F322509
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 126 | 424 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100007770|Ga0070713_1000077705 |
| Length | 341 |
| Sequence | MLLYSLAPRLLSSSRSVTIEVMSTTEETLHRLAEIPNLTVSAATPLSLHTRFGIGGPADLFADTCSPDAFIAAIRAARAIGMDIMVIGGGTNLIVSDSGYRGLVIRFRDDRISAEAARITVGAGAVLQDLVDFGNARGLRGLETLAGIPGWVGAAVYGNAGAYGHAMNERVDRVHFFDGEQIRVFDNAQCEFRYRESIFKRNKKWIIFSAELAMEPAATAELQKISADILAVRNAKFPPTMKCAGSIFKNFLLRDLPATVAAGVPAKVVREGKIPAAWFLEQVGAKGMRHGGIQVADYHANLIYNAGEGTAAELCAVISELKSRVRVQFGIDVEEEVQYVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 14 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 16 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 17 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 18 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 35 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 36 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 37 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 38 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 56 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 57 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 60 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 62 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 63 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 64 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 65 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 66 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 67 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 68 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 69 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 71 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 72 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 73 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 74 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 75 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 76 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 77 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 104 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 1.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 87.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100007770 | 3300005436 | Bacteria | 7554 |
| 2 | Ga0070658_10017843 | 3300005327 | Bacteria | 5675 |
| 3 | Ga0070658_10109438 | 3300005327 | Bacteria | 2288 |
| 4 | Ga0070658_10325417 | 3300005327 | Bacteria | 1313 |
| 5 | Ga0070683_100010272 | 3300005329 | Bacteria | 8047 |
| 6 | Ga0070683_100127027 | 3300005329 | Bacteria | 2411 |
| 7 | Ga0070680_100013130 | 3300005336 | Bacteria | 6447 |
| 8 | Ga0070680_100411552 | 3300005336 | Archaea | 1153 |
| 9 | Ga0070660_100070952 | 3300005339 | Bacteria | 2719 |
| 10 | Ga0070689_100050198 | 3300005340 | Bacteria | 3223 |
| 11 | Ga0070673_100043320 | 3300005364 | Bacteria | 3477 |
| 12 | Ga0070714_100012288 | 3300005435 | Bacteria | 6831 |
