110 Ga0265327_10001384 3300031251 Bacteria 30970
111 Ga0265327_10022467 3300031251 Bacteria 3771
112 Ga0265316_10038067 3300031344 Bacteria 3878
113 Ga0265316_10071475 3300031344 Bacteria 2675
114 Ga0265316_10090978 3300031344 Bacteria 2328
115 Ga0265316_10456964 3300031344 Bacteria 915
116 Ga0307509_10457335 3300031507 Bacteria 969
117 Ga0265313_10014152 3300031595 Bacteria 4733
118 Ga0265314_10024696 3300031711 Bacteria 4550
119 Ga0265314_10057906 3300031711 Bacteria 2658
120 Ga0265314_10093360 3300031711 Bacteria 1954
121 Ga0265314_10229639 3300031711 Unclassified 1077
122 Ga0265342_10072210 3300031712 Bacteria 2010
123 Ga0265342_10089887 3300031712 Bacteria 1762
124 Ga0373950_0014418 3300034818 Bacteria 1329
125 Ga0373928_0000085 3300035084 Bacteria 16172
126 Ga0373929_0000445 3300035085 Bacteria 7852
127 Ga0373944_0000192 3300035089 Bacteria 12891
128 Ga0373949_0003132 3300035090 Bacteria 4032
129 Ga0373951_0001625 3300035091 Bacteria 5896
130 Ga0373951_0019887 3300035091 Bacteria 1534
131 Ga0373952_0121375 3300035092 Bacteria 709
132 Ga0373932_0000001 3300035112 Bacteria 1459067
133 Ga0373939_0274534 3300035114 Bacteria 664
134 Ga0373941_0193446 3300035115 Bacteria 770
135 Ga0373954_0089068 3300035118 Bacteria 1481
136 Ga0373954_0208832 3300035118 Bacteria 960
137 Ga0373954_0223663 3300035118 Bacteria 926
138 Ga0373956_0037029 3300035119 Bacteria 2155
139 Ga0373956_0408418 3300035119 Bacteria 648
140 Ga0373943_0303410 3300035170 Unclassified 907
141 Ga0373943_0367364 3300035170 Bacteria 827
142 Ga0373955_0426549 3300035172 Bacteria 807
143 Ga0373942_0035577 3300035207 Bacteria 1337
144 Ga0373962_0000352 3300035242 Bacteria 10107
145 Ga0373931_0000008 3300035691 Bacteria 362269
146 Ga0373935_0050270 3300035692 Bacteria 2645
147 Ga0373927_0010005 3300035695 Bacteria 6354
148 Ga0373927_0015057 3300035695 Bacteria 5113
149 Ga0373927_0055433 3300035695 Bacteria 2563
150 Ga0373933_0316400 3300035724 Bacteria 1012
151 Ga0373947_0026747 3300035725 Bacteria 3374
152 Ga0373937_0629769 3300036401 Bacteria 1018
153 Ga0373937_0821424 3300036401 Bacteria 878
154 Ga0373925_0000158 3300037068 Bacteria 72961
155 Ga0373925_0038423 3300037068 Bacteria 3539
156 Ga0451577_0001890 3300042876 Bacteria 26574
157 Ga0451576_0374060 3300045051 Bacteria 1493
158 Ga0451576_0721296 3300045051 Unclassified 1047
159 Ga0451576_0752017 3300045051 Bacteria 1024
160 Ga0451576_1747181 3300045051 Bacteria 644
161 Ga0495653_0415870 3300046463 Bacteria 852
162 Ga0495580_0368850 3300046472 Bacteria 971
163 Ga0495608_0260324 3300046511 Bacteria 1080
164 Ga0495628_0111375 3300046516 Bacteria 2105
165 Ga0495630_0048092 3300046517 Bacteria 3192
166 Ga0495630_0174369 3300046517 Bacteria 1639
167 Ga0495630_0568909 3300046517 Bacteria 869
168 Ga0495666_0341189 3300046526 Bacteria 675
169 Ga0495652_0217395 3300046529 Bacteria 1438
170 Ga0495640_0295690 3300046533 Bacteria 1006
171 Ga0495586_0009876 3300046535 Bacteria 5082
172 Ga0495586_0379130 3300046535 Bacteria 813
173 Ga0495587_0215808 3300046536 Bacteria 1083
174 Ga0495622_0020382 3300046557 Bacteria 3087
175 Ga0495667_0173702 3300046559 Bacteria 1384
176 Ga0495634_0078845 3300046642 Bacteria 2157
177 Ga0495634_0378172 3300046642 Bacteria 844
178 Ga0495599_0043291 3300046678 Bacteria 2825
179 Ga0495658_0044072 3300046683 Bacteria 2498
180 Ga0495658_0489957 3300046683 Bacteria 786
181 Ga0495613_0007115 3300046689 Bacteria 8330
182 Ga0495613_0309540 3300046689 Bacteria 1092
183 Ga0495600_0559214 3300046809 Bacteria 698
184 Ga0495604_0234783 3300047317 Bacteria 1257
185 Ga0495604_0529585 3300047317 Bacteria 762
186 Ga0495674_0119361 3300047319 Bacteria 2229
187 Ga0495676_0365420 3300047321 Bacteria 963
188 Ga0495680_0224631 3300047322 Bacteria 1339
189 Ga0495680_0347543 3300047322 Bacteria 1033
190 Ga0495683_0430708 3300047323 Bacteria 544
191 Ga0495675_0019886 3300047444 Unclassified 4267
192 Ga0495684_0064909 3300047471 Bacteria 2775
193 Ga0496106_0392477 3300048909 Bacteria 1115
194 Ga0496115_0010852 3300048918 Bacteria 6817
195 Ga0501031_0124040 3300049568 Bacteria 1687
196 Ga0501032_0091217 3300049569 Bacteria 2021
197 Ga0501033_0069473 3300049570 Bacteria 2589
198 Ga0501033_0110195 3300049570 Bacteria 2004
199 Ga0501034_0245996 3300049571 Bacteria 1734
200 Ga0501038_0341817 3300049574 Bacteria 1167
201 Ga0501043_0089025 3300049579 Bacteria 2426
202 Ga0501043_0637629 3300049579 Bacteria 784
203 Ga0501047_0022182 3300049581 Bacteria 6101
204 Ga0501047_0655657 3300049581 Bacteria 869
205 Ga0501070_0876929 3300049586 Bacteria 701
206 Ga0501080_0015111 3300049742 Bacteria 7115
207 Ga0501035_0684375 3300049822 Bacteria 828
208 Ga0501044_0010644 3300049823 Bacteria 9980
209 Ga0501044_0306527 3300049823 Bacteria 1515
210 nmdc:mga0n895_280350_c1 3300050512 Bacteria 1690
211 Ga0495595_0074156 3300053084 Bacteria 1613
212 Ga0500650_0046818 3300053098 Bacteria 2004
213 Ga0097621_100948286
214 rootH2_10007789
215 Ga0070660_100312726
216 Ga0070687_100083879
217 Ga0070687_100128862
218 Ga0070675_100408577
219 Ga0070688_100213566
220 Ga0070714_100007927
221 Ga0070714_100237602
222 Ga0070713_100423049
223 Ga0070711_100006796
224 Ga0070681_10553161
225 Ga0070685_10122506
226 Ga0070706_101019592
227 Ga0070679_100161935
228 Ga0070679_100763565
229 Ga0070686_100245569
230 Ga0068855_100021790
231 Ga0068855_100037818
232 Ga0068855_100479850
233 Ga0068855_100502262
234 Ga0068855_100727980
235 Ga0068856_100000155
236 Ga0068856_100373188
237 Ga0068856_100548062
238 Ga0068858_100144945
239 Ga0068858_101086510
240 Ga0068860_101224844
241 Ga0097621_100778340
242 Ga0068871_100052835
243 Ga0075434_100308002
244 Ga0105240_10048955
245 Ga0105240_10109131
246 Ga0105240_10124904
247 Ga0105240_10735226
248 Ga0105240_10965443
249 Ga0105240_11782149
250 Ga0105238_10002708
251 Ga0105238_10037836
252 Ga0157369_11713755
253 Ga0157374_10079198
254 Ga0157374_10603357
255 Ga0157378_10423932
256 Ga0157372_11021015
257 Ga0157375_10037307
258 Ga0163163_10499481
259 Ga0157376_10307520
260 Ga0207707_10192264
261 Ga0207707_10207536
262 Ga0207695_10152671
263 Ga0207695_10474873
264 Ga0207695_10927127
265 Ga0207671_10289865
266 Ga0207663_10012610
267 Ga0207662_10176288
268 Ga0207694_10001536
269 Ga0207694_10010655
270 Ga0207694_10981767
271 Ga0207664_10026153
272 Ga0207667_10042987
273 Ga0207667_10147855
274 Ga0207667_10264551
275 Ga0207667_10374073
276 Ga0207667_11109737
277 Ga0207703_10128532
278 Ga0207703_10643517
279 Ga0207702_10031791
280 Ga0207702_10097852
281 Ga0207641_10569924
282 Ga0265337_1000035
283 Ga0265337_1033949
284 Ga0265337_1045999
285 Ga0265337_1123064
286 Ga0265326_10007296
287 Ga0265326_10010387
288 Ga0265319_1000004
289 Ga0265323_10013601
290 Ga0265323_10046168
291 Ga0265323_10094730
292 Ga0265336_10024002
293 Ga0265336_10031644
294 Ga0265338_10000208
295 Ga0265338_10000425
296 Ga0265338_10002171
297 Ga0265338_10006766
298 Ga0265338_10030063
299 Ga0265338_10033529
300 Ga0265338_10035806
301 Ga0265338_10197095
302 Ga0265338_10198931
303 Ga0265338_10304013
304 Ga0265324_10000515
305 Ga0265324_10000998
306 Ga0265324_10014984
307 Ga0265324_10018379
308 Ga0265332_10009269
309 Ga0265328_10214972
310 Ga0265320_10000755
311 Ga0265320_10006541
312 Ga0265320_10017568
313 Ga0265320_10038894
314 Ga0265320_10110828
315 Ga0265325_10276264
316 Ga0265329_10068519
317 Ga0265340_10002275
318 Ga0265340_10006777
319 Ga0265339_10004168
320 Ga0265339_10180144
321 Ga0265339_10332469
322 Ga0265327_10001384
323 Ga0265327_10022467
324 Ga0265316_10038067
325 Ga0265316_10071475
326 Ga0265316_10090978
327 Ga0265316_10456964
328 Ga0307509_10457335
329 Ga0265313_10014152
330 Ga0265314_10024696
331 Ga0265314_10057906
332 Ga0265314_10093360
333 Ga0265314_10229639
334 Ga0265342_10072210
335 Ga0265342_10089887
336 Ga0373950_0014418
337 Ga0373928_0000085
338 Ga0373929_0000445
339 Ga0373944_0000192
340 Ga0373949_0003132
341 Ga0373951_0001625
342 Ga0373951_0019887
343 Ga0373952_0121375
344 Ga0373932_0000001
345 Ga0373939_0274534
346 Ga0373941_0193446
347 Ga0373954_0089068
348 Ga0373954_0208832
349 Ga0373954_0223663
350 Ga0373956_0037029
351 Ga0373956_0408418
352 Ga0373943_0303410
353 Ga0373943_0367364
354 Ga0373955_0426549
355 Ga0373942_0035577
356 Ga0373962_0000352
357 Ga0373931_0000008
358 Ga0373935_0050270
359 Ga0373927_0010005
360 Ga0373927_0015057
361 Ga0373927_0055433
362 Ga0373933_0316400
363 Ga0373947_0026747
364 Ga0373937_0629769
365 Ga0373937_0821424
366 Ga0373925_0000158
367 Ga0373925_0038423
368 Ga0451577_0001890
369 Ga0451576_0374060
370 Ga0451576_0721296
371 Ga0451576_0752017
372 Ga0451576_1747181
373 Ga0495653_0415870
374 Ga0495580_0368850
375 Ga0495608_0260324
376 Ga0495628_0111375
377 Ga0495630_0048092
378 Ga0495630_0174369
379 Ga0495630_0568909
380 Ga0495666_0341189
381 Ga0495652_0217395
382 Ga0495640_0295690
383 Ga0495586_0009876
384 Ga0495586_0379130
385 Ga0495587_0215808
386 Ga0495622_0020382
387 Ga0495667_0173702
388 Ga0495634_0078845
389 Ga0495634_0378172
390 Ga0495599_0043291
391 Ga0495658_0044072
392 Ga0495658_0489957
393 Ga0495613_0007115
394 Ga0495613_0309540
395 Ga0495600_0559214
396 Ga0495604_0234783
397 Ga0495604_0529585
398 Ga0495674_0119361
399 Ga0495676_0365420
400 Ga0495680_0224631
401 Ga0495680_0347543
402 Ga0495683_0430708
403 Ga0495675_0019886
404 Ga0495684_0064909
405 Ga0496106_0392477
406 Ga0496115_0010852
407 Ga0501031_0124040
408 Ga0501032_0091217
409 Ga0501033_0069473
410 Ga0501033_0110195
411 Ga0501034_0245996
412 Ga0501038_0341817
413 Ga0501043_0089025
414 Ga0501043_0637629
415 Ga0501047_0022182
416 Ga0501047_0655657
417 Ga0501070_0876929
418 Ga0501080_0015111
419 Ga0501035_0684375
420 Ga0501044_0010644
421 Ga0501044_0306527
422 nmdc:mga0n895_280350_c1
423 Ga0495595_0074156
424 Ga0500650_0046818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

17

171

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xz8-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form 0.9564 5 178
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.9562 1 178
1xzn-assembly1.cif.gz_B pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form 0.9526 1 178
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.9505 1 178
1ufr-assembly2.cif.gz_D crystal structure of tt1027 from thermus thermophilus hb8 0.9479 5 178
ID Description Score Start End Superfamily
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9476 1 177 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9374 1 177 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9117 5 178 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9015 5 178 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7992 5 151 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A4P5YU96-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9829 1 178 GO:0004845
GO:0006355
AF-A0A2D5WFX2-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9805 1 177 GO:0004845
GO:0006355
AF-A0A4P5YU96-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9774 1 178 GO:0004845
GO:0006355
AF-A0A537ZAJ9-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR (EC 2.4.2.9) 0.9769 3 121 GO:0004845
AF-A0A838H2P1-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR (EC 2.4.2.9) 0.9727 7 150 GO:0016757

Map