F322107

General Info

Members Datasets Scaffolds Average Seq Length
211 141 422 195

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0778441|Ga0501072_0778441_86_676
Length 185
Sequence MIGSVRGRVLERSVAGEVLVEVGGVGYRAHVPLGAVPALEPGAQAFLFTHLHVRDDAMVLYGFPTRDERDTFEALIGASGVGPKLALAILSVHAPPALRRCLADDDLRTAQRLLVDLKTRLDVPDLDLTAVPGSPTASVRAEVRDALTGLGYSAEEVREVLNQVTEAETVEELLREALRVLAGRS

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 11.85
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0778441 3300049588 Bacteria 750
2 Ga0065712_10290871 3300005290 Bacteria 869
3 Ga0070676_10197144 3300005328 Bacteria 1318
4 Ga0070683_101193980 3300005329 Bacteria 731
5 Ga0070687_100555010 3300005343 Bacteria 782
6 Ga0070692_10400498 3300005345 Bacteria 866
7 Ga0070673_100270967 3300005364 Bacteria 1486
8 Ga0070688_100160348 3300005365 Bacteria 1545
9 Ga0070659_100821496 3300005366 Unclassified 809
10 Ga0070713_100120519 3300005436 Bacteria 2300
11 Ga0070713_100764904 3300005436 Bacteria 925
12 Ga0070701_10378850 3300005438 Bacteria 891
13 Ga0070711_100060538 3300005439 Bacteria 2632
14 Ga0070694_100332552 3300005444 Unclassified 1172
15 Ga0070694_100849547 3300005444 Bacteria 751
16 Ga0070708_100083696 3300005445 Bacteria 2893
17 Ga0070685_10302172 3300005466 Bacteria 1079
18 Ga0070706_100061274 3300005467 Bacteria 3474
19 Ga0070706_100383119 3300005467 Bacteria 1309
20 Ga0070707_100180039 3300005468 Bacteria 2061
21 Ga0070698_100045093 3300005471 Bacteria 4513
22 Ga0070698_100589284 3300005471 Bacteria 1052
23 Ga0070697_100401176 3300005536 Bacteria 1190
24 Ga0070672_100186750 3300005543 Bacteria 1729
25 Ga0070686_100144786 3300005544 Bacteria 1658
26 Ga0070665_100468683 3300005548 Bacteria 1270
27 Ga0070665_101202023 3300005548 Bacteria 769
28 Ga0068864_100798999 3300005618 Bacteria 927
29 Ga0068866_10362753 3300005718 Bacteria 924
30 Ga0081455_10111173 3300005937 Bacteria 2177
31 Ga0081455_10174618 3300005937 Bacteria 1633
32 Ga0081539_10047489 3300005985 Bacteria 2451
33 Ga0075363_100011760 3300006048 Bacteria 4200
34 Ga0070712_100291272 3300006175 Bacteria 1318
35 Ga0075428_100009286 3300006844 Bacteria 10903
36 Ga0075428_100063361 3300006844 Bacteria 4047
37 Ga0075428_100317361 3300006844 Unclassified 1674
38 Ga0075428_100344581 3300006844 Bacteria 1600
39 Ga0075428_101007636 3300006844 Unclassified 882
40 Ga0075430_100188268 3300006846 Bacteria 1716
41 Ga0075430_100224012 3300006846 Bacteria 1560
42 Ga0075430_100855074 3300006846 Bacteria 749
43 Ga0075431_100070665 3300006847 Bacteria 3602
44 Ga0075431_100090590 3300006847 Bacteria 3156
45 Ga0075431_100204139 3300006847 Bacteria 2021
46 Ga0075433_10001702 3300006852 Bacteria 16414
47 Ga0075434_100015779 3300006871 Bacteria 7251
48 Ga0075429_100033283 3300006880 Bacteria 4478
49 Ga0075429_100565467 3300006880 Bacteria 996
50 Ga0075436_100038561 3300006914 Bacteria 3297
51 Ga0075435_100002004 3300007076 Bacteria 13334
52 Ga0075435_100033518 3300007076 Bacteria 4062
53 Ga0105240_11213367 3300009093 Bacteria 798
54 Ga0111539_10101149 3300009094 Bacteria 3384
55 Ga0111539_11590052 3300009094 Unclassified 758
56 Ga0105245_10036865 3300009098 Bacteria 4346
57 Ga0105245_10598995 3300009098 Bacteria 1128
58 Ga0105245_10733297 3300009098 Bacteria 1023
59 Ga0114129_10879706 3300009147 Bacteria 1137
60 Ga0114129_11049032 3300009147 Bacteria 1023
61 Ga0114129_11268669 3300009147 Unclassified 914
62 Ga0114129_11307801 3300009147 Unclassified 898
63 Ga0105243_11134959 3300009148 Bacteria 792
64 Ga0105242_10310094 3300009176 Bacteria 1443
65 Ga0105239_11026202 3300010375 Bacteria 949
66 Ga0105246_10122430 3300011119 Bacteria 1930
67 Ga0105246_10590107 3300011119 Bacteria 958
68 Ga0157378_10963317 3300013297 Bacteria 886
69 Ga0163163_10330636 3300014325 Bacteria 1578
70 Ga0157380_10111787 3300014326 Bacteria 2297
71 Ga0157377_10368681 3300014745 Bacteria 969
72 Ga0207699_10158511 3300025906 Bacteria 1504
73 Ga0207693_10443876 3300025915 Bacteria 1014
74 Ga0207646_10229924 3300025922 Bacteria 1675
75 Ga0207681_10565786 3300025923 Bacteria 937
76 Ga0207700_10248588 3300025928 Bacteria 1518
77 Ga0207709_10525928 3300025935 Bacteria 927
78 Ga0207704_10431781 3300025938 Bacteria 1047
79 Ga0207665_10262029 3300025939 Bacteria 1281
80 Ga0207691_10190925 3300025940 Bacteria 1786
81 Ga0207661_10078678 3300025944 Bacteria 2716
82 Ga0207667_10639989 3300025949 Bacteria 1070
83 Ga0207651_10117778 3300025960 Bacteria 2008
84 Ga0207668_10597581 3300025972 Unclassified 961
85 Ga0207708_10116343 3300026075 Bacteria 2080
86 Ga0207648_11027908 3300026089 Unclassified 772
87 Ga0207675_100678463 3300026118 Unclassified 1038
88 Ga0207683_10715034 3300026121 Bacteria 929
89 Ga0268266_10398683 3300028379 Bacteria 1301
90 Ga0268266_10414439 3300028379 Bacteria 1276
91 Ga0265338_10000266 3300028800 Bacteria 95213
92 Ga0265338_10622794 3300028800 Unclassified 750
93 Ga0265325_10000487 3300031241 Bacteria 28790
94 Ga0265339_10001697 3300031249 Bacteria 16247
95 Ga0265327_10010786 3300031251 Bacteria 6373
96 Ga0265327_10017253 3300031251 Bacteria 4539
97 Ga0265327_10046337 3300031251 Bacteria 2303
98 Ga0265327_10087412 3300031251 Bacteria 1527
99 Ga0265313_10000511 3300031595 Bacteria 40655
100 Ga0373943_0058845 3300035170 Bacteria 1914
101 Ga0373946_0011400 3300035171 Bacteria 3317
102 Ga0316574_0047473 3300035398 Bacteria 2665
103 Ga0373947_0108252 3300035725 Bacteria 1753
104 Ga0373947_0215263 3300035725 Bacteria 1261
105 Ga0316584_0235865 3300036712 Bacteria 1340
106 Ga0436365_0497491 3300039437 Bacteria 694
107 Ga0436365_0499671 3300039437 Bacteria 977
108 Ga0436365_0837050 3300039437 Bacteria 1921
109 Ga0436365_1216646 3300039437 Bacteria 4731
110 Ga0466967_0227023 3300045976 Bacteria 1777
111 Ga0495641_0045290 3300046461 Bacteria 2026
112 Ga0495653_0030741 3300046463 Bacteria 4274
113 Ga0495639_0120221 3300046475 Bacteria 1253
114 Ga0495608_0142976 3300046511 Bacteria 1527
115 Ga0495618_0404673 3300046514 Bacteria 834
116 Ga0495630_0071220 3300046517 Bacteria 2616
117 Ga0495630_0109610 3300046517 Bacteria 2091
118 Ga0495630_0252530 3300046517 Bacteria 1347
119 Ga0495666_0200813 3300046526 Bacteria 916
120 Ga0495665_0073457 3300046531 Bacteria 1801
121 Ga0495665_0246749 3300046531 Unclassified 920
122 Ga0495586_0108218 3300046535 Bacteria 1546
123 Ga0495587_0342484 3300046536 Bacteria 834
124 Ga0495587_0496934 3300046536 Bacteria 675
125 Ga0495634_0465187 3300046642 Bacteria 745
126 Ga0495659_0228856 3300046664 Bacteria 770
127 Ga0495657_0251908 3300046675 Bacteria 1063
128 Ga0495658_0052246 3300046683 Bacteria 2317
129 Ga0495658_0686167 3300046683 Unclassified 656
130 Ga0495613_0230171 3300046689 Bacteria 1299
131 Ga0495581_0097488 3300047315 Bacteria 1708
132 Ga0495581_0116351 3300047315 Bacteria 1555
133 Ga0495604_0565248 3300047317 Bacteria 732
134 Ga0495674_0133335 3300047319 Bacteria 2092
135 Ga0495676_0170681 3300047321 Bacteria 1531
136 Ga0495684_0835921 3300047471 Bacteria 599
137 Ga0496101_0018536 3300048904 Bacteria 4735
138 Ga0496101_0059804 3300048904 Bacteria 2763
139 Ga0496101_0092074 3300048904 Bacteria 2257
140 Ga0496102_0076088 3300048905 Bacteria 3087
141 Ga0496102_0261677 3300048905 Bacteria 1631
142 Ga0496103_0212822 3300048906 Bacteria 1243
143 Ga0496104_0074861 3300048907 Bacteria 3223
144 Ga0496104_0139884 3300048907 Bacteria 2326
145 Ga0496104_0273880 3300048907 Bacteria 1601
146 Ga0496105_0394713 3300048908 Bacteria 1099
147 Ga0496106_0267779 3300048909 Bacteria 1368
148 Ga0496108_0116063 3300048911 Bacteria 2293
149 Ga0496108_0503920 3300048911 Bacteria 1057
150 Ga0496108_0593205 3300048911 Bacteria 966
151 Ga0496109_0850454 3300048912 Bacteria 850
152 Ga0496109_1158991 3300048912 Bacteria 710
153 Ga0496112_0028021 3300048915 Bacteria 5434
154 Ga0496112_0049367 3300048915 Bacteria 4125
155 Ga0496112_0154653 3300048915 Bacteria 2261
156 Ga0496112_0550403 3300048915 Bacteria 1088
157 Ga0496112_0893500 3300048915 Bacteria 811
158 Ga0496113_0375805 3300048916 Bacteria 1141
159 Ga0496114_0343553 3300048917 Bacteria 1320
160 Ga0496115_0021937 3300048918 Bacteria 4938
161 Ga0496115_0029734 3300048918 Bacteria 4294
162 Ga0501034_0214445 3300049571 Bacteria 1879
163 Ga0501036_0409439 3300049572 Bacteria 1131
164 Ga0501039_0309488 3300049575 Bacteria 1242
165 Ga0501040_0500836 3300049576 Unclassified 876
166 Ga0501043_0097273 3300049579 Bacteria 2314
167 Ga0501046_0137871 3300049580 Bacteria 1847
168 Ga0501047_0027674 3300049581 Bacteria 5462
169 Ga0501070_0005102 3300049586 Bacteria 11194
170 Ga0501074_0503791 3300049590 Bacteria 858
171 Ga0501074_0561366 3300049590 Unclassified 808
172 Ga0501076_0220766 3300049592 Bacteria 1549
173 Ga0501076_0576780 3300049592 Bacteria 928
174 Ga0501077_0615454 3300049593 Bacteria 698
175 Ga0501079_0226195 3300049741 Bacteria 1462
176 Ga0501080_0135542 3300049742 Bacteria 2278
177 Ga0501044_0070669 3300049823 Bacteria 3550
178 Ga0501045_0603277 3300049824 Bacteria 813
179 nmdc:mga05p37_1622307_c1 3300050507 Bacteria 636
180 nmdc:mga05p37_261001_c1 3300050507 Bacteria 2073
181 nmdc:mga05p37_39747_c1 3300050507 Bacteria 5776
182 nmdc:mga05p37_991374_c1 3300050507 Bacteria 894
183 nmdc:mga09592_11695_c1 3300050508 Bacteria 7139
184 nmdc:mga09592_825524_c1 3300050508 Bacteria 783
185 nmdc:mga0qj67_229210_c1 3300050509 Bacteria 1507
186 nmdc:mga0qj67_385948_c1 3300050509 Bacteria 1131
187 nmdc:mga06r32_122038_c1 3300050510 Bacteria 2571
188 nmdc:mga06r32_229852_c1 3300050510 Bacteria 1843
189 nmdc:mga06r32_60357_c1 3300050510 Bacteria 3649
190 nmdc:mga08y16_838600_c1 3300050511 Bacteria 909
191 nmdc:mga0n895_2590_c1 3300050512 Bacteria 14207
192 nmdc:mga0rr50_23318_c1 3300050513 Bacteria 4266
193 nmdc:mga0rr50_83225_c1 3300050513 Bacteria 2473
194 nmdc:mga0a205_2147_c1 3300050515 Bacteria 17325
195 Ga0495601_0173609 3300053077 Bacteria 1409
196 Ga0495601_0221172 3300053077 Bacteria 1237
197 Ga0495601_0249251 3300053077 Bacteria 1160
198 Ga0495612_0035804 3300053078 Bacteria 2013
199 Ga0495612_0208288 3300053078 Bacteria 864
200 Ga0495595_0010452 3300053084 Bacteria 3857
201 Ga0495595_0192921 3300053084 Bacteria 1013
202 Ga0495619_0043371 3300053085 Bacteria 2948
203 Ga0495619_0127004 3300053085 Bacteria 1751
204 Ga0495619_0585679 3300053085 Unclassified 764
205 Ga0500616_0001519 3300053153 Bacteria 21888
206 Ga0501084_0000133 3300054114 Bacteria 56376
207 Ga0501084_0317301 3300054114 Bacteria 1316
208 Ga0501082_0125090 3300060353 Bacteria 2230
209 Ga0501082_0744016 3300060353 Bacteria 858
210 Ga0501082_0899827 3300060353 Unclassified 774
211 Ga0530510_0004397 3300061734 Bacteria 9758
212 Ga0501072_0778441
213 Ga0065712_10290871
214 Ga0070676_10197144
215 Ga0070683_101193980
216 Ga0070687_100555010
217 Ga0070692_10400498
218 Ga0070673_100270967
219 Ga0070688_100160348
220 Ga0070659_100821496
221 Ga0070713_100120519
222 Ga0070713_100764904
223 Ga0070701_10378850
224 Ga0070711_100060538
225 Ga0070694_100332552
226 Ga0070694_100849547
227 Ga0070708_100083696
228 Ga0070685_10302172
229 Ga0070706_100061274
230 Ga0070706_100383119
231 Ga0070707_100180039
232 Ga0070698_100045093
233 Ga0070698_100589284
234 Ga0070697_100401176
235 Ga0070672_100186750
236 Ga0070686_100144786
237 Ga0070665_100468683
238 Ga0070665_101202023
239 Ga0068864_100798999
240 Ga0068866_10362753
241 Ga0081455_10111173
242 Ga0081455_10174618
243 Ga0081539_10047489
244 Ga0075363_100011760
245 Ga0070712_100291272
246 Ga0075428_100009286
247 Ga0075428_100063361
248 Ga0075428_100317361
249 Ga0075428_100344581
250 Ga0075428_101007636
251 Ga0075430_100188268
252 Ga0075430_100224012
253 Ga0075430_100855074
254 Ga0075431_100070665
255 Ga0075431_100090590
256 Ga0075431_100204139
257 Ga0075433_10001702
258 Ga0075434_100015779
259 Ga0075429_100033283
260 Ga0075429_100565467
261 Ga0075436_100038561
262 Ga0075435_100002004
263 Ga0075435_100033518
264 Ga0105240_11213367
265 Ga0111539_10101149
266 Ga0111539_11590052
267 Ga0105245_10036865
268 Ga0105245_10598995
269 Ga0105245_10733297
270 Ga0114129_10879706
271 Ga0114129_11049032
272 Ga0114129_11268669
273 Ga0114129_11307801
274 Ga0105243_11134959
275 Ga0105242_10310094
276 Ga0105239_11026202
277 Ga0105246_10122430
278 Ga0105246_10590107
279 Ga0157378_10963317
280 Ga0163163_10330636
281 Ga0157380_10111787
282 Ga0157377_10368681
283 Ga0207699_10158511
284 Ga0207693_10443876
285 Ga0207646_10229924
286 Ga0207681_10565786
287 Ga0207700_10248588
288 Ga0207709_10525928
289 Ga0207704_10431781
290 Ga0207665_10262029
291 Ga0207691_10190925
292 Ga0207661_10078678
293 Ga0207667_10639989
294 Ga0207651_10117778
295 Ga0207668_10597581
296 Ga0207708_10116343
297 Ga0207648_11027908
298 Ga0207675_100678463
299 Ga0207683_10715034
300 Ga0268266_10398683
301 Ga0268266_10414439
302 Ga0265338_10000266
303 Ga0265338_10622794
304 Ga0265325_10000487
305 Ga0265339_10001697
306 Ga0265327_10010786
307 Ga0265327_10017253
308 Ga0265327_10046337
309 Ga0265327_10087412
310 Ga0265313_10000511
311 Ga0373943_0058845
312 Ga0373946_0011400
313 Ga0316574_0047473
314 Ga0373947_0108252
315 Ga0373947_0215263
316 Ga0316584_0235865
317 Ga0436365_0497491
318 Ga0436365_0499671
319 Ga0436365_0837050
320 Ga0436365_1216646
321 Ga0466967_0227023
322 Ga0495641_0045290
323 Ga0495653_0030741
324 Ga0495639_0120221
325 Ga0495608_0142976
326 Ga0495618_0404673
327 Ga0495630_0071220
328 Ga0495630_0109610
329 Ga0495630_0252530
330 Ga0495666_0200813
331 Ga0495665_0073457
332 Ga0495665_0246749
333 Ga0495586_0108218
334 Ga0495587_0342484
335 Ga0495587_0496934
336 Ga0495634_0465187
337 Ga0495659_0228856
338 Ga0495657_0251908
339 Ga0495658_0052246
340 Ga0495658_0686167
341 Ga0495613_0230171
342 Ga0495581_0097488
343 Ga0495581_0116351
344 Ga0495604_0565248
345 Ga0495674_0133335
346 Ga0495676_0170681
347 Ga0495684_0835921
348 Ga0496101_0018536
349 Ga0496101_0059804
350 Ga0496101_0092074
351 Ga0496102_0076088
352 Ga0496102_0261677
353 Ga0496103_0212822
354 Ga0496104_0074861
355 Ga0496104_0139884
356 Ga0496104_0273880
357 Ga0496105_0394713
358 Ga0496106_0267779
359 Ga0496108_0116063
360 Ga0496108_0503920
361 Ga0496108_0593205
362 Ga0496109_0850454
363 Ga0496109_1158991
364 Ga0496112_0028021
365 Ga0496112_0049367
366 Ga0496112_0154653
367 Ga0496112_0550403
368 Ga0496112_0893500
369 Ga0496113_0375805
370 Ga0496114_0343553
371 Ga0496115_0021937
372 Ga0496115_0029734
373 Ga0501034_0214445
374 Ga0501036_0409439
375 Ga0501039_0309488
376 Ga0501040_0500836
377 Ga0501043_0097273
378 Ga0501046_0137871
379 Ga0501047_0027674
380 Ga0501070_0005102
381 Ga0501074_0503791
382 Ga0501074_0561366
383 Ga0501076_0220766
384 Ga0501076_0576780
385 Ga0501077_0615454
386 Ga0501079_0226195
387 Ga0501080_0135542
388 Ga0501044_0070669
389 Ga0501045_0603277
390 nmdc:mga05p37_1622307_c1
391 nmdc:mga05p37_261001_c1
392 nmdc:mga05p37_39747_c1
393 nmdc:mga05p37_991374_c1
394 nmdc:mga09592_11695_c1
395 nmdc:mga09592_825524_c1
396 nmdc:mga0qj67_229210_c1
397 nmdc:mga0qj67_385948_c1
398 nmdc:mga06r32_122038_c1
399 nmdc:mga06r32_229852_c1
400 nmdc:mga06r32_60357_c1
401 nmdc:mga08y16_838600_c1
402 nmdc:mga0n895_2590_c1
403 nmdc:mga0rr50_23318_c1
404 nmdc:mga0rr50_83225_c1
405 nmdc:mga0a205_2147_c1
406 Ga0495601_0173609
407 Ga0495601_0221172
408 Ga0495601_0249251
409 Ga0495612_0035804
410 Ga0495612_0208288
411 Ga0495595_0010452
412 Ga0495595_0192921
413 Ga0495619_0043371
414 Ga0495619_0127004
415 Ga0495619_0585679
416 Ga0500616_0001519
417 Ga0501084_0000133
418 Ga0501084_0317301
419 Ga0501082_0125090
420 Ga0501082_0744016
421 Ga0501082_0899827
422 Ga0530510_0004397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

1

62

0.95

PF07499

RuvA_C

RuvA, C-terminal domain

138

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dmo-assembly1.cif.gz_A refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2) 0.8795 7 30
3m9d-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8729 4 31
3fp9-assembly3.cif.gz_L crystal structure of intern domain of proteasome-associated atpase, mycobacterium tuberculosis 0.8637 4 48
7px9-assembly1.cif.gz_B substrate-engaged mycobacterial proteasome-associated atpase - focused 3d refinement (state a) 0.8594 4 46
5kzf-assembly1.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8571 4 48
ID Description Score Start End Superfamily
af_Q9Y7Z8_1103_1179_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9423 7 30 2.30.30.40
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9256 67 128 1.10.150.20
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9255 67 129 1.10.150.20
2h5xC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9248 67 132 1.10.150.20
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9199 65 131 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A348XZ20-F1-model_v4 deleted 0.8674 1 129
AF-A0A357VRU4-F1-model_v4 Helix-hairpin-helix DNA-binding motif class 1 domain-containing protein 0.8627 1 132 GO:0003677
GO:0003678
GO:0005737
GO:0006281
GO:0006310
AF-A0A349W2V0-F1-model_v4 Holliday junction branch migration protein RuvA 0.8617 4 127 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A348XZ20-F1-model_v4 deleted 0.8612 1 129
AF-A0A7C7PT71-F1-model_v4 Holliday junction branch migration complex subunit RuvA 0.8586 1 132 GO:0000400
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0048476
GO:0061749
GO:1990518

Map