| 13 | Ga0070713_100001832 | 3300005436 | Bacteria | 13720 |
| 14 | Ga0070711_100004301 | 3300005439 | Bacteria | 8385 |
| 15 | Ga0070681_10061492 | 3300005458 | Bacteria | 3729 |
| 16 | Ga0070699_100032363 | 3300005518 | Bacteria | 4515 |
| 17 | Ga0070684_100157834 | 3300005535 | Unclassified | 2057 |
| 18 | Ga0068855_100679984 | 3300005563 | Bacteria | 1103 |
| 19 | Ga0070717_10084210 | 3300006028 | Unclassified | 2675 |
| 20 | Ga0070717_10181529 | 3300006028 | Bacteria | 1835 |
| 21 | Ga0075430_100093122 | 3300006846 | Bacteria | 2519 |
| 22 | Ga0075431_100112288 | 3300006847 | Bacteria | 2812 |
| 23 | Ga0075429_100191219 | 3300006880 | Bacteria | 1793 |
| 24 | Ga0105240_10000235 | 3300009093 | Bacteria | 110217 |
| 25 | Ga0105240_10000415 | 3300009093 | Bacteria | 78890 |
| 26 | Ga0105240_10004362 | 3300009093 | Bacteria | 21597 |
| 27 | Ga0105240_10048816 | 3300009093 | Bacteria | 5347 |
| 28 | Ga0105240_10277197 | 3300009093 | Bacteria | 1928 |
| 29 | Ga0111539_10331928 | 3300009094 | Unclassified | 1770 |
| 30 | Ga0105242_10677344 | 3300009176 | Bacteria | 1006 |
| 31 | Ga0105248_10086872 | 3300009177 | Unclassified | 3519 |
| 32 | Ga0105248_10389341 | 3300009177 | Bacteria | 1569 |
| 33 | Ga0105237_10004398 | 3300009545 | Bacteria | 16341 |
| 34 | Ga0105237_10277278 | 3300009545 | Bacteria | 1679 |
| 35 | Ga0105238_10289778 | 3300009551 | Bacteria | 1619 |
| 36 | Ga0105249_10155826 | 3300009553 | Bacteria | 2203 |
| 37 | Ga0105239_10291546 | 3300010375 | Bacteria | 1837 |
| 38 | Ga0105246_10170699 | 3300011119 | Unclassified | 1666 |
| 39 | Ga0157370_10111050 | 3300013104 | Bacteria | 2563 |
| 40 | Ga0157370_10220244 | 3300013104 | Unclassified | 1758 |
| 41 | Ga0157370_10295176 | 3300013104 | Unclassified | 1497 |
| 42 | Ga0157369_10002714 | 3300013105 | Bacteria | 21128 |
| 43 | Ga0157372_10033149 | 3300013307 | Bacteria | 5671 |
| 44 | Ga0157375_10119055 | 3300013308 | Bacteria | 2748 |
| 45 | Ga0163163_10038385 | 3300014325 | Bacteria | 4668 |
| 46 | Ga0163163_10102368 | 3300014325 | Bacteria | 2887 |
| 47 | Ga0163163_10142815 | 3300014325 | Bacteria | 2436 |
| 48 | Ga0157380_10031280 | 3300014326 | Bacteria | 4085 |
| 49 | Ga0157376_10013599 | 3300014969 | Bacteria | 6079 |
| 50 | Ga0206355_1043159 | 3300020076 | Bacteria | 1211 |
| 51 | Ga0206355_1600735 | 3300020076 | Bacteria | 1590 |
| 52 | Ga0213876_10003477 | 3300021384 | Bacteria | 9001 |
| 53 | Ga0213876_10122929 | 3300021384 | Unclassified | 1378 |
| 54 | Ga0213875_10000006 | 3300021388 | Bacteria | 579005 |
| 55 | Ga0213875_10005393 | 3300021388 | Bacteria | 6868 |
| 56 | Ga0213875_10016999 | 3300021388 | Unclassified | 3522 |
| 57 | Ga0213875_10113354 | 3300021388 | Unclassified | 1267 |
| 58 | Ga0213871_10000084 | 3300021441 | Bacteria | 8211 |
| 59 | Ga0224712_10038786 | 3300022467 | Bacteria | 1782 |
| 60 | Ga0207699_10156710 | 3300025906 | Unclassified | 1512 |
| 61 | Ga0207705_10020299 | 3300025909 | Bacteria | 4751 |
