F321907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 162 | 211 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0114199|Ga0466963_0114199_843_1568 |
| Length | 222 |
| Sequence | MSKLPLAIRSMFALASGCGTTTANIDRGRELFKTKCGVCHTLAQAGTTAQVGPNLDDAFAAAREEGEDSDTIEGIVRAQVEHPRPYTSSSVSAVSMPPNVVEGQDLDDVAAYVGRWAGVPGAEPPKVPGGPGAQVFANNGCGGCHTLKAANSGGTTGPPLEEALKPSVDEAKLEEMITEPNAEIAKGYQPNIMPPNFGEVLSPKELEDLVQFLVESTPAGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 87 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 89 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 90 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 93 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 94 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 137 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 138 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 139 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 140 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 141 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 162 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.95 |
| Nodule | 0 |
| Rhizoplane | 12.32 |
| Rhizosphere | 85.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022756 | 3300001979 | Bacteria | 2152 |
| 2 | JGI24748J21848_1001098 | 3300002074 | Bacteria | 2942 |
| 3 | JGI24034J26672_10000115 | 3300002239 | Bacteria | 12949 |
| 4 | Ga0070683_100011312 | 3300005329 | Bacteria | 7707 |
| 5 | Ga0070677_10000521 | 3300005333 | Bacteria | 13187 |
| 6 | Ga0070666_10030539 | 3300005335 | Bacteria | 3551 |
| 7 | Ga0070680_100014062 | 3300005336 | Bacteria | 6249 |
| 8 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 9 | Ga0068868_100022371 | 3300005338 | Bacteria | 4770 |
| 10 | Ga0070691_10000970 | 3300005341 | Bacteria | 11707 |
| 11 | Ga0070668_100120801 | 3300005347 | Bacteria | 2094 |
| 12 | Ga0070674_100000141 | 3300005356 | Bacteria | 33366 |
| 13 | Ga0070659_100055679 | 3300005366 | Bacteria | 3118 |
| 14 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 15 | Ga0070667_100762940 | 3300005367 | Bacteria | 897 |
| 16 | Ga0070701_10393852 | 3300005438 | Unclassified | 876 |
| 17 | Ga0070711_100047966 | 3300005439 | Bacteria | 2918 |
| 18 | Ga0070700_100035172 | 3300005441 | Bacteria | 3030 |
| 19 | Ga0070678_100007037 | 3300005456 | Bacteria | 6650 |
| 20 | Ga0070681_10037706 | 3300005458 | Bacteria | 4849 |
| 21 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 22 | Ga0070684_100014422 | 3300005535 | Bacteria | 6403 |
| 23 | Ga0070684_100122802 | 3300005535 | Bacteria | 2337 |
| 24 | Ga0070686_100407651 | 3300005544 | Bacteria | 1035 |
| 25 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 26 | Ga0070665_100002868 | 3300005548 | Bacteria | 18629 |
| 27 | Ga0070665_100038076 | 3300005548 | Bacteria | 4835 |
| 28 | Ga0070665_100042444 | 3300005548 | Bacteria | 4572 |
| 29 | Ga0068855_100053536 | 3300005563 | Bacteria | 4748 |
| 30 | Ga0068854_100097017 | 3300005578 | Bacteria | 2203 |
| 31 | Ga0068852_100063963 | 3300005616 | Bacteria | 3205 |
| 32 | Ga0068859_101044738 | 3300005617 | Unclassified | 898 |
| 33 | Ga0068864_100000090 | 3300005618 | Bacteria | 96213 |
| 34 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 35 | Ga0068866_10016679 | 3300005718 | Bacteria | 3289 |
| 36 | Ga0068851_10003112 | 3300005834 | Bacteria | 7354 |
| 37 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 38 | Ga0068863_100190446 | 3300005841 | Bacteria | 1971 |
| 39 | Ga0068863_100307565 | 3300005841 | Unclassified | 1538 |
