F321907

General Info

Members Datasets Scaffolds Average Seq Length
211 162 211 229

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0114199|Ga0466963_0114199_843_1568
Length 222
Sequence MSKLPLAIRSMFALASGCGTTTANIDRGRELFKTKCGVCHTLAQAGTTAQVGPNLDDAFAAAREEGEDSDTIEGIVRAQVEHPRPYTSSSVSAVSMPPNVVEGQDLDDVAAYVGRWAGVPGAEPPKVPGGPGAQVFANNGCGGCHTLKAANSGGTTGPPLEEALKPSVDEAKLEEMITEPNAEIAKGYQPNIMPPNFGEVLSPKELEDLVQFLVESTPAGGA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 12.32
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022756 3300001979 Bacteria 2152
2 JGI24748J21848_1001098 3300002074 Bacteria 2942
3 JGI24034J26672_10000115 3300002239 Bacteria 12949
4 Ga0070683_100011312 3300005329 Bacteria 7707
5 Ga0070677_10000521 3300005333 Bacteria 13187
6 Ga0070666_10030539 3300005335 Bacteria 3551
7 Ga0070680_100014062 3300005336 Bacteria 6249
8 Ga0070682_100000023 3300005337 Bacteria 206016
9 Ga0068868_100022371 3300005338 Bacteria 4770
10 Ga0070691_10000970 3300005341 Bacteria 11707
11 Ga0070668_100120801 3300005347 Bacteria 2094
12 Ga0070674_100000141 3300005356 Bacteria 33366
13 Ga0070659_100055679 3300005366 Bacteria 3118
14 Ga0070667_100001110 3300005367 Bacteria 24556
15 Ga0070667_100762940 3300005367 Bacteria 897
16 Ga0070701_10393852 3300005438 Unclassified 876
17 Ga0070711_100047966 3300005439 Bacteria 2918
18 Ga0070700_100035172 3300005441 Bacteria 3030
19 Ga0070678_100007037 3300005456 Bacteria 6650
20 Ga0070681_10037706 3300005458 Bacteria 4849
21 Ga0070679_100000424 3300005530 Bacteria 35927
22 Ga0070684_100014422 3300005535 Bacteria 6403
23 Ga0070684_100122802 3300005535 Bacteria 2337
24 Ga0070686_100407651 3300005544 Bacteria 1035
25 Ga0070665_100000022 3300005548 Bacteria 379286
26 Ga0070665_100002868 3300005548 Bacteria 18629
27 Ga0070665_100038076 3300005548 Bacteria 4835
28 Ga0070665_100042444 3300005548 Bacteria 4572
29 Ga0068855_100053536 3300005563 Bacteria 4748
30 Ga0068854_100097017 3300005578 Bacteria 2203
31 Ga0068852_100063963 3300005616 Bacteria 3205
32 Ga0068859_101044738 3300005617 Unclassified 898
33 Ga0068864_100000090 3300005618 Bacteria 96213
34 Ga0068866_10000004 3300005718 Bacteria 202810
35 Ga0068866_10016679 3300005718 Bacteria 3289
36 Ga0068851_10003112 3300005834 Bacteria 7354
37 Ga0068863_100000261 3300005841 Bacteria 55053
38 Ga0068863_100190446 3300005841 Bacteria 1971
39 Ga0068863_100307565 3300005841 Unclassified 1538
40 Ga0068858_100000046 3300005842 Bacteria 127519
41 Ga0068858_100001180 3300005842 Bacteria 27065
42 Ga0068860_100272052 3300005843 Bacteria 1654
43 Ga0068862_100017783 3300005844 Bacteria 5917
44 Ga0070715_10000008 3300006163 Bacteria 189899
45 Ga0075431_100012857 3300006847 Bacteria 8447
46 Ga0097620_101044841 3300006931 Unclassified 898
47 Ga0105245_10000040 3300009098 Bacteria 144005
48 Ga0105247_10180200 3300009101 Bacteria 1410
49 Ga0105243_10007042 3300009148 Bacteria 8652
50 Ga0105242_10000428 3300009176 Bacteria 33565
51 Ga0105242_10037459 3300009176 Bacteria 3896
52 Ga0105242_10304021 3300009176 Bacteria 1457
53 Ga0105238_10000033 3300009551 Bacteria 172981
54 Ga0105249_10000218 3300009553 Bacteria 65480
55 Ga0105249_10017915 3300009553 Bacteria 6294
56 Ga0157374_10001719 3300013296 Bacteria 18377
57 Ga0157378_10118657 3300013297 Bacteria 2435
58 Ga0157375_10000492 3300013308 Bacteria 35821
59 Ga0157375_10009414 3300013308 Bacteria 8576
60 Ga0157375_10178721 3300013308 Bacteria 2273
61 Ga0157375_10462630 3300013308 Bacteria 1434
62 Ga0157380_10788027 3300014326 Bacteria 966
63 Ga0157379_10088527 3300014968 Unclassified 2777
64 Ga0157379_10141140 3300014968 Bacteria 2172
65 Ga0163161_10000064 3300017792 Bacteria 108508
66 Ga0207682_10000769 3300025893 Bacteria 14799
67 Ga0207642_10000005 3300025899 Bacteria 401934
68 Ga0207680_10007123 3300025903 Bacteria 5437
69 Ga0207685_10000012 3300025905 Bacteria 189900
70 Ga0207707_10059817 3300025912 Bacteria 3315
71 Ga0207693_10010825 3300025915 Bacteria 7404
72 Ga0207663_10050547 3300025916 Bacteria 2584
73 Ga0207663_10106046 3300025916 Bacteria 1898
74 Ga0207660_10004388 3300025917 Bacteria 9200
75 Ga0207662_10140064 3300025918 Bacteria 1532
76 Ga0207652_10000232 3300025921 Bacteria 58473
77 Ga0207694_10000012 3300025924 Bacteria 411218
78 Ga0207687_10000046 3300025927 Bacteria 99576
79 Ga0207690_10403354 3300025932 Unclassified 1091
80 Ga0207686_10000395 3300025934 Bacteria 30349
81 Ga0207709_10003313 3300025935 Bacteria 9648
82 Ga0207669_10000021 3300025937 Bacteria 100327
83 Ga0207665_10289148 3300025939 Bacteria 1222
84 Ga0207661_10007065 3300025944 Bacteria 7970
85 Ga0207667_10122450 3300025949 Bacteria 2680
86 Ga0207651_10003288 3300025960 Bacteria 7914
87 Ga0207712_10000027 3300025961 Bacteria 263739
88 Ga0207712_10047958 3300025961 Bacteria 2969
89 Ga0207668_10050729 3300025972 Bacteria 2861
90 Ga0207668_10058090 3300025972 Bacteria 2702
91 Ga0207640_10047856 3300025981 Bacteria 2761
92 Ga0207658_10001811 3300025986 Bacteria 15995
93 Ga0207658_10056859 3300025986 Bacteria 2905
94 Ga0207677_10009001 3300026023 Bacteria 5602
95 Ga0207703_10000020 3300026035 Bacteria 251603
96 Ga0207703_10000042 3300026035 Bacteria 161459
97 Ga0207639_10032914 3300026041 Bacteria 3821
98 Ga0207678_10118785 3300026067 Bacteria 2256
99 Ga0207708_10052500 3300026075 Bacteria 3105
100 Ga0207641_10000062 3300026088 Bacteria 159982
101 Ga0207641_10011027 3300026088 Bacteria 7412
102 Ga0207641_10190668 3300026088 Bacteria 1884
103 Ga0207676_10000016 3300026095 Bacteria 311561
104 Ga0207683_10634660 3300026121 Bacteria 989
105 Ga0207698_10044308 3300026142 Bacteria 3342
106 Ga0268266_10000029 3300028379 Bacteria 424015
107 Ga0268266_10000526 3300028379 Bacteria 53404
108 Ga0268266_10015588 3300028379 Bacteria 6515
109 Ga0268266_10024467 3300028379 Bacteria 5135
110 Ga0268265_10001768 3300028380 Bacteria 17341
111 Ga0268264_10001191 3300028381 Bacteria 25160
112 Ga0307513_10290941 3300031456 Bacteria 1405
113 Ga0373937_0196444 3300036401 Bacteria 1896
114 Ga0451800_0385771 3300041459 Bacteria 1555
115 Ga0451833_0010390 3300041491 Bacteria 999
116 Ga0451853_1793063 3300041512 Bacteria 3429
117 Ga0466963_0000233 3300044694 Bacteria 24036
118 Ga0466963_0114199 3300044694 Bacteria 1855
119 Ga0466960_0148645 3300044901 Bacteria 1250
120 Ga0466967_0005859 3300045976 Bacteria 8601
121 Ga0466967_0027611 3300045976 Bacteria 4724
122 Ga0495592_0000024 3300046454 Bacteria 136661
123 Ga0495603_0001201 3300046455 Bacteria 15127
124 Ga0495629_0029414 3300046459 Bacteria 3896
125 Ga0495641_0000004 3300046461 Bacteria 210501
126 Ga0495641_0103083 3300046461 Bacteria 1273
127 Ga0495651_0069917 3300046462 Bacteria 2672
128 Ga0495651_0115113 3300046462 Bacteria 1983
129 Ga0495653_0053993 3300046463 Bacteria 3072
130 Ga0495662_0000069 3300046476 Bacteria 36219
131 Ga0495608_0005080 3300046511 Bacteria 9402
132 Ga0495608_0022084 3300046511 Bacteria 4362
133 Ga0495618_0000267 3300046514 Bacteria 37924
134 Ga0495620_0000041 3300046515 Bacteria 112605
135 Ga0495628_0481997 3300046516 Bacteria 897
136 Ga0495630_0009525 3300046517 Bacteria 6985
137 Ga0495630_0063626 3300046517 Bacteria 2771
138 Ga0495644_0002165 3300046523 Bacteria 7890
139 Ga0495652_0116183 3300046529 Bacteria 2143
140 Ga0495640_0039697 3300046533 Bacteria 3301
141 Ga0495586_0000254 3300046535 Bacteria 35015
142 Ga0495587_0065886 3300046536 Bacteria 2114
143 Ga0495621_0000692 3300046539 Bacteria 8511
144 Ga0495645_0177790 3300046543 Bacteria 1460
145 Ga0495667_0000038 3300046559 Bacteria 131349
146 Ga0495634_0000002 3300046642 Bacteria 247842
147 Ga0495635_0000005 3300046663 Bacteria 302178
148 Ga0495588_0000073 3300046674 Bacteria 219005
149 Ga0495647_0000005 3300046681 Bacteria 125996
150 Ga0495647_0073084 3300046681 Bacteria 1376
151 Ga0495658_0000001 3300046683 Bacteria 385362
152 Ga0495669_0003848 3300046684 Bacteria 6171
153 Ga0495613_0001632 3300046689 Bacteria 17071
154 Ga0495624_0019486 3300046690 Bacteria 4525
155 Ga0495670_0080120 3300046691 Bacteria 1663
156 Ga0495649_0007918 3300046694 Bacteria 6430
157 Ga0495600_0007613 3300046809 Bacteria 6634
158 Ga0495604_0000100 3300047317 Bacteria 72995
159 Ga0495674_0479463 3300047319 Bacteria 997
160 Ga0495672_0098919 3300047320 Bacteria 1586
161 Ga0495676_0034965 3300047321 Bacteria 4209
162 Ga0495676_0044649 3300047321 Bacteria 3615
163 Ga0495680_0000007 3300047322 Bacteria 152053
164 Ga0495680_0000929 3300047322 Bacteria 32526
165 Ga0495680_0001001 3300047322 Bacteria 31451
166 Ga0495685_016294 3300047447 Bacteria 2538
167 Ga0495673_0039178 3300047469 Unclassified 2151
168 Ga0495686_0126272 3300047472 Bacteria 1520
169 Ga0495602_0161166 3300048088 Bacteria 1751
170 Ga0496100_0000024 3300048903 Bacteria 116138
171 Ga0496101_0000072 3300048904 Bacteria 116138
172 Ga0496102_0181760 3300048905 Bacteria 1982
173 Ga0496104_0000008 3300048907 Bacteria 516976
174 Ga0496104_0000230 3300048907 Bacteria 49225
175 Ga0496105_0000003 3300048908 Bacteria 713251
176 Ga0496105_0000051 3300048908 Bacteria 90365
177 Ga0496106_0000040 3300048909 Bacteria 108754
178 Ga0496106_0000042 3300048909 Bacteria 106662
179 Ga0496107_0000025 3300048910 Bacteria 116138
180 Ga0496107_0030281 3300048910 Bacteria 3857
181 Ga0496107_0129837 3300048910 Bacteria 1860
182 Ga0496108_0000004 3300048911 Bacteria 545055
183 Ga0496108_0082672 3300048911 Bacteria 2723
184 Ga0496109_0000013 3300048912 Bacteria 227469
185 Ga0496109_0000378 3300048912 Bacteria 40469
186 Ga0496109_0125990 3300048912 Bacteria 2388
187 Ga0496110_0085616 3300048913 Bacteria 2813
188 Ga0496111_0237731 3300048914 Bacteria 1353
189 Ga0496111_0574519 3300048914 Bacteria 826
190 Ga0496113_0622284 3300048916 Bacteria 864
191 Ga0496114_0005156 3300048917 Bacteria 10194
192 Ga0496114_0186386 3300048917 Bacteria 1814
193 Ga0496115_0000016 3300048918 Bacteria 187067
194 Ga0496115_0004801 3300048918 Bacteria 9806
195 Ga0501038_0363120 3300049574 Bacteria 1126
196 Ga0501042_0009362 3300049578 Bacteria 6526
197 Ga0501068_0193042 3300049584 Bacteria 1290
198 Ga0501071_0649902 3300049587 Unclassified 811
199 Ga0501072_0157980 3300049588 Bacteria 1808
200 Ga0501075_0006173 3300049591 Bacteria 8237
201 Ga0501076_0016445 3300049592 Bacteria 5609
202 nmdc:mga0qj67_145159_c1 3300050509 Bacteria 1924
203 nmdc:mga06r32_380219_c1 3300050510 Bacteria 1395
204 Ga0495601_0003205 3300053077 Bacteria 9362
205 Ga0495601_0020026 3300053077 Bacteria 4083
206 Ga0495612_0003768 3300053078 Bacteria 6305
207 Ga0495595_0000378 3300053084 Bacteria 16864
208 Ga0495619_0000127 3300053085 Bacteria 55995
209 Ga0495619_0007002 3300053085 Bacteria 7137
210 Ga0500566_0033940 3300053094 Bacteria 2971
211 Ga0500614_000426 3300053123 Bacteria 10958

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0005859 Ga0466967_0005859_4008_4739 194
2 3300048911 Ga0496108_0082672 Ga0496108_0082672_1127_1864 198
3 3300048912 Ga0496109_0125990 Ga0496109_0125990_1492_2229 198
4 3300013308 Ga0157375_10000492 Ga0157375_100004927 204
5 3300017792 Ga0163161_10000064 Ga0163161_10000064118 204
6 3300046511 Ga0495608_0005080 Ga0495608_0005080_3606_4313 204
7 3300053084 Ga0495595_0000378 Ga0495595_0000378_7932_8639 204
8 3300046515 Ga0495620_0000041 Ga0495620_0000041_39554_40303 205
9 3300005341 Ga0070691_10000970 Ga0070691_1000097012 207
10 3300005618 Ga0068864_100000090 Ga0068864_10000009078 207
11 3300026095 Ga0207676_10000016 Ga0207676_10000016292 207
12 3300049592 Ga0501076_0016445 Ga0501076_0016445_1837_2529 207
13 3300005842 Ga0068858_100000046 Ga0068858_10000004671 208
14 3300013296 Ga0157374_10001719 Ga0157374_1000171919 208
15 3300026035 Ga0207703_10000042 Ga0207703_1000004236 208
16 3300036401 Ga0373937_0196444 Ga0373937_0196444_1127_1840 208
17 3300046559 Ga0495667_0000038 Ga0495667_0000038_41440_42153 208
18 3300047317 Ga0495604_0000100 Ga0495604_0000100_68258_68983 208
19 3300047322 Ga0495680_0001001 Ga0495680_0001001_16013_16726 208
20 3300048911 Ga0496108_0000004 Ga0496108_0000004_467911_468642 208
21 3300048912 Ga0496109_0000013 Ga0496109_0000013_150352_151083 208
22 3300048918 Ga0496115_0004801 Ga0496115_0004801_2048_2761 208
23 3300049574 Ga0501038_0363120 Ga0501038_0363120_21_722 208
24 3300049587 Ga0501071_0649902 Ga0501071_0649902_65_766 208
25 3300049588 Ga0501072_0157980 Ga0501072_0157980_830_1531 208
26 3300005535 Ga0070684_100014422 Ga0070684_1000144224 209
27 3300044694 Ga0466963_0114199 Ga0466963_0114199_843_1568 209
28 3300044901 Ga0466960_0148645 Ga0466960_0148645_56_781 209
29 3300045976 Ga0466967_0027611 Ga0466967_0027611_1060_1785 209
30 3300046539 Ga0495621_0000692 Ga0495621_0000692_3448_4131 209
31 3300048909 Ga0496106_0000042 Ga0496106_0000042_58906_59607 209
32 3300048910 Ga0496107_0030281 Ga0496107_0030281_1374_2075 209
33 3300050509 nmdc:mga0qj67_145159_c1 nmdc:mga0qj67_145159_c1_110_802 209
34 3300005367 Ga0070667_100001110 Ga0070667_10000111020 210
35 3300005544 Ga0070686_100407651 Ga0070686_1004076511 210
36 3300005548 Ga0070665_100042444 Ga0070665_1000424445 210
37 3300005617 Ga0068859_101044738 Ga0068859_1010447381 210
38 3300005841 Ga0068863_100307565 Ga0068863_1003075652 210
39 3300005843 Ga0068860_100272052 Ga0068860_1002720522 210
40 3300005844 Ga0068862_100017783 Ga0068862_1000177837 210
41 3300006931 Ga0097620_101044841 Ga0097620_1010448411 210
42 3300009101 Ga0105247_10180200 Ga0105247_101802002 210
43 3300009553 Ga0105249_10017915 Ga0105249_100179155 210
44 3300014968 Ga0157379_10141140 Ga0157379_101411405 210
45 3300025961 Ga0207712_10047958 Ga0207712_100479582 210
46 3300025972 Ga0207668_10050729 Ga0207668_100507293 210
47 3300025986 Ga0207658_10001811 Ga0207658_100018118 210
48 3300026088 Ga0207641_10190668 Ga0207641_101906682 210
49 3300028379 Ga0268266_10024467 Ga0268266_100244676 210
50 3300028380 Ga0268265_10001768 Ga0268265_100017685 210
51 3300046463 Ga0495653_0053993 Ga0495653_0053993_1355_2062 210
52 3300047320 Ga0495672_0098919 Ga0495672_0098919_509_1195 210
53 3300048914 Ga0496111_0237731 Ga0496111_0237731_379_1065 210
54 3300053085 Ga0495619_0000127 Ga0495619_0000127_1764_2450 210
55 3300005563 Ga0068855_100053536 Ga0068855_1000535362 211
56 3300005616 Ga0068852_100063963 Ga0068852_1000639632 211
57 3300006847 Ga0075431_100012857 Ga0075431_1000128578 211
58 3300009553 Ga0105249_10000218 Ga0105249_1000021840 211
59 3300025949 Ga0207667_10122450 Ga0207667_101224504 211
60 3300025961 Ga0207712_10000027 Ga0207712_10000027233 211
61 3300026142 Ga0207698_10044308 Ga0207698_100443085 211
62 3300046511 Ga0495608_0022084 Ga0495608_0022084_3194_3898 211
63 3300048905 Ga0496102_0181760 Ga0496102_0181760_649_1359 211
64 3300048913 Ga0496110_0085616 Ga0496110_0085616_1075_1785 211
65 3300048914 Ga0496111_0574519 Ga0496111_0574519_10_720 211
66 3300049578 Ga0501042_0009362 Ga0501042_0009362_3782_4483 211
67 3300050510 nmdc:mga06r32_380219_c1 nmdc:mga06r32_380219_c1_536_1246 211
68 3300014968 Ga0157379_10088527 Ga0157379_100885272 212
69 3300026067 Ga0207678_10118785 Ga0207678_101187855 212
70 3300046691 Ga0495670_0080120 Ga0495670_0080120_795_1517 212
71 3300047469 Ga0495673_0039178 Ga0495673_0039178_560_1267 212
72 3300002074 JGI24748J21848_1001098 JGI24748J21848_10010984 213
73 3300002239 JGI24034J26672_10000115 JGI24034J26672_100001155 213
74 3300005333 Ga0070677_10000521 Ga0070677_100005217 213
75 3300005335 Ga0070666_10030539 Ga0070666_100305394 213
76 3300005347 Ga0070668_100120801 Ga0070668_1001208013 213
77 3300005356 Ga0070674_100000141 Ga0070674_10000014133 213
78 3300005367 Ga0070667_100762940 Ga0070667_1007629401 213
79 3300005456 Ga0070678_100007037 Ga0070678_1000070372 213
80 3300005548 Ga0070665_100002868 Ga0070665_1000028688 213
81 3300005548 Ga0070665_100038076 Ga0070665_1000380766 213
82 3300005578 Ga0068854_100097017 Ga0068854_1000970175 213
83 3300005718 Ga0068866_10000004 Ga0068866_100000046 213
84 3300005834 Ga0068851_10003112 Ga0068851_100031127 213
85 3300006163 Ga0070715_10000008 Ga0070715_1000000842 213
86 3300009098 Ga0105245_10000040 Ga0105245_1000004036 213
87 3300009148 Ga0105243_10007042 Ga0105243_100070427 213
88 3300009176 Ga0105242_10037459 Ga0105242_100374595 213
89 3300013308 Ga0157375_10009414 Ga0157375_100094148 213
90 3300013308 Ga0157375_10178721 Ga0157375_101787211 213
91 3300014326 Ga0157380_10788027 Ga0157380_107880272 213
92 3300025893 Ga0207682_10000769 Ga0207682_1000076910 213
93 3300025899 Ga0207642_10000005 Ga0207642_10000005201 213
94 3300025903 Ga0207680_10007123 Ga0207680_100071233 213
95 3300025905 Ga0207685_10000012 Ga0207685_1000001242 213
96 3300025915 Ga0207693_10010825 Ga0207693_100108258 213
97 3300025918 Ga0207662_10140064 Ga0207662_101400642 213
98 3300025927 Ga0207687_10000046 Ga0207687_100000467 213
99 3300025935 Ga0207709_10003313 Ga0207709_100033137 213
100 3300025937 Ga0207669_10000021 Ga0207669_1000002126 213
101 3300025972 Ga0207668_10058090 Ga0207668_100580904 213
102 3300025981 Ga0207640_10047856 Ga0207640_100478562 213
103 3300025986 Ga0207658_10056859 Ga0207658_100568593 213
104 3300028379 Ga0268266_10000526 Ga0268266_1000052635 213
105 3300028379 Ga0268266_10015588 Ga0268266_100155886 213
106 3300028381 Ga0268264_10001191 Ga0268264_100011918 213
107 3300046674 Ga0495588_0000073 Ga0495588_0000073_174281_174979 213
108 3300046681 Ga0495647_0000005 Ga0495647_0000005_92496_93194 213
109 3300046684 Ga0495669_0003848 Ga0495669_0003848_4329_5042 213
110 3300048903 Ga0496100_0000024 Ga0496100_0000024_76276_76989 213
111 3300048904 Ga0496101_0000072 Ga0496101_0000072_39150_39863 213
112 3300048907 Ga0496104_0000008 Ga0496104_0000008_126918_127616 213
113 3300048908 Ga0496105_0000003 Ga0496105_0000003_126918_127616 213
114 3300048909 Ga0496106_0000040 Ga0496106_0000040_68892_69605 213
115 3300048910 Ga0496107_0000025 Ga0496107_0000025_76276_76989 213
116 3300048910 Ga0496107_0129837 Ga0496107_0129837_621_1319 213
117 3300049584 Ga0501068_0193042 Ga0501068_0193042_252_950 213
118 3300053077 Ga0495601_0020026 Ga0495601_0020026_1219_1920 213
119 3300005336 Ga0070680_100014062 Ga0070680_1000140622 214
120 3300005438 Ga0070701_10393852 Ga0070701_103938521 214
121 3300005441 Ga0070700_100035172 Ga0070700_1000351723 214
122 3300005458 Ga0070681_10037706 Ga0070681_100377065 214
123 3300005530 Ga0070679_100000424 Ga0070679_10000042413 214
124 3300013308 Ga0157375_10462630 Ga0157375_104626302 214
125 3300025912 Ga0207707_10059817 Ga0207707_100598172 214
126 3300025917 Ga0207660_10004388 Ga0207660_100043889 214
127 3300025921 Ga0207652_10000232 Ga0207652_1000023211 214
128 3300026075 Ga0207708_10052500 Ga0207708_100525004 214
129 3300046543 Ga0495645_0177790 Ga0495645_0177790_179_919 214
130 3300047319 Ga0495674_0479463 Ga0495674_0479463_253_963 214
131 3300047472 Ga0495686_0126272 Ga0495686_0126272_711_1421 214
132 3300005329 Ga0070683_100011312 Ga0070683_1000113127 215
133 3300005338 Ga0068868_100022371 Ga0068868_1000223712 215
134 3300005439 Ga0070711_100047966 Ga0070711_1000479664 215
135 3300005535 Ga0070684_100122802 Ga0070684_1001228023 215
136 3300005841 Ga0068863_100000261 Ga0068863_10000026118 215
137 3300009176 Ga0105242_10304021 Ga0105242_103040212 215
138 3300009551 Ga0105238_10000033 Ga0105238_10000033129 215
139 3300025916 Ga0207663_10050547 Ga0207663_100505473 215
140 3300025924 Ga0207694_10000012 Ga0207694_10000012130 215
141 3300025939 Ga0207665_10289148 Ga0207665_102891482 215
142 3300025944 Ga0207661_10007065 Ga0207661_100070656 215
143 3300026023 Ga0207677_10009001 Ga0207677_100090017 215
144 3300026088 Ga0207641_10000062 Ga0207641_10000062136 215
145 3300041491 Ga0451833_0010390 Ga0451833_0010390_98_808 215
146 3300046454 Ga0495592_0000024 Ga0495592_0000024_128826_129533 215
147 3300046455 Ga0495603_0001201 Ga0495603_0001201_5208_5915 215
148 3300046461 Ga0495641_0103083 Ga0495641_0103083_452_1159 215
149 3300046462 Ga0495651_0069917 Ga0495651_0069917_1699_2406 215
150 3300046476 Ga0495662_0000069 Ga0495662_0000069_34829_35536 215
151 3300046514 Ga0495618_0000267 Ga0495618_0000267_8322_9029 215
152 3300046516 Ga0495628_0481997 Ga0495628_0481997_66_773 215
153 3300046517 Ga0495630_0009525 Ga0495630_0009525_593_1300 215
154 3300046517 Ga0495630_0063626 Ga0495630_0063626_1612_2316 215
155 3300046533 Ga0495640_0039697 Ga0495640_0039697_1873_2580 215
156 3300046535 Ga0495586_0000254 Ga0495586_0000254_6558_7301 215
157 3300046536 Ga0495587_0065886 Ga0495587_0065886_56_763 215
158 3300046642 Ga0495634_0000002 Ga0495634_0000002_121611_122321 215
159 3300046663 Ga0495635_0000005 Ga0495635_0000005_24508_25215 215
160 3300046681 Ga0495647_0073084 Ga0495647_0073084_648_1355 215
161 3300046683 Ga0495658_0000001 Ga0495658_0000001_145084_145794 215
162 3300046689 Ga0495613_0001632 Ga0495613_0001632_15689_16396 215
163 3300046690 Ga0495624_0019486 Ga0495624_0019486_2276_2983 215
164 3300046809 Ga0495600_0007613 Ga0495600_0007613_1542_2249 215
165 3300047322 Ga0495680_0000007 Ga0495680_0000007_132729_133436 215
166 3300047322 Ga0495680_0000929 Ga0495680_0000929_23566_24273 215
167 3300047447 Ga0495685_016294 Ga0495685_016294_246_953 215
168 3300048912 Ga0496109_0000378 Ga0496109_0000378_34583_35293 215
169 3300048917 Ga0496114_0005156 Ga0496114_0005156_6276_7019 215
170 3300053085 Ga0495619_0007002 Ga0495619_0007002_3782_4489 215
171 3300005366 Ga0070659_100055679 Ga0070659_1000556791 216
172 3300005548 Ga0070665_100000022 Ga0070665_10000002218 216
173 3300005718 Ga0068866_10016679 Ga0068866_100166796 216
174 3300005842 Ga0068858_100001180 Ga0068858_10000118018 216
175 3300025916 Ga0207663_10106046 Ga0207663_101060462 216
176 3300025932 Ga0207690_10403354 Ga0207690_104033542 216
177 3300026035 Ga0207703_10000020 Ga0207703_1000002072 216
178 3300026041 Ga0207639_10032914 Ga0207639_100329145 216
179 3300028379 Ga0268266_10000029 Ga0268266_10000029431 216
180 3300031456 Ga0307513_10290941 Ga0307513_102909412 216
181 3300041459 Ga0451800_0385771 Ga0451800_0385771_656_1363 216
182 3300041512 Ga0451853_1793063 Ga0451853_1793063_1372_2079 216
183 3300046461 Ga0495641_0000004 Ga0495641_0000004_80633_81340 216
184 3300046694 Ga0495649_0007918 Ga0495649_0007918_3824_4531 216
185 3300047321 Ga0495676_0044649 Ga0495676_0044649_2319_3026 216
186 3300048088 Ga0495602_0161166 Ga0495602_0161166_652_1362 216
187 3300048917 Ga0496114_0186386 Ga0496114_0186386_771_1490 216
188 3300048918 Ga0496115_0000016 Ga0496115_0000016_31996_32715 216
189 3300049591 Ga0501075_0006173 Ga0501075_0006173_4928_5641 216
190 3300053094 Ga0500566_0033940 Ga0500566_0033940_1336_2052 216
191 3300053123 Ga0500614_000426 Ga0500614_000426_4917_5624 216
192 3300001979 JGI24740J21852_10022756 JGI24740J21852_100227562 217
193 3300005337 Ga0070682_100000023 Ga0070682_100000023162 217
194 3300005841 Ga0068863_100190446 Ga0068863_1001904462 217
195 3300009176 Ga0105242_10000428 Ga0105242_1000042836 217
196 3300013297 Ga0157378_10118657 Ga0157378_101186572 217
197 3300025934 Ga0207686_10000395 Ga0207686_1000039523 217
198 3300025960 Ga0207651_10003288 Ga0207651_100032889 217
199 3300026088 Ga0207641_10011027 Ga0207641_100110275 217
200 3300026121 Ga0207683_10634660 Ga0207683_106346601 217
201 3300044694 Ga0466963_0000233 Ga0466963_0000233_8430_9140 217
202 3300046459 Ga0495629_0029414 Ga0495629_0029414_1358_2068 217
203 3300046462 Ga0495651_0115113 Ga0495651_0115113_1227_1940 217
204 3300046523 Ga0495644_0002165 Ga0495644_0002165_6668_7387 217
205 3300046529 Ga0495652_0116183 Ga0495652_0116183_1079_1792 217
206 3300047321 Ga0495676_0034965 Ga0495676_0034965_1084_1794 217
207 3300048907 Ga0496104_0000230 Ga0496104_0000230_2326_3039 217
208 3300048908 Ga0496105_0000051 Ga0496105_0000051_73245_73958 217
209 3300048916 Ga0496113_0622284 Ga0496113_0622284_45_794 217
210 3300053077 Ga0495601_0003205 Ga0495601_0003205_4152_4865 217
211 3300053078 Ga0495612_0003768 Ga0495612_0003768_4373_5086 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

130

217

0.88

PF00034

Cytochrom_C

Cytochrome c

25

115

0.8

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

129

213

0.64

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

23

113

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pw9-assembly1.cif.gz_B crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti 0.7521 120 207
4pwa-assembly2.cif.gz_D crystal structure of the c-type cytochrome soru from sinorhizobium meliloti 0.7215 16 115
4pw9-assembly1.cif.gz_B crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti 0.7022 120 207
4pwa-assembly2.cif.gz_D crystal structure of the c-type cytochrome soru from sinorhizobium meliloti 0.6864 16 115
4xxl-assembly1.cif.gz_A crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 0.6767 115 205
ID Description Score Start End Superfamily
4pwaC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8027 16 107 1.10.760.10
4pwaC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7426 16 107 1.10.760.10
4xxlA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6767 115 205 1.10.760.10
4xxlA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6648 115 205 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6523 13 109 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A537TV08-F1-model_v4 C-type cytochrome 0.9916 120 208 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7W0TSV4-F1-model_v4 C-type cytochrome 0.9892 120 201 GO:0009055
GO:0020037
GO:0046872
AF-A0A3M1YJ04-F1-model_v4 Cytochrome c domain-containing protein 0.9528 158 203 GO:0009055
GO:0020037
AF-A0A7V9R9Y1-F1-model_v4 Cytochrome c 0.9507 120 204 GO:0009055
GO:0020037
GO:0046872
AF-A0A6J6NDD0-F1-model_v4 Unannotated protein 0.9436 13 109 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.17 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map