| 62 | Ga0207705_10066196 | 3300025909 | Bacteria | 2613 |
| 63 | Ga0207707_10203133 | 3300025912 | Bacteria | 1727 |
| 64 | Ga0207695_10005356 | 3300025913 | Bacteria | 17065 |
| 65 | Ga0207695_10009790 | 3300025913 | Bacteria | 11784 |
| 66 | Ga0207695_10033192 | 3300025913 | Bacteria | 5637 |
| 67 | Ga0207695_10150228 | 3300025913 | Bacteria | 2269 |
| 68 | Ga0207695_10225028 | 3300025913 | Bacteria | 1782 |
| 69 | Ga0207695_10317688 | 3300025913 | Bacteria | 1447 |
| 70 | Ga0207671_10017014 | 3300025914 | Bacteria | 5626 |
| 71 | Ga0207663_10014455 | 3300025916 | Bacteria | 4321 |
| 72 | Ga0207660_10036494 | 3300025917 | Bacteria | 3418 |
| 73 | Ga0207694_10209051 | 3300025924 | Bacteria | 1589 |
| 74 | Ga0207700_10001815 | 3300025928 | Bacteria | 12132 |
| 75 | Ga0207664_10069367 | 3300025929 | Unclassified | 2834 |
| 76 | Ga0207711_10128217 | 3300025941 | Bacteria | 2272 |
| 77 | Ga0207661_10376923 | 3300025944 | Bacteria | 1284 |
| 78 | Ga0207667_10130108 | 3300025949 | Bacteria | 2592 |
| 79 | Ga0207651_10041070 | 3300025960 | Bacteria | 3067 |
| 80 | Ga0207677_10398422 | 3300026023 | Bacteria | 1167 |
| 81 | Ga0207678_10234947 | 3300026067 | Bacteria | 1570 |
| 82 | Ga0265320_10016884 | 3300031240 | Unclassified | 4072 |
| 83 | Ga0265325_10004072 | 3300031241 | Bacteria | 9313 |
| 84 | Ga0265325_10093821 | 3300031241 | Bacteria | 1476 |
| 85 | Ga0265329_10022218 | 3300031242 | Bacteria | 2124 |
| 86 | Ga0265340_10056064 | 3300031247 | Bacteria | 1896 |
| 87 | Ga0265339_10041473 | 3300031249 | Unclassified | 2555 |
| 88 | Ga0265331_10100232 | 3300031250 | Bacteria | 1333 |
| 89 | Ga0265316_10018408 | 3300031344 | Bacteria | 6003 |
| 90 | Ga0265316_10199892 | 3300031344 | Bacteria | 1482 |
| 91 | Ga0265313_10027731 | 3300031595 | Bacteria | 2960 |
| 92 | Ga0265342_10035440 | 3300031712 | Bacteria | 3055 |
| 93 | Ga0265342_10092091 | 3300031712 | Unclassified | 1737 |
| 94 | Ga0373934_0066825 | 3300035086 | Unclassified | 1436 |
| 95 | Ga0373946_0048258 | 3300035171 | Bacteria | 1772 |
| 96 | Ga0373927_0000861 | 3300035695 | Bacteria | 23134 |
| 97 | Ga0373927_0003025 | 3300035695 | Bacteria | 12200 |
| 98 | Ga0373927_0036226 | 3300035695 | Unclassified | 3209 |
| 99 | Ga0373927_0117212 | 3300035695 | Bacteria | 1737 |
| 100 | Ga0373927_0200792 | 3300035695 | Bacteria | 1309 |
| 101 | Ga0373947_0002166 | 3300035725 | Bacteria | 11930 |
| 102 | Ga0373947_0100226 | 3300035725 | Unclassified | 1820 |
| 103 | Ga0373937_0296377 | 3300036401 | Bacteria | 1528 |
| 104 | Ga0373925_0000062 | 3300037068 | Bacteria | 114902 |
| 105 | Ga0373925_0041615 | 3300037068 | Unclassified | 3407 |
| 106 | Ga0436364_0075929 | 3300037853 | Bacteria | 4828 |
| 107 | Ga0436364_0478514 | 3300037853 | Bacteria | 578677 |
| 108 | Ga0436364_0702152 | 3300037853 | Bacteria | 6615 |
| 109 | Ga0436364_1142401 | 3300037853 | Bacteria | 3770 |
| 110 | Ga0436364_1150238 | 3300037853 | Bacteria | 1550 |
| 111 | Ga0436364_1167256 | 3300037853 | Bacteria | 2989 |
| 112 | Ga0436364_1215748 | 3300037853 | Bacteria | 4990 |
| 113 | Ga0436364_1303546 | 3300037853 | Unclassified | 2950 |
| 114 | Ga0436364_1324999 | 3300037853 | Bacteria | 2729 |
| 115 | Ga0436364_1342134 | 3300037853 | Unclassified | 4270 |
| 116 | Ga0436364_1353109 | 3300037853 | Bacteria | 10406 |
| 117 | Ga0436364_1483439 | 3300037853 | Bacteria | 13565 |
| 118 | Ga0436365_1541514 | 3300039437 | Bacteria | 3727 |
| 119 | Ga0436365_1694236 | 3300039437 | Bacteria | 3720 |
| 120 | Ga0436365_1769894 | 3300039437 | Bacteria | 4880 |
| 121 | Ga0436365_1843913 | 3300039437 | Bacteria | 5096 |
| 122 | Ga0436365_1934745 | 3300039437 | Unclassified | 2298 |
| 123 | Ga0436360_0776352 | 3300039438 | Bacteria | 13811 |
| 124 | Ga0436361_0820036 | 3300039447 | Bacteria | 2455 |
| 125 | Ga0436361_1130066 | 3300039447 | Bacteria | 21265 |
| 126 | Ga0436363_0305032 | 3300039450 | Unclassified | 1345 |
| 127 | Ga0436363_1297622 | 3300039450 | Unclassified | 3491 |
| 128 | Ga0466960_0106244 | 3300044901 | Bacteria | 1452 |
| 129 | Ga0466958_0101911 | 3300045836 | Bacteria | 1786 |
| 130 | Ga0466958_0162447 | 3300045836 | Unclassified | 1412 |
| 131 | Ga0495592_0072752 | 3300046454 | Unclassified | 2500 |
| 132 | Ga0495629_0031852 | 3300046459 | Unclassified | 3734 |
| 133 | Ga0495651_0016484 | 3300046462 | Bacteria | 5724 |
| 134 | Ga0495651_0030254 | 3300046462 | Unclassified | 4222 |
| 135 | Ga0495653_0026373 | 3300046463 | Bacteria | 4659 |
| 136 | Ga0495580_0000159 | 3300046472 | Bacteria | 49542 |
| 137 | Ga0495580_0052269 | 3300046472 | Bacteria | 2886 |
| 138 | Ga0495580_0061958 | 3300046472 | Unclassified | 2625 |
| 139 | Ga0495580_0074942 | 3300046472 | Bacteria | 2362 |
| 140 | Ga0495580_0095142 | 3300046472 | Bacteria | 2072 |
| 141 | Ga0495580_0158841 | 3300046472 | Bacteria | 1565 |
| 142 | Ga0495582_0019219 | 3300046473 | Bacteria | 3737 |
| 143 | Ga0495662_0027424 | 3300046476 | Unclassified | 2751 |
| 144 | Ga0495664_0004560 | 3300046477 | Bacteria | 7581 |
| 145 | Ga0495608_0169818 | 3300046511 | Bacteria | 1384 |
| 146 | Ga0495628_0081911 | 3300046516 | Bacteria | 2506 |
| 147 | Ga0495628_0183884 | 3300046516 | Unclassified | 1580 |
| 148 | Ga0495628_0196382 | 3300046516 | Bacteria | 1522 |
| 149 | Ga0495640_0021814 | 3300046533 | Unclassified | 4691 |
| 150 | Ga0495586_0045293 | 3300046535 | Bacteria | 2371 |
| 151 | Ga0495587_0014337 | 3300046536 | Unclassified | 4974 |
| 152 | Ga0495645_0013746 | 3300046543 | Bacteria | 5736 |
| 153 | Ga0495645_0021337 | 3300046543 | Bacteria | 4681 |
| 154 | Ga0495667_0045490 | 3300046559 | Unclassified | 2906 |
| 155 | Ga0495667_0087068 | 3300046559 | Bacteria | 2026 |
| 156 | Ga0495635_0073538 | 3300046663 | Unclassified | 2341 |
| 157 | Ga0495635_0107907 | 3300046663 | Bacteria | 1902 |
| 158 | Ga0495657_0204518 | 3300046675 | Bacteria | 1202 |
| 159 | Ga0495599_0056274 | 3300046678 | Unclassified | 2461 |
| 160 | Ga0495599_0174872 | 3300046678 | Unclassified | 1324 |
| 161 | Ga0495623_0064822 | 3300046679 | Bacteria | 2286 |
| 162 | Ga0495623_0169645 | 3300046679 | Bacteria | 1276 |
| 163 | Ga0495581_0075234 | 3300047315 | Bacteria | 1954 |
| 164 | Ga0495604_0034411 | 3300047317 | Bacteria | 4008 |
| 165 | Ga0495604_0042235 | 3300047317 | Bacteria | 3574 |
| 166 | Ga0495604_0117699 | 3300047317 | Unclassified | 1927 |
| 167 | Ga0495604_0194750 | 3300047317 | Unclassified | 1410 |
| 168 | Ga0495674_0004503 | 3300047319 | Bacteria | 13404 |
| 169 | Ga0495674_0077899 | 3300047319 | Unclassified | 2849 |
| 170 | Ga0495675_0011814 | 3300047444 | Bacteria | 5486 |
| 171 | Ga0495675_0035694 | 3300047444 | Bacteria | 3175 |
| 172 | Ga0495675_0038367 | 3300047444 | Viruses | 3050 |
| 173 | Ga0495675_0106872 | 3300047444 | Unclassified | 1749 |
| 174 | Ga0495675_0176323 | 3300047444 | Unclassified | 1311 |
| 175 | Ga0495684_0000741 | 3300047471 | Bacteria | 26335 |
| 176 | Ga0495684_0093145 | 3300047471 | Unclassified | 2282 |
| 177 | Ga0495602_0036330 | 3300048088 | Bacteria | 4587 |
| 178 | Ga0495602_0387085 | 3300048088 | Unclassified | 1000 |
| 179 | Ga0496109_0537534 | 3300048912 | Bacteria | 1103 |
| 180 | Ga0496113_0524272 | 3300048916 | Bacteria | 951 |
| 181 | Ga0501032_0009803 | 3300049569 | Bacteria | 6928 |
| 182 | Ga0501034_0025115 | 3300049571 | Bacteria | 6064 |
| 183 | Ga0501036_0035745 | 3300049572 | Unclassified | 4203 |
| 184 | Ga0501037_0003557 | 3300049573 | Bacteria | 11305 |
| 185 | Ga0501038_0001062 | 3300049574 | Bacteria | 24804 |
| 186 | Ga0501038_0200150 | 3300049574 | Bacteria | 1603 |
| 187 | Ga0501039_0005526 | 3300049575 | Bacteria | 9565 |
| 188 | Ga0501046_0007785 | 3300049580 | Bacteria | 9399 |
| 189 | Ga0501046_0102388 | 3300049580 | Bacteria | 2196 |
| 190 | Ga0501047_0016995 | 3300049581 | Bacteria | 6955 |
| 191 | Ga0501047_0033767 | 3300049581 | Bacteria | 4938 |
| 192 | Ga0501048_0010493 | 3300049582 | Bacteria | 6915 |
| 193 | Ga0501068_0001610 | 3300049584 | Bacteria | 12022 |
| 194 | Ga0501070_0014649 | 3300049586 | Bacteria | 6599 |
| 195 | Ga0501072_0001570 | 3300049588 | Bacteria | 17054 |
| 196 | Ga0501073_0014942 | 3300049589 | Bacteria | 5632 |
| 197 | Ga0501074_0014421 | 3300049590 | Bacteria | 5750 |
| 198 | Ga0501077_0001791 | 3300049593 | Bacteria | 12990 |
| 199 | Ga0501079_0002461 | 3300049741 | Bacteria | 13445 |
| 200 | Ga0501080_0001660 | 3300049742 | Bacteria | 18940 |
| 201 | Ga0501035_0010079 | 3300049822 | Bacteria | 8772 |
| 202 | Ga0501035_0022136 | 3300049822 | Bacteria | 5837 |
| 203 | Ga0501044_0001615 | 3300049823 | Bacteria | 26407 |
| 204 | Ga0501044_0003757 | 3300049823 | Bacteria | 17064 |
| 205 | Ga0501044_0023974 | 3300049823 | Bacteria | 6484 |
| 206 | Ga0501044_0024992 | 3300049823 | Bacteria | 6333 |
| 207 | Ga0501044_0109192 | 3300049823 | Unclassified | 2776 |