| 40 | Ga0068858_100000046 | 3300005842 | Bacteria | 127519 |
| 41 | Ga0068858_100001180 | 3300005842 | Bacteria | 27065 |
| 42 | Ga0068860_100272052 | 3300005843 | Bacteria | 1654 |
| 43 | Ga0068862_100017783 | 3300005844 | Bacteria | 5917 |
| 44 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 45 | Ga0075431_100012857 | 3300006847 | Bacteria | 8447 |
| 46 | Ga0097620_101044841 | 3300006931 | Unclassified | 898 |
| 47 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 48 | Ga0105247_10180200 | 3300009101 | Bacteria | 1410 |
| 49 | Ga0105243_10007042 | 3300009148 | Bacteria | 8652 |
| 50 | Ga0105242_10000428 | 3300009176 | Bacteria | 33565 |
| 51 | Ga0105242_10037459 | 3300009176 | Bacteria | 3896 |
| 52 | Ga0105242_10304021 | 3300009176 | Bacteria | 1457 |
| 53 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 54 | Ga0105249_10000218 | 3300009553 | Bacteria | 65480 |
| 55 | Ga0105249_10017915 | 3300009553 | Bacteria | 6294 |
| 56 | Ga0157374_10001719 | 3300013296 | Bacteria | 18377 |
| 57 | Ga0157378_10118657 | 3300013297 | Bacteria | 2435 |
| 58 | Ga0157375_10000492 | 3300013308 | Bacteria | 35821 |
| 59 | Ga0157375_10009414 | 3300013308 | Bacteria | 8576 |
| 60 | Ga0157375_10178721 | 3300013308 | Bacteria | 2273 |
| 61 | Ga0157375_10462630 | 3300013308 | Bacteria | 1434 |
| 62 | Ga0157380_10788027 | 3300014326 | Bacteria | 966 |
| 63 | Ga0157379_10088527 | 3300014968 | Unclassified | 2777 |
| 64 | Ga0157379_10141140 | 3300014968 | Bacteria | 2172 |
| 65 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 66 | Ga0207682_10000769 | 3300025893 | Bacteria | 14799 |
| 67 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 68 | Ga0207680_10007123 | 3300025903 | Bacteria | 5437 |
| 69 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 70 | Ga0207707_10059817 | 3300025912 | Bacteria | 3315 |
| 71 | Ga0207693_10010825 | 3300025915 | Bacteria | 7404 |
| 72 | Ga0207663_10050547 | 3300025916 | Bacteria | 2584 |
| 73 | Ga0207663_10106046 | 3300025916 | Bacteria | 1898 |
| 74 | Ga0207660_10004388 | 3300025917 | Bacteria | 9200 |
| 75 | Ga0207662_10140064 | 3300025918 | Bacteria | 1532 |
| 76 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 77 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 78 | Ga0207687_10000046 | 3300025927 | Bacteria | 99576 |
| 79 | Ga0207690_10403354 | 3300025932 | Unclassified | 1091 |
| 80 | Ga0207686_10000395 | 3300025934 | Bacteria | 30349 |
| 81 | Ga0207709_10003313 | 3300025935 | Bacteria | 9648 |
| 82 | Ga0207669_10000021 | 3300025937 | Bacteria | 100327 |
| 83 | Ga0207665_10289148 | 3300025939 | Bacteria | 1222 |
| 84 | Ga0207661_10007065 | 3300025944 | Bacteria | 7970 |
| 85 | Ga0207667_10122450 | 3300025949 | Bacteria | 2680 |
| 86 | Ga0207651_10003288 | 3300025960 | Bacteria | 7914 |
| 87 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 88 | Ga0207712_10047958 | 3300025961 | Bacteria | 2969 |
| 89 | Ga0207668_10050729 | 3300025972 | Bacteria | 2861 |
| 90 | Ga0207668_10058090 | 3300025972 | Bacteria | 2702 |
| 91 | Ga0207640_10047856 | 3300025981 | Bacteria | 2761 |
| 92 | Ga0207658_10001811 | 3300025986 | Bacteria | 15995 |
| 93 | Ga0207658_10056859 | 3300025986 | Bacteria | 2905 |
| 94 | Ga0207677_10009001 | 3300026023 | Bacteria | 5602 |
| 95 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 96 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 97 | Ga0207639_10032914 | 3300026041 | Bacteria | 3821 |
| 98 | Ga0207678_10118785 | 3300026067 | Bacteria | 2256 |
| 99 | Ga0207708_10052500 | 3300026075 | Bacteria | 3105 |
| 100 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 101 | Ga0207641_10011027 | 3300026088 | Bacteria | 7412 |
| 102 | Ga0207641_10190668 | 3300026088 | Bacteria | 1884 |
| 103 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 104 | Ga0207683_10634660 | 3300026121 | Bacteria | 989 |
| 105 | Ga0207698_10044308 | 3300026142 | Bacteria | 3342 |
| 106 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 107 | Ga0268266_10000526 | 3300028379 | Bacteria | 53404 |
| 108 | Ga0268266_10015588 | 3300028379 | Bacteria | 6515 |
| 109 | Ga0268266_10024467 | 3300028379 | Bacteria | 5135 |
| 110 | Ga0268265_10001768 | 3300028380 | Bacteria | 17341 |
| 111 | Ga0268264_10001191 | 3300028381 | Bacteria | 25160 |
| 112 | Ga0307513_10290941 | 3300031456 | Bacteria | 1405 |
| 113 | Ga0373937_0196444 | 3300036401 | Bacteria | 1896 |
| 114 | Ga0451800_0385771 | 3300041459 | Bacteria | 1555 |
| 115 | Ga0451833_0010390 | 3300041491 | Bacteria | 999 |
| 116 | Ga0451853_1793063 | 3300041512 | Bacteria | 3429 |
| 117 | Ga0466963_0000233 | 3300044694 | Bacteria | 24036 |
| 118 | Ga0466963_0114199 | 3300044694 | Bacteria | 1855 |
| 119 | Ga0466960_0148645 | 3300044901 | Bacteria | 1250 |
| 120 | Ga0466967_0005859 | 3300045976 | Bacteria | 8601 |
| 121 | Ga0466967_0027611 | 3300045976 | Bacteria | 4724 |
| 122 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 123 | Ga0495603_0001201 | 3300046455 | Bacteria | 15127 |
| 124 | Ga0495629_0029414 | 3300046459 | Bacteria | 3896 |
| 125 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 126 | Ga0495641_0103083 | 3300046461 | Bacteria | 1273 |
| 127 | Ga0495651_0069917 | 3300046462 | Bacteria | 2672 |
| 128 | Ga0495651_0115113 | 3300046462 | Bacteria | 1983 |
| 129 | Ga0495653_0053993 | 3300046463 | Bacteria | 3072 |
| 130 | Ga0495662_0000069 | 3300046476 | Bacteria | 36219 |
| 131 | Ga0495608_0005080 | 3300046511 | Bacteria | 9402 |
| 132 | Ga0495608_0022084 | 3300046511 | Bacteria | 4362 |
| 133 | Ga0495618_0000267 | 3300046514 | Bacteria | 37924 |
| 134 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 135 | Ga0495628_0481997 | 3300046516 | Bacteria | 897 |
| 136 | Ga0495630_0009525 | 3300046517 | Bacteria | 6985 |
| 137 | Ga0495630_0063626 | 3300046517 | Bacteria | 2771 |
| 138 | Ga0495644_0002165 | 3300046523 | Bacteria | 7890 |
| 139 | Ga0495652_0116183 | 3300046529 | Bacteria | 2143 |
| 140 | Ga0495640_0039697 | 3300046533 | Bacteria | 3301 |
| 141 | Ga0495586_0000254 | 3300046535 | Bacteria | 35015 |
| 142 | Ga0495587_0065886 | 3300046536 | Bacteria | 2114 |
| 143 | Ga0495621_0000692 | 3300046539 | Bacteria | 8511 |
| 144 | Ga0495645_0177790 | 3300046543 | Bacteria | 1460 |
| 145 | Ga0495667_0000038 | 3300046559 | Bacteria | 131349 |
| 146 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 147 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 148 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 149 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 150 | Ga0495647_0073084 | 3300046681 | Bacteria | 1376 |
| 151 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 152 | Ga0495669_0003848 | 3300046684 | Bacteria | 6171 |
| 153 | Ga0495613_0001632 | 3300046689 | Bacteria | 17071 |
| 154 | Ga0495624_0019486 | 3300046690 | Bacteria | 4525 |
| 155 | Ga0495670_0080120 | 3300046691 | Bacteria | 1663 |
| 156 | Ga0495649_0007918 | 3300046694 | Bacteria | 6430 |
| 157 | Ga0495600_0007613 | 3300046809 | Bacteria | 6634 |
| 158 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 159 | Ga0495674_0479463 | 3300047319 | Bacteria | 997 |
| 160 | Ga0495672_0098919 | 3300047320 | Bacteria | 1586 |
| 161 | Ga0495676_0034965 | 3300047321 | Bacteria | 4209 |
| 162 | Ga0495676_0044649 | 3300047321 | Bacteria | 3615 |
| 163 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 164 | Ga0495680_0000929 | 3300047322 | Bacteria | 32526 |
| 165 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 166 | Ga0495685_016294 | 3300047447 | Bacteria | 2538 |
| 167 | Ga0495673_0039178 | 3300047469 | Unclassified | 2151 |
| 168 | Ga0495686_0126272 | 3300047472 | Bacteria | 1520 |
| 169 | Ga0495602_0161166 | 3300048088 | Bacteria | 1751 |
| 170 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 171 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 172 | Ga0496102_0181760 | 3300048905 | Bacteria | 1982 |
| 173 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 174 | Ga0496104_0000230 | 3300048907 | Bacteria | 49225 |
| 175 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 176 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 177 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 178 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 179 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 180 | Ga0496107_0030281 | 3300048910 | Bacteria | 3857 |
| 181 | Ga0496107_0129837 | 3300048910 | Bacteria | 1860 |
| 182 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 183 | Ga0496108_0082672 | 3300048911 | Bacteria | 2723 |
| 184 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 185 | Ga0496109_0000378 | 3300048912 | Bacteria | 40469 |
| 186 | Ga0496109_0125990 | 3300048912 | Bacteria | 2388 |
| 187 | Ga0496110_0085616 | 3300048913 | Bacteria | 2813 |
| 188 | Ga0496111_0237731 | 3300048914 | Bacteria | 1353 |
| 189 | Ga0496111_0574519 | 3300048914 | Bacteria | 826 |
| 190 | Ga0496113_0622284 | 3300048916 | Bacteria | 864 |
| 191 | Ga0496114_0005156 | 3300048917 | Bacteria | 10194 |
| 192 | Ga0496114_0186386 | 3300048917 | Bacteria | 1814 |
| 193 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 194 | Ga0496115_0004801 | 3300048918 | Bacteria | 9806 |
| 195 | Ga0501038_0363120 | 3300049574 | Bacteria | 1126 |
| 196 | Ga0501042_0009362 | 3300049578 | Bacteria | 6526 |
| 197 | Ga0501068_0193042 | 3300049584 | Bacteria | 1290 |
| 198 | Ga0501071_0649902 | 3300049587 | Unclassified | 811 |
| 199 | Ga0501072_0157980 | 3300049588 | Bacteria | 1808 |
| 200 | Ga0501075_0006173 | 3300049591 | Bacteria | 8237 |
| 201 | Ga0501076_0016445 | 3300049592 | Bacteria | 5609 |
| 202 | nmdc:mga0qj67_145159_c1 | 3300050509 | Bacteria | 1924 |
| 203 | nmdc:mga06r32_380219_c1 | 3300050510 | Bacteria | 1395 |
| 204 | Ga0495601_0003205 | 3300053077 | Bacteria | 9362 |
| 205 | Ga0495601_0020026 | 3300053077 | Bacteria | 4083 |
| 206 | Ga0495612_0003768 | 3300053078 | Bacteria | 6305 |
| 207 | Ga0495595_0000378 | 3300053084 | Bacteria | 16864 |
| 208 | Ga0495619_0000127 | 3300053085 | Bacteria | 55995 |
| 209 | Ga0495619_0007002 | 3300053085 | Bacteria | 7137 |
| 210 | Ga0500566_0033940 | 3300053094 | Bacteria | 2971 |
| 211 | Ga0500614_000426 | 3300053123 | Bacteria | 10958 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0005859 | Ga0466967_0005859_4008_4739 | 194 |
| 2 | 3300048911 | Ga0496108_0082672 | Ga0496108_0082672_1127_1864 | 198 |
| 3 | 3300048912 | Ga0496109_0125990 | Ga0496109_0125990_1492_2229 | 198 |
| 4 | 3300013308 | Ga0157375_10000492 | Ga0157375_100004927 | 204 |
| 5 | 3300017792 | Ga0163161_10000064 | Ga0163161_10000064118 | 204 |
| 6 | 3300046511 | Ga0495608_0005080 | Ga0495608_0005080_3606_4313 | 204 |
| 7 | 3300053084 | Ga0495595_0000378 | Ga0495595_0000378_7932_8639 | 204 |
| 8 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_39554_40303 | 205 |
| 9 | 3300005341 | Ga0070691_10000970 | Ga0070691_1000097012 | 207 |
| 10 | 3300005618 | Ga0068864_100000090 | Ga0068864_10000009078 | 207 |
| 11 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016292 | 207 |
| 12 | 3300049592 | Ga0501076_0016445 | Ga0501076_0016445_1837_2529 | 207 |
| 13 | 3300005842 | Ga0068858_100000046 | Ga0068858_10000004671 | 208 |
| 14 | 3300013296 | Ga0157374_10001719 | Ga0157374_1000171919 | 208 |
| 15 | 3300026035 | Ga0207703_10000042 | Ga0207703_1000004236 | 208 |
| 16 | 3300036401 | Ga0373937_0196444 | Ga0373937_0196444_1127_1840 | 208 |
| 17 | 3300046559 | Ga0495667_0000038 | Ga0495667_0000038_41440_42153 | 208 |
| 18 | 3300047317 | Ga0495604_0000100 | Ga0495604_0000100_68258_68983 | 208 |
| 19 | 3300047322 | Ga0495680_0001001 | Ga0495680_0001001_16013_16726 | 208 |
| 20 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_467911_468642 | 208 |
| 21 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_150352_151083 | 208 |
| 22 | 3300048918 | Ga0496115_0004801 | Ga0496115_0004801_2048_2761 | 208 |
| 23 | 3300049574 | Ga0501038_0363120 | Ga0501038_0363120_21_722 | 208 |
| 24 | 3300049587 | Ga0501071_0649902 | Ga0501071_0649902_65_766 | 208 |
| 25 | 3300049588 | Ga0501072_0157980 | Ga0501072_0157980_830_1531 | 208 |
| 26 | 3300005535 | Ga0070684_100014422 | Ga0070684_1000144224 | 209 |
| 27 | 3300044694 | Ga0466963_0114199 | Ga0466963_0114199_843_1568 | 209 |
| 28 | 3300044901 | Ga0466960_0148645 | Ga0466960_0148645_56_781 | 209 |
| 29 | 3300045976 | Ga0466967_0027611 | Ga0466967_0027611_1060_1785 | 209 |
| 30 | 3300046539 | Ga0495621_0000692 | Ga0495621_0000692_3448_4131 | 209 |
| 31 | 3300048909 | Ga0496106_0000042 | Ga0496106_0000042_58906_59607 | 209 |
| 32 | 3300048910 | Ga0496107_0030281 | Ga0496107_0030281_1374_2075 | 209 |
| 33 | 3300050509 | nmdc:mga0qj67_145159_c1 | nmdc:mga0qj67_145159_c1_110_802 | 209 |
| 34 | 3300005367 | Ga0070667_100001110 | Ga0070667_10000111020 | 210 |
| 35 | 3300005544 | Ga0070686_100407651 | Ga0070686_1004076511 | 210 |
| 36 | 3300005548 | Ga0070665_100042444 | Ga0070665_1000424445 | 210 |
| 37 | 3300005617 | Ga0068859_101044738 | Ga0068859_1010447381 | 210 |
| 38 | 3300005841 | Ga0068863_100307565 | Ga0068863_1003075652 | 210 |
| 39 | 3300005843 | Ga0068860_100272052 | Ga0068860_1002720522 | 210 |
| 40 | 3300005844 | Ga0068862_100017783 | Ga0068862_1000177837 | 210 |
| 41 | 3300006931 | Ga0097620_101044841 | Ga0097620_1010448411 | 210 |
| 42 | 3300009101 | Ga0105247_10180200 | Ga0105247_101802002 | 210 |
| 43 | 3300009553 | Ga0105249_10017915 | Ga0105249_100179155 | 210 |
| 44 | 3300014968 | Ga0157379_10141140 | Ga0157379_101411405 | 210 |
| 45 | 3300025961 | Ga0207712_10047958 | Ga0207712_100479582 | 210 |
| 46 | 3300025972 | Ga0207668_10050729 | Ga0207668_100507293 | 210 |
| 47 | 3300025986 | Ga0207658_10001811 | Ga0207658_100018118 | 210 |
| 48 | 3300026088 | Ga0207641_10190668 | Ga0207641_101906682 | 210 |
| 49 | 3300028379 | Ga0268266_10024467 | Ga0268266_100244676 | 210 |
| 50 | 3300028380 | Ga0268265_10001768 | Ga0268265_100017685 | 210 |
| 51 | 3300046463 | Ga0495653_0053993 | Ga0495653_0053993_1355_2062 | 210 |
| 52 | 3300047320 | Ga0495672_0098919 | Ga0495672_0098919_509_1195 | 210 |
| 53 | 3300048914 | Ga0496111_0237731 | Ga0496111_0237731_379_1065 | 210 |
| 54 | 3300053085 | Ga0495619_0000127 | Ga0495619_0000127_1764_2450 | 210 |
| 55 | 3300005563 | Ga0068855_100053536 | Ga0068855_1000535362 | 211 |
| 56 | 3300005616 | Ga0068852_100063963 | Ga0068852_1000639632 | 211 |
| 57 | 3300006847 | Ga0075431_100012857 | Ga0075431_1000128578 | 211 |
| 58 | 3300009553 | Ga0105249_10000218 | Ga0105249_1000021840 | 211 |
| 59 | 3300025949 | Ga0207667_10122450 | Ga0207667_101224504 | 211 |
| 60 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027233 | 211 |
| 61 | 3300026142 | Ga0207698_10044308 | Ga0207698_100443085 | 211 |
| 62 | 3300046511 | Ga0495608_0022084 | Ga0495608_0022084_3194_3898 | 211 |
| 63 | 3300048905 | Ga0496102_0181760 | Ga0496102_0181760_649_1359 | 211 |
| 64 | 3300048913 | Ga0496110_0085616 | Ga0496110_0085616_1075_1785 | 211 |
| 65 | 3300048914 | Ga0496111_0574519 | Ga0496111_0574519_10_720 | 211 |
| 66 | 3300049578 | Ga0501042_0009362 | Ga0501042_0009362_3782_4483 | 211 |
| 67 | 3300050510 | nmdc:mga06r32_380219_c1 | nmdc:mga06r32_380219_c1_536_1246 | 211 |
| 68 | 3300014968 | Ga0157379_10088527 | Ga0157379_100885272 | 212 |
| 69 | 3300026067 | Ga0207678_10118785 | Ga0207678_101187855 | 212 |
| 70 | 3300046691 | Ga0495670_0080120 | Ga0495670_0080120_795_1517 | 212 |
| 71 | 3300047469 | Ga0495673_0039178 | Ga0495673_0039178_560_1267 | 212 |
| 72 | 3300002074 | JGI24748J21848_1001098 | JGI24748J21848_10010984 | 213 |
| 73 | 3300002239 | JGI24034J26672_10000115 | JGI24034J26672_100001155 | 213 |
| 74 | 3300005333 | Ga0070677_10000521 | Ga0070677_100005217 | 213 |
| 75 | 3300005335 | Ga0070666_10030539 | Ga0070666_100305394 | 213 |
| 76 | 3300005347 | Ga0070668_100120801 | Ga0070668_1001208013 | 213 |
| 77 | 3300005356 | Ga0070674_100000141 | Ga0070674_10000014133 | 213 |
| 78 | 3300005367 | Ga0070667_100762940 | Ga0070667_1007629401 | 213 |
| 79 | 3300005456 | Ga0070678_100007037 | Ga0070678_1000070372 | 213 |
| 80 | 3300005548 | Ga0070665_100002868 | Ga0070665_1000028688 | 213 |
| 81 | 3300005548 | Ga0070665_100038076 | Ga0070665_1000380766 | 213 |
| 82 | 3300005578 | Ga0068854_100097017 | Ga0068854_1000970175 | 213 |
| 83 | 3300005718 | Ga0068866_10000004 | Ga0068866_100000046 | 213 |
| 84 | 3300005834 | Ga0068851_10003112 | Ga0068851_100031127 | 213 |
| 85 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000842 | 213 |
| 86 | 3300009098 | Ga0105245_10000040 | Ga0105245_1000004036 | 213 |
| 87 | 3300009148 | Ga0105243_10007042 | Ga0105243_100070427 | 213 |
| 88 | 3300009176 | Ga0105242_10037459 | Ga0105242_100374595 | 213 |
| 89 | 3300013308 | Ga0157375_10009414 | Ga0157375_100094148 | 213 |
| 90 | 3300013308 | Ga0157375_10178721 | Ga0157375_101787211 | 213 |
| 91 | 3300014326 | Ga0157380_10788027 | Ga0157380_107880272 | 213 |
| 92 | 3300025893 | Ga0207682_10000769 | Ga0207682_1000076910 | 213 |
| 93 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005201 | 213 |
| 94 | 3300025903 | Ga0207680_10007123 | Ga0207680_100071233 | 213 |
| 95 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001242 | 213 |
| 96 | 3300025915 | Ga0207693_10010825 | Ga0207693_100108258 | 213 |
| 97 | 3300025918 | Ga0207662_10140064 | Ga0207662_101400642 | 213 |
| 98 | 3300025927 | Ga0207687_10000046 | Ga0207687_100000467 | 213 |
| 99 | 3300025935 | Ga0207709_10003313 | Ga0207709_100033137 | 213 |
| 100 | 3300025937 | Ga0207669_10000021 | Ga0207669_1000002126 | 213 |
| 101 | 3300025972 | Ga0207668_10058090 | Ga0207668_100580904 | 213 |
| 102 | 3300025981 | Ga0207640_10047856 | Ga0207640_100478562 | 213 |
| 103 | 3300025986 | Ga0207658_10056859 | Ga0207658_100568593 | 213 |
| 104 | 3300028379 | Ga0268266_10000526 | Ga0268266_1000052635 | 213 |
| 105 | 3300028379 | Ga0268266_10015588 | Ga0268266_100155886 | 213 |
| 106 | 3300028381 | Ga0268264_10001191 | Ga0268264_100011918 | 213 |
| 107 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_174281_174979 | 213 |
| 108 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_92496_93194 | 213 |
| 109 | 3300046684 | Ga0495669_0003848 | Ga0495669_0003848_4329_5042 | 213 |
| 110 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_76276_76989 | 213 |
| 111 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_39150_39863 | 213 |
| 112 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_126918_127616 | 213 |
| 113 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_126918_127616 | 213 |
| 114 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_68892_69605 | 213 |
| 115 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_76276_76989 | 213 |
| 116 | 3300048910 | Ga0496107_0129837 | Ga0496107_0129837_621_1319 | 213 |
| 117 | 3300049584 | Ga0501068_0193042 | Ga0501068_0193042_252_950 | 213 |
| 118 | 3300053077 | Ga0495601_0020026 | Ga0495601_0020026_1219_1920 | 213 |
| 119 | 3300005336 | Ga0070680_100014062 | Ga0070680_1000140622 | 214 |
| 120 | 3300005438 | Ga0070701_10393852 | Ga0070701_103938521 | 214 |
| 121 | 3300005441 | Ga0070700_100035172 | Ga0070700_1000351723 | 214 |
| 122 | 3300005458 | Ga0070681_10037706 | Ga0070681_100377065 | 214 |
| 123 | 3300005530 | Ga0070679_100000424 | Ga0070679_10000042413 | 214 |
| 124 | 3300013308 | Ga0157375_10462630 | Ga0157375_104626302 | 214 |
| 125 | 3300025912 | Ga0207707_10059817 | Ga0207707_100598172 | 214 |
| 126 | 3300025917 | Ga0207660_10004388 | Ga0207660_100043889 | 214 |
| 127 | 3300025921 | Ga0207652_10000232 | Ga0207652_1000023211 | 214 |
| 128 | 3300026075 | Ga0207708_10052500 | Ga0207708_100525004 | 214 |
| 129 | 3300046543 | Ga0495645_0177790 | Ga0495645_0177790_179_919 | 214 |
| 130 | 3300047319 | Ga0495674_0479463 | Ga0495674_0479463_253_963 | 214 |
| 131 | 3300047472 | Ga0495686_0126272 | Ga0495686_0126272_711_1421 | 214 |
| 132 | 3300005329 | Ga0070683_100011312 | Ga0070683_1000113127 | 215 |
| 133 | 3300005338 | Ga0068868_100022371 | Ga0068868_1000223712 | 215 |
| 134 | 3300005439 | Ga0070711_100047966 | Ga0070711_1000479664 | 215 |
| 135 | 3300005535 | Ga0070684_100122802 | Ga0070684_1001228023 | 215 |
| 136 | 3300005841 | Ga0068863_100000261 | Ga0068863_10000026118 | 215 |
| 137 | 3300009176 | Ga0105242_10304021 | Ga0105242_103040212 | 215 |
| 138 | 3300009551 | Ga0105238_10000033 | Ga0105238_10000033129 | 215 |
| 139 | 3300025916 | Ga0207663_10050547 | Ga0207663_100505473 | 215 |
| 140 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012130 | 215 |
| 141 | 3300025939 | Ga0207665_10289148 | Ga0207665_102891482 | 215 |
| 142 | 3300025944 | Ga0207661_10007065 | Ga0207661_100070656 | 215 |
| 143 | 3300026023 | Ga0207677_10009001 | Ga0207677_100090017 | 215 |
| 144 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062136 | 215 |
| 145 | 3300041491 | Ga0451833_0010390 | Ga0451833_0010390_98_808 | 215 |
| 146 | 3300046454 | Ga0495592_0000024 | Ga0495592_0000024_128826_129533 | 215 |
| 147 | 3300046455 | Ga0495603_0001201 | Ga0495603_0001201_5208_5915 | 215 |
| 148 | 3300046461 | Ga0495641_0103083 | Ga0495641_0103083_452_1159 | 215 |
| 149 | 3300046462 | Ga0495651_0069917 | Ga0495651_0069917_1699_2406 | 215 |
| 150 | 3300046476 | Ga0495662_0000069 | Ga0495662_0000069_34829_35536 | 215 |
| 151 | 3300046514 | Ga0495618_0000267 | Ga0495618_0000267_8322_9029 | 215 |
| 152 | 3300046516 | Ga0495628_0481997 | Ga0495628_0481997_66_773 | 215 |
| 153 | 3300046517 | Ga0495630_0009525 | Ga0495630_0009525_593_1300 | 215 |
| 154 | 3300046517 | Ga0495630_0063626 | Ga0495630_0063626_1612_2316 | 215 |
| 155 | 3300046533 | Ga0495640_0039697 | Ga0495640_0039697_1873_2580 | 215 |
| 156 | 3300046535 | Ga0495586_0000254 | Ga0495586_0000254_6558_7301 | 215 |
| 157 | 3300046536 | Ga0495587_0065886 | Ga0495587_0065886_56_763 | 215 |
| 158 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_121611_122321 | 215 |
| 159 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_24508_25215 | 215 |
| 160 | 3300046681 | Ga0495647_0073084 | Ga0495647_0073084_648_1355 | 215 |
| 161 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_145084_145794 | 215 |
| 162 | 3300046689 | Ga0495613_0001632 | Ga0495613_0001632_15689_16396 | 215 |
| 163 | 3300046690 | Ga0495624_0019486 | Ga0495624_0019486_2276_2983 | 215 |
| 164 | 3300046809 | Ga0495600_0007613 | Ga0495600_0007613_1542_2249 | 215 |
| 165 | 3300047322 | Ga0495680_0000007 | Ga0495680_0000007_132729_133436 | 215 |
| 166 | 3300047322 | Ga0495680_0000929 | Ga0495680_0000929_23566_24273 | 215 |
| 167 | 3300047447 | Ga0495685_016294 | Ga0495685_016294_246_953 | 215 |
| 168 | 3300048912 | Ga0496109_0000378 | Ga0496109_0000378_34583_35293 | 215 |
| 169 | 3300048917 | Ga0496114_0005156 | Ga0496114_0005156_6276_7019 | 215 |
| 170 | 3300053085 | Ga0495619_0007002 | Ga0495619_0007002_3782_4489 | 215 |
| 171 | 3300005366 | Ga0070659_100055679 | Ga0070659_1000556791 | 216 |
| 172 | 3300005548 | Ga0070665_100000022 | Ga0070665_10000002218 | 216 |
| 173 | 3300005718 | Ga0068866_10016679 | Ga0068866_100166796 | 216 |
| 174 | 3300005842 | Ga0068858_100001180 | Ga0068858_10000118018 | 216 |
| 175 | 3300025916 | Ga0207663_10106046 | Ga0207663_101060462 | 216 |
| 176 | 3300025932 | Ga0207690_10403354 | Ga0207690_104033542 | 216 |
| 177 | 3300026035 | Ga0207703_10000020 | Ga0207703_1000002072 | 216 |
| 178 | 3300026041 | Ga0207639_10032914 | Ga0207639_100329145 | 216 |
| 179 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029431 | 216 |
| 180 | 3300031456 | Ga0307513_10290941 | Ga0307513_102909412 | 216 |
| 181 | 3300041459 | Ga0451800_0385771 | Ga0451800_0385771_656_1363 | 216 |
| 182 | 3300041512 | Ga0451853_1793063 | Ga0451853_1793063_1372_2079 | 216 |
| 183 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_80633_81340 | 216 |
| 184 | 3300046694 | Ga0495649_0007918 | Ga0495649_0007918_3824_4531 | 216 |
| 185 | 3300047321 | Ga0495676_0044649 | Ga0495676_0044649_2319_3026 | 216 |
| 186 | 3300048088 | Ga0495602_0161166 | Ga0495602_0161166_652_1362 | 216 |
| 187 | 3300048917 | Ga0496114_0186386 | Ga0496114_0186386_771_1490 | 216 |
| 188 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_31996_32715 | 216 |
| 189 | 3300049591 | Ga0501075_0006173 | Ga0501075_0006173_4928_5641 | 216 |
| 190 | 3300053094 | Ga0500566_0033940 | Ga0500566_0033940_1336_2052 | 216 |
| 191 | 3300053123 | Ga0500614_000426 | Ga0500614_000426_4917_5624 | 216 |
| 192 | 3300001979 | JGI24740J21852_10022756 | JGI24740J21852_100227562 | 217 |
| 193 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023162 | 217 |
| 194 | 3300005841 | Ga0068863_100190446 | Ga0068863_1001904462 | 217 |
| 195 | 3300009176 | Ga0105242_10000428 | Ga0105242_1000042836 | 217 |
| 196 | 3300013297 | Ga0157378_10118657 | Ga0157378_101186572 | 217 |
| 197 | 3300025934 | Ga0207686_10000395 | Ga0207686_1000039523 | 217 |
| 198 | