F322509

General Info

Members Datasets Scaffolds Average Seq Length
212 126 424 320

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100007770|Ga0070713_1000077705
Length 341
Sequence MLLYSLAPRLLSSSRSVTIEVMSTTEETLHRLAEIPNLTVSAATPLSLHTRFGIGGPADLFADTCSPDAFIAAIRAARAIGMDIMVIGGGTNLIVSDSGYRGLVIRFRDDRISAEAARITVGAGAVLQDLVDFGNARGLRGLETLAGIPGWVGAAVYGNAGAYGHAMNERVDRVHFFDGEQIRVFDNAQCEFRYRESIFKRNKKWIIFSAELAMEPAATAELQKISADILAVRNAKFPPTMKCAGSIFKNFLLRDLPATVAAGVPAKVVREGKIPAAWFLEQVGAKGMRHGGIQVADYHANLIYNAGEGTAAELCAVISELKSRVRVQFGIDVEEEVQYVG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 1.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 21.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100007770 3300005436 Bacteria 7554
2 Ga0070658_10017843 3300005327 Bacteria 5675
3 Ga0070658_10109438 3300005327 Bacteria 2288
4 Ga0070658_10325417 3300005327 Bacteria 1313
5 Ga0070683_100010272 3300005329 Bacteria 8047
6 Ga0070683_100127027 3300005329 Bacteria 2411
7 Ga0070680_100013130 3300005336 Bacteria 6447
8 Ga0070680_100411552 3300005336 Archaea 1153
9 Ga0070660_100070952 3300005339 Bacteria 2719
10 Ga0070689_100050198 3300005340 Bacteria 3223
11 Ga0070673_100043320 3300005364 Bacteria 3477
12 Ga0070714_100012288 3300005435 Bacteria 6831
13 Ga0070713_100001832 3300005436 Bacteria 13720
14 Ga0070711_100004301 3300005439 Bacteria 8385
15 Ga0070681_10061492 3300005458 Bacteria 3729
16 Ga0070699_100032363 3300005518 Bacteria 4515
17 Ga0070684_100157834 3300005535 Unclassified 2057
18 Ga0068855_100679984 3300005563 Bacteria 1103
19 Ga0070717_10084210 3300006028 Unclassified 2675
20 Ga0070717_10181529 3300006028 Bacteria 1835
21 Ga0075430_100093122 3300006846 Bacteria 2519
22 Ga0075431_100112288 3300006847 Bacteria 2812
23 Ga0075429_100191219 3300006880 Bacteria 1793
24 Ga0105240_10000235 3300009093 Bacteria 110217
25 Ga0105240_10000415 3300009093 Bacteria 78890
26 Ga0105240_10004362 3300009093 Bacteria 21597
27 Ga0105240_10048816 3300009093 Bacteria 5347
28 Ga0105240_10277197 3300009093 Bacteria 1928
29 Ga0111539_10331928 3300009094 Unclassified 1770
30 Ga0105242_10677344 3300009176 Bacteria 1006
31 Ga0105248_10086872 3300009177 Unclassified 3519
32 Ga0105248_10389341 3300009177 Bacteria 1569
33 Ga0105237_10004398 3300009545 Bacteria 16341
34 Ga0105237_10277278 3300009545 Bacteria 1679
35 Ga0105238_10289778 3300009551 Bacteria 1619
36 Ga0105249_10155826 3300009553 Bacteria 2203
37 Ga0105239_10291546 3300010375 Bacteria 1837
38 Ga0105246_10170699 3300011119 Unclassified 1666
39 Ga0157370_10111050 3300013104 Bacteria 2563
40 Ga0157370_10220244 3300013104 Unclassified 1758
41 Ga0157370_10295176 3300013104 Unclassified 1497
42 Ga0157369_10002714 3300013105 Bacteria 21128
43 Ga0157372_10033149 3300013307 Bacteria 5671
44 Ga0157375_10119055 3300013308 Bacteria 2748
45 Ga0163163_10038385 3300014325 Bacteria 4668
46 Ga0163163_10102368 3300014325 Bacteria 2887
47 Ga0163163_10142815 3300014325 Bacteria 2436
48 Ga0157380_10031280 3300014326 Bacteria 4085
49 Ga0157376_10013599 3300014969 Bacteria 6079
50 Ga0206355_1043159 3300020076 Bacteria 1211
51 Ga0206355_1600735 3300020076 Bacteria 1590
52 Ga0213876_10003477 3300021384 Bacteria 9001
53 Ga0213876_10122929 3300021384 Unclassified 1378
54 Ga0213875_10000006 3300021388 Bacteria 579005
55 Ga0213875_10005393 3300021388 Bacteria 6868
56 Ga0213875_10016999 3300021388 Unclassified 3522
57 Ga0213875_10113354 3300021388 Unclassified 1267
58 Ga0213871_10000084 3300021441 Bacteria 8211
59 Ga0224712_10038786 3300022467 Bacteria 1782
60 Ga0207699_10156710 3300025906 Unclassified 1512
61 Ga0207705_10020299 3300025909 Bacteria 4751
62 Ga0207705_10066196 3300025909 Bacteria 2613
63 Ga0207707_10203133 3300025912 Bacteria 1727
64 Ga0207695_10005356 3300025913 Bacteria 17065
65 Ga0207695_10009790 3300025913 Bacteria 11784
66 Ga0207695_10033192 3300025913 Bacteria 5637
67 Ga0207695_10150228 3300025913 Bacteria 2269
68 Ga0207695_10225028 3300025913 Bacteria 1782
69 Ga0207695_10317688 3300025913 Bacteria 1447
70 Ga0207671_10017014 3300025914 Bacteria 5626
71 Ga0207663_10014455 3300025916 Bacteria 4321
72 Ga0207660_10036494 3300025917 Bacteria 3418
73 Ga0207694_10209051 3300025924 Bacteria 1589
74 Ga0207700_10001815 3300025928 Bacteria 12132
75 Ga0207664_10069367 3300025929 Unclassified 2834
76 Ga0207711_10128217 3300025941 Bacteria 2272
77 Ga0207661_10376923 3300025944 Bacteria 1284
78 Ga0207667_10130108 3300025949 Bacteria 2592
79 Ga0207651_10041070 3300025960 Bacteria 3067
80 Ga0207677_10398422 3300026023 Bacteria 1167
81 Ga0207678_10234947 3300026067 Bacteria 1570
82 Ga0265320_10016884 3300031240 Unclassified 4072
83 Ga0265325_10004072 3300031241 Bacteria 9313
84 Ga0265325_10093821 3300031241 Bacteria 1476
85 Ga0265329_10022218 3300031242 Bacteria 2124
86 Ga0265340_10056064 3300031247 Bacteria 1896
87 Ga0265339_10041473 3300031249 Unclassified 2555
88 Ga0265331_10100232 3300031250 Bacteria 1333
89 Ga0265316_10018408 3300031344 Bacteria 6003
90 Ga0265316_10199892 3300031344 Bacteria 1482
91 Ga0265313_10027731 3300031595 Bacteria 2960
92 Ga0265342_10035440 3300031712 Bacteria 3055
93 Ga0265342_10092091 3300031712 Unclassified 1737
94 Ga0373934_0066825 3300035086 Unclassified 1436
95 Ga0373946_0048258 3300035171 Bacteria 1772
96 Ga0373927_0000861 3300035695 Bacteria 23134
97 Ga0373927_0003025 3300035695 Bacteria 12200
98 Ga0373927_0036226 3300035695 Unclassified 3209
99 Ga0373927_0117212 3300035695 Bacteria 1737
100 Ga0373927_0200792 3300035695 Bacteria 1309
101 Ga0373947_0002166 3300035725 Bacteria 11930
102 Ga0373947_0100226 3300035725 Unclassified 1820
103 Ga0373937_0296377 3300036401 Bacteria 1528
104 Ga0373925_0000062 3300037068 Bacteria 114902
105 Ga0373925_0041615 3300037068 Unclassified 3407
106 Ga0436364_0075929 3300037853 Bacteria 4828
107 Ga0436364_0478514 3300037853 Bacteria 578677
108 Ga0436364_0702152 3300037853 Bacteria 6615
109 Ga0436364_1142401 3300037853 Bacteria 3770
110 Ga0436364_1150238 3300037853 Bacteria 1550
111 Ga0436364_1167256 3300037853 Bacteria 2989
112 Ga0436364_1215748 3300037853 Bacteria 4990
113 Ga0436364_1303546 3300037853 Unclassified 2950
114 Ga0436364_1324999 3300037853 Bacteria 2729
115 Ga0436364_1342134 3300037853 Unclassified 4270
116 Ga0436364_1353109 3300037853 Bacteria 10406
117 Ga0436364_1483439 3300037853 Bacteria 13565
118 Ga0436365_1541514 3300039437 Bacteria 3727
119 Ga0436365_1694236 3300039437 Bacteria 3720
120 Ga0436365_1769894 3300039437 Bacteria 4880
121 Ga0436365_1843913 3300039437 Bacteria 5096
122 Ga0436365_1934745 3300039437 Unclassified 2298
123 Ga0436360_0776352 3300039438 Bacteria 13811
124 Ga0436361_0820036 3300039447 Bacteria 2455
125 Ga0436361_1130066 3300039447 Bacteria 21265
126 Ga0436363_0305032 3300039450 Unclassified 1345
127 Ga0436363_1297622 3300039450 Unclassified 3491
128 Ga0466960_0106244 3300044901 Bacteria 1452
129 Ga0466958_0101911 3300045836 Bacteria 1786
130 Ga0466958_0162447 3300045836 Unclassified 1412
131 Ga0495592_0072752 3300046454 Unclassified 2500
132 Ga0495629_0031852 3300046459 Unclassified 3734
133 Ga0495651_0016484 3300046462 Bacteria 5724
134 Ga0495651_0030254 3300046462 Unclassified 4222
135 Ga0495653_0026373 3300046463 Bacteria 4659
136 Ga0495580_0000159 3300046472 Bacteria 49542
137 Ga0495580_0052269 3300046472 Bacteria 2886
138 Ga0495580_0061958 3300046472 Unclassified 2625
139 Ga0495580_0074942 3300046472 Bacteria 2362
140 Ga0495580_0095142 3300046472 Bacteria 2072
141 Ga0495580_0158841 3300046472 Bacteria 1565
142 Ga0495582_0019219 3300046473 Bacteria 3737
143 Ga0495662_0027424 3300046476 Unclassified 2751
144 Ga0495664_0004560 3300046477 Bacteria 7581
145 Ga0495608_0169818 3300046511 Bacteria 1384
146 Ga0495628_0081911 3300046516 Bacteria 2506
147 Ga0495628_0183884 3300046516 Unclassified 1580
148 Ga0495628_0196382 3300046516 Bacteria 1522
149 Ga0495640_0021814 3300046533 Unclassified 4691
150 Ga0495586_0045293 3300046535 Bacteria 2371
151 Ga0495587_0014337 3300046536 Unclassified 4974
152 Ga0495645_0013746 3300046543 Bacteria 5736
153 Ga0495645_0021337 3300046543 Bacteria 4681
154 Ga0495667_0045490 3300046559 Unclassified 2906
155 Ga0495667_0087068 3300046559 Bacteria 2026
156 Ga0495635_0073538 3300046663 Unclassified 2341
157 Ga0495635_0107907 3300046663 Bacteria 1902
158 Ga0495657_0204518 3300046675 Bacteria 1202
159 Ga0495599_0056274 3300046678 Unclassified 2461
160 Ga0495599_0174872 3300046678 Unclassified 1324
161 Ga0495623_0064822 3300046679 Bacteria 2286
162 Ga0495623_0169645 3300046679 Bacteria 1276
163 Ga0495581_0075234 3300047315 Bacteria 1954
164 Ga0495604_0034411 3300047317 Bacteria 4008
165 Ga0495604_0042235 3300047317 Bacteria 3574
166 Ga0495604_0117699 3300047317 Unclassified 1927
167 Ga0495604_0194750 3300047317 Unclassified 1410
168 Ga0495674_0004503 3300047319 Bacteria 13404
169 Ga0495674_0077899 3300047319 Unclassified 2849
170 Ga0495675_0011814 3300047444 Bacteria 5486
171 Ga0495675_0035694 3300047444 Bacteria 3175
172 Ga0495675_0038367 3300047444 Viruses 3050
173 Ga0495675_0106872 3300047444 Unclassified 1749
174 Ga0495675_0176323 3300047444 Unclassified 1311
175 Ga0495684_0000741 3300047471 Bacteria 26335
176 Ga0495684_0093145 3300047471 Unclassified 2282
177 Ga0495602_0036330 3300048088 Bacteria 4587
178 Ga0495602_0387085 3300048088 Unclassified 1000
179 Ga0496109_0537534 3300048912 Bacteria 1103
180 Ga0496113_0524272 3300048916 Bacteria 951
181 Ga0501032_0009803 3300049569 Bacteria 6928
182 Ga0501034_0025115 3300049571 Bacteria 6064
183 Ga0501036_0035745 3300049572 Unclassified 4203
184 Ga0501037_0003557 3300049573 Bacteria 11305
185 Ga0501038_0001062 3300049574 Bacteria 24804
186 Ga0501038_0200150 3300049574 Bacteria 1603
187 Ga0501039_0005526 3300049575 Bacteria 9565
188 Ga0501046_0007785 3300049580 Bacteria 9399
189 Ga0501046_0102388 3300049580 Bacteria 2196
190 Ga0501047_0016995 3300049581 Bacteria 6955
191 Ga0501047_0033767 3300049581 Bacteria 4938
192 Ga0501048_0010493 3300049582 Bacteria 6915
193 Ga0501068_0001610 3300049584 Bacteria 12022
194 Ga0501070_0014649 3300049586 Bacteria 6599
195 Ga0501072_0001570 3300049588 Bacteria 17054
196 Ga0501073_0014942 3300049589 Bacteria 5632
197 Ga0501074_0014421 3300049590 Bacteria 5750
198 Ga0501077_0001791 3300049593 Bacteria 12990
199 Ga0501079_0002461 3300049741 Bacteria 13445
200 Ga0501080_0001660 3300049742 Bacteria 18940
201 Ga0501035_0010079 3300049822 Bacteria 8772
202 Ga0501035_0022136 3300049822 Bacteria 5837
203 Ga0501044_0001615 3300049823 Bacteria 26407
204 Ga0501044_0003757 3300049823 Bacteria 17064
205 Ga0501044_0023974 3300049823 Bacteria 6484
206 Ga0501044_0024992 3300049823 Bacteria 6333
207 Ga0501044_0109192 3300049823 Unclassified 2776
208 Ga0501045_0239116 3300049824 Bacteria 1352
209 nmdc:mga06r32_41492_c1 3300050510 Bacteria 4372
210 nmdc:mga06r32_68701_c1 3300050510 Bacteria 3424
211 nmdc:mga08y16_438141_c1 3300050511 Bacteria 1334
212 Ga0501084_0001252 3300054114 Bacteria 19987
213 Ga0070713_100007770
214 Ga0070658_10017843
215 Ga0070658_10109438
216 Ga0070658_10325417
217 Ga0070683_100010272
218 Ga0070683_100127027
219 Ga0070680_100013130
220 Ga0070680_100411552
221 Ga0070660_100070952
222 Ga0070689_100050198
223 Ga0070673_100043320
224 Ga0070714_100012288
225 Ga0070713_100001832
226 Ga0070711_100004301
227 Ga0070681_10061492
228 Ga0070699_100032363
229 Ga0070684_100157834
230 Ga0068855_100679984
231 Ga0070717_10084210
232 Ga0070717_10181529
233 Ga0075430_100093122
234 Ga0075431_100112288
235 Ga0075429_100191219
236 Ga0105240_10000235
237 Ga0105240_10000415
238 Ga0105240_10004362
239 Ga0105240_10048816
240 Ga0105240_10277197
241 Ga0111539_10331928
242 Ga0105242_10677344
243 Ga0105248_10086872
244 Ga0105248_10389341
245 Ga0105237_10004398
246 Ga0105237_10277278
247 Ga0105238_10289778
248 Ga0105249_10155826
249 Ga0105239_10291546
250 Ga0105246_10170699
251 Ga0157370_10111050
252 Ga0157370_10220244
253 Ga0157370_10295176
254 Ga0157369_10002714
255 Ga0157372_10033149
256 Ga0157375_10119055
257 Ga0163163_10038385
258 Ga0163163_10102368
259 Ga0163163_10142815
260 Ga0157380_10031280
261 Ga0157376_10013599
262 Ga0206355_1043159
263 Ga0206355_1600735
264 Ga0213876_10003477
265 Ga0213876_10122929
266 Ga0213875_10000006
267 Ga0213875_10005393
268 Ga0213875_10016999
269 Ga0213875_10113354
270 Ga0213871_10000084
271 Ga0224712_10038786
272 Ga0207699_10156710
273 Ga0207705_10020299
274 Ga0207705_10066196
275 Ga0207707_10203133
276 Ga0207695_10005356
277 Ga0207695_10009790
278 Ga0207695_10033192
279 Ga0207695_10150228
280 Ga0207695_10225028
281 Ga0207695_10317688
282 Ga0207671_10017014
283 Ga0207663_10014455
284 Ga0207660_10036494
285 Ga0207694_10209051
286 Ga0207700_10001815
287 Ga0207664_10069367
288 Ga0207711_10128217
289 Ga0207661_10376923
290 Ga0207667_10130108
291 Ga0207651_10041070
292 Ga0207677_10398422
293 Ga0207678_10234947
294 Ga0265320_10016884
295 Ga0265325_10004072
296 Ga0265325_10093821
297 Ga0265329_10022218
298 Ga0265340_10056064
299 Ga0265339_10041473
300 Ga0265331_10100232
301 Ga0265316_10018408
302 Ga0265316_10199892
303 Ga0265313_10027731
304 Ga0265342_10035440
305 Ga0265342_10092091
306 Ga0373934_0066825
307 Ga0373946_0048258
308 Ga0373927_0000861
309 Ga0373927_0003025
310 Ga0373927_0036226
311 Ga0373927_0117212
312 Ga0373927_0200792
313 Ga0373947_0002166
314 Ga0373947_0100226
315 Ga0373937_0296377
316 Ga0373925_0000062
317 Ga0373925_0041615
318 Ga0436364_0075929
319 Ga0436364_0478514
320 Ga0436364_0702152
321 Ga0436364_1142401
322 Ga0436364_1150238
323 Ga0436364_1167256
324 Ga0436364_1215748
325 Ga0436364_1303546
326 Ga0436364_1324999
327 Ga0436364_1342134
328 Ga0436364_1353109
329 Ga0436364_1483439
330 Ga0436365_1541514
331 Ga0436365_1694236
332 Ga0436365_1769894
333 Ga0436365_1843913
334 Ga0436365_1934745
335 Ga0436360_0776352
336 Ga0436361_0820036
337 Ga0436361_1130066
338 Ga0436363_0305032
339 Ga0436363_1297622
340 Ga0466960_0106244
341 Ga0466958_0101911
342 Ga0466958_0162447
343 Ga0495592_0072752
344 Ga0495629_0031852
345 Ga0495651_0016484
346 Ga0495651_0030254
347 Ga0495653_0026373
348 Ga0495580_0000159
349 Ga0495580_0052269
350 Ga0495580_0061958
351 Ga0495580_0074942
352 Ga0495580_0095142
353 Ga0495580_0158841
354 Ga0495582_0019219
355 Ga0495662_0027424
356 Ga0495664_0004560
357 Ga0495608_0169818
358 Ga0495628_0081911
359 Ga0495628_0183884
360 Ga0495628_0196382
361 Ga0495640_0021814
362 Ga0495586_0045293
363 Ga0495587_0014337
364 Ga0495645_0013746
365 Ga0495645_0021337
366 Ga0495667_0045490
367 Ga0495667_0087068
368 Ga0495635_0073538
369 Ga0495635_0107907
370 Ga0495657_0204518
371 Ga0495599_0056274
372 Ga0495599_0174872
373 Ga0495623_0064822
374 Ga0495623_0169645
375 Ga0495581_0075234
376 Ga0495604_0034411
377 Ga0495604_0042235
378 Ga0495604_0117699
379 Ga0495604_0194750
380 Ga0495674_0004503
381 Ga0495674_0077899
382 Ga0495675_0011814
383 Ga0495675_0035694
384 Ga0495675_0038367
385 Ga0495675_0106872
386 Ga0495675_0176323
387 Ga0495684_0000741
388 Ga0495684_0093145
389 Ga0495602_0036330
390 Ga0495602_0387085
391 Ga0496109_0537534
392 Ga0496113_0524272
393 Ga0501032_0009803
394 Ga0501034_0025115
395 Ga0501036_0035745
396 Ga0501037_0003557
397 Ga0501038_0001062
398 Ga0501038_0200150
399 Ga0501039_0005526
400 Ga0501046_0007785
401 Ga0501046_0102388
402 Ga0501047_0016995
403 Ga0501047_0033767
404 Ga0501048_0010493
405 Ga0501068_0001610
406 Ga0501070_0014649
407 Ga0501072_0001570
408 Ga0501073_0014942
409 Ga0501074_0014421
410 Ga0501077_0001791
411 Ga0501079_0002461
412 Ga0501080_0001660
413 Ga0501035_0010079
414 Ga0501035_0022136
415 Ga0501044_0001615
416 Ga0501044_0003757
417 Ga0501044_0023974
418 Ga0501044_0024992
419 Ga0501044_0109192
420 Ga0501045_0239116
421 nmdc:mga06r32_41492_c1
422 nmdc:mga06r32_68701_c1
423 nmdc:mga08y16_438141_c1
424 Ga0501084_0001252

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

58

183

0.89

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

221

340

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.926 8 324
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9206 12 324
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9177 5 324
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9172 8 324
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9058 12 324
ID Description Score Start End Superfamily
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9641 93 217 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9402 93 218 3.30.465.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9349 93 217 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9257 93 218 3.30.465.10
4jayA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9115 93 218 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A7Y8HY27-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9756 8 324 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A7V6D0Z2-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9724 1 322 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A1F5YUN3-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9674 21 321 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A0G0K4D0-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9656 29 233 GO:0005829
GO:0008762
GO:0071555
GO:0071949
AF-A0A7C3RAW4-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9651 21 324 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949

Map