| 208 | Ga0501045_0239116 | 3300049824 | Bacteria | 1352 |
| 209 | nmdc:mga06r32_41492_c1 | 3300050510 | Bacteria | 4372 |
| 210 | nmdc:mga06r32_68701_c1 | 3300050510 | Bacteria | 3424 |
| 211 | nmdc:mga08y16_438141_c1 | 3300050511 | Bacteria | 1334 |
| 212 | Ga0501084_0001252 | 3300054114 | Bacteria | 19987 |
| 213 | Ga0070713_100007770 | |||
| 214 | Ga0070658_10017843 | |||
| 215 | Ga0070658_10109438 | |||
| 216 | Ga0070658_10325417 | |||
| 217 | Ga0070683_100010272 | |||
| 218 | Ga0070683_100127027 | |||
| 219 | Ga0070680_100013130 | |||
| 220 | Ga0070680_100411552 | |||
| 221 | Ga0070660_100070952 | |||
| 222 | Ga0070689_100050198 | |||
| 223 | Ga0070673_100043320 | |||
| 224 | Ga0070714_100012288 | |||
| 225 | Ga0070713_100001832 | |||
| 226 | Ga0070711_100004301 | |||
| 227 | Ga0070681_10061492 | |||
| 228 | Ga0070699_100032363 | |||
| 229 | Ga0070684_100157834 | |||
| 230 | Ga0068855_100679984 | |||
| 231 | Ga0070717_10084210 | |||
| 232 | Ga0070717_10181529 | |||
| 233 | Ga0075430_100093122 | |||
| 234 | Ga0075431_100112288 | |||
| 235 | Ga0075429_100191219 | |||
| 236 | Ga0105240_10000235 | |||
| 237 | Ga0105240_10000415 | |||
| 238 | Ga0105240_10004362 | |||
| 239 | Ga0105240_10048816 | |||
| 240 | Ga0105240_10277197 | |||
| 241 | Ga0111539_10331928 | |||
| 242 | Ga0105242_10677344 | |||
| 243 | Ga0105248_10086872 | |||
| 244 | Ga0105248_10389341 | |||
| 245 | Ga0105237_10004398 | |||
| 246 | Ga0105237_10277278 | |||
| 247 | Ga0105238_10289778 | |||
| 248 | Ga0105249_10155826 | |||
| 249 | Ga0105239_10291546 | |||
| 250 | Ga0105246_10170699 | |||
| 251 | Ga0157370_10111050 | |||
| 252 | Ga0157370_10220244 | |||
| 253 | Ga0157370_10295176 | |||
| 254 | Ga0157369_10002714 | |||
| 255 | Ga0157372_10033149 | |||
| 256 | Ga0157375_10119055 | |||
| 257 | Ga0163163_10038385 | |||
| 258 | Ga0163163_10102368 | |||
| 259 | Ga0163163_10142815 | |||
| 260 | Ga0157380_10031280 | |||
| 261 | Ga0157376_10013599 | |||
| 262 | Ga0206355_1043159 | |||
| 263 | Ga0206355_1600735 | |||
| 264 | Ga0213876_10003477 | |||
| 265 | Ga0213876_10122929 | |||
| 266 | Ga0213875_10000006 | |||
| 267 | Ga0213875_10005393 | |||
| 268 | Ga0213875_10016999 | |||
| 269 | Ga0213875_10113354 | |||
| 270 | Ga0213871_10000084 | |||
| 271 | Ga0224712_10038786 | |||
| 272 | Ga0207699_10156710 | |||
| 273 | Ga0207705_10020299 | |||
| 274 | Ga0207705_10066196 | |||
| 275 | Ga0207707_10203133 | |||
| 276 | Ga0207695_10005356 | |||
| 277 | Ga0207695_10009790 | |||
| 278 | Ga0207695_10033192 | |||
| 279 | Ga0207695_10150228 | |||
| 280 | Ga0207695_10225028 | |||
| 281 | Ga0207695_10317688 | |||
| 282 | Ga0207671_10017014 | |||
| 283 | Ga0207663_10014455 | |||
| 284 | Ga0207660_10036494 | |||
| 285 | Ga0207694_10209051 | |||
| 286 | Ga0207700_10001815 | |||
| 287 | Ga0207664_10069367 | |||
| 288 | Ga0207711_10128217 | |||
| 289 | Ga0207661_10376923 | |||
| 290 | Ga0207667_10130108 | |||
| 291 | Ga0207651_10041070 | |||
| 292 | Ga0207677_10398422 | |||
| 293 | Ga0207678_10234947 | |||
| 294 | Ga0265320_10016884 | |||
| 295 | Ga0265325_10004072 | |||
| 296 | Ga0265325_10093821 | |||
| 297 | Ga0265329_10022218 | |||
| 298 | Ga0265340_10056064 | |||
| 299 | Ga0265339_10041473 | |||
| 300 | Ga0265331_10100232 | |||
| 301 | Ga0265316_10018408 | |||
| 302 | Ga0265316_10199892 | |||
| 303 | Ga0265313_10027731 | |||
| 304 | Ga0265342_10035440 | |||
| 305 | Ga0265342_10092091 | |||
| 306 | Ga0373934_0066825 | |||
| 307 | Ga0373946_0048258 | |||
| 308 | Ga0373927_0000861 | |||
| 309 | Ga0373927_0003025 | |||
| 310 | Ga0373927_0036226 | |||
| 311 | Ga0373927_0117212 | |||
| 312 | Ga0373927_0200792 | |||
| 313 | Ga0373947_0002166 | |||
| 314 | Ga0373947_0100226 | |||
| 315 | Ga0373937_0296377 | |||
| 316 | Ga0373925_0000062 | |||
| 317 | Ga0373925_0041615 | |||
| 318 | Ga0436364_0075929 | |||
| 319 | Ga0436364_0478514 | |||
| 320 | Ga0436364_0702152 | |||
| 321 | Ga0436364_1142401 | |||
| 322 | Ga0436364_1150238 | |||
| 323 | Ga0436364_1167256 | |||
| 324 | Ga0436364_1215748 | |||
| 325 | Ga0436364_1303546 | |||
| 326 | Ga0436364_1324999 | |||
| 327 | Ga0436364_1342134 | |||
| 328 | Ga0436364_1353109 | |||
| 329 | Ga0436364_1483439 | |||
| 330 | Ga0436365_1541514 | |||
| 331 | Ga0436365_1694236 | |||
| 332 | Ga0436365_1769894 | |||
| 333 | Ga0436365_1843913 | |||
| 334 | Ga0436365_1934745 | |||
| 335 | Ga0436360_0776352 | |||
| 336 | Ga0436361_0820036 | |||
| 337 | Ga0436361_1130066 | |||
| 338 | Ga0436363_0305032 | |||
| 339 | Ga0436363_1297622 | |||
| 340 | Ga0466960_0106244 | |||
| 341 | Ga0466958_0101911 | |||
| 342 | Ga0466958_0162447 | |||
| 343 | Ga0495592_0072752 | |||
| 344 | Ga0495629_0031852 | |||
| 345 | Ga0495651_0016484 | |||
| 346 | Ga0495651_0030254 | |||
| 347 | Ga0495653_0026373 | |||
| 348 | Ga0495580_0000159 | |||
| 349 | Ga0495580_0052269 | |||
| 350 | Ga0495580_0061958 | |||
| 351 | Ga0495580_0074942 | |||
| 352 | Ga0495580_0095142 | |||
| 353 | Ga0495580_0158841 | |||
| 354 | Ga0495582_0019219 | |||
| 355 | Ga0495662_0027424 | |||
| 356 | Ga0495664_0004560 | |||
| 357 | Ga0495608_0169818 | |||
| 358 | Ga0495628_0081911 | |||
| 359 | Ga0495628_0183884 | |||
| 360 | Ga0495628_0196382 | |||
| 361 | Ga0495640_0021814 | |||
| 362 | Ga0495586_0045293 | |||
| 363 | Ga0495587_0014337 | |||
| 364 | Ga0495645_0013746 | |||
| 365 | Ga0495645_0021337 | |||
| 366 | Ga0495667_0045490 | |||
| 367 | Ga0495667_0087068 | |||
| 368 | Ga0495635_0073538 | |||
| 369 | Ga0495635_0107907 | |||
| 370 | Ga0495657_0204518 | |||
| 371 | Ga0495599_0056274 | |||
| 372 | Ga0495599_0174872 | |||
| 373 | Ga0495623_0064822 | |||
| 374 | Ga0495623_0169645 | |||
| 375 | Ga0495581_0075234 | |||
| 376 | Ga0495604_0034411 | |||
| 377 | Ga0495604_0042235 | |||
| 378 | Ga0495604_0117699 | |||
| 379 | Ga0495604_0194750 | |||
| 380 | Ga0495674_0004503 | |||
| 381 | Ga0495674_0077899 | |||
| 382 | Ga0495675_0011814 | |||
| 383 | Ga0495675_0035694 | |||
| 384 | Ga0495675_0038367 | |||
| 385 | Ga0495675_0106872 | |||
| 386 | Ga0495675_0176323 | |||
| 387 | Ga0495684_0000741 | |||
| 388 | Ga0495684_0093145 | |||
| 389 | Ga0495602_0036330 | |||
| 390 | Ga0495602_0387085 | |||
| 391 | Ga0496109_0537534 | |||
| 392 | Ga0496113_0524272 | |||
| 393 | Ga0501032_0009803 | |||
| 394 | Ga0501034_0025115 | |||
| 395 | Ga0501036_0035745 | |||
| 396 | Ga0501037_0003557 | |||
| 397 | Ga0501038_0001062 | |||
| 398 | Ga0501038_0200150 | |||
| 399 | Ga0501039_0005526 | |||
| 400 | Ga0501046_0007785 | |||
| 401 | Ga0501046_0102388 | |||
| 402 | Ga0501047_0016995 | |||
| 403 | Ga0501047_0033767 | |||
| 404 | Ga0501048_0010493 | |||
| 405 | Ga0501068_0001610 | |||
| 406 | Ga0501070_0014649 | |||
| 407 | Ga0501072_0001570 | |||
| 408 | Ga0501073_0014942 | |||
| 409 | Ga0501074_0014421 | |||
| 410 | Ga0501077_0001791 | |||
| 411 | Ga0501079_0002461 | |||
| 412 | Ga0501080_0001660 | |||
| 413 | Ga0501035_0010079 | |||
| 414 | Ga0501035_0022136 | |||
| 415 | Ga0501044_0001615 | |||
| 416 | Ga0501044_0003757 | |||
| 417 | Ga0501044_0023974 | |||
| 418 | Ga0501044_0024992 | |||
| 419 | Ga0501044_0109192 | |||
| 420 | Ga0501045_0239116 | |||
| 421 | nmdc:mga06r32_41492_c1 | |||
| 422 | nmdc:mga06r32_68701_c1 | |||
| 423 | nmdc:mga08y16_438141_c1 | |||
| 424 | Ga0501084_0001252 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.926 | 8 | 324 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9206 | 12 | 324 |
| 1hsk-assembly1.cif.gz_A | crystal structure of s. aureus murb | 0.9177 | 5 | 324 |
| 4pyt-assembly1.cif.gz_A | crystal structure of a murb family ep-udp-n-acetylglucosamine reductase | 0.9172 | 8 | 324 |
| 3tx1-assembly1.cif.gz_A | x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) | 0.9058 | 12 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9641 | 93 | 217 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9402 | 93 | 218 | 3.30.465.10 |
| 4pytA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9349 | 93 | 217 | 3.30.465.10 |
| 3tx1A02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9257 | 93 | 218 | 3.30.465.10 |
| 4jayA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9115 | 93 | 218 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8HY27-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9756 | 8 | 324 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A7V6D0Z2-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9724 | 1 | 322 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A1F5YUN3-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9674 | 21 | 321 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A0G0K4D0-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase | 0.9656 | 29 | 233 |
GO:0005829
GO:0008762 GO:0071555 GO:0071949 |
| AF-A0A7C3RAW4-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9651 | 21 | 324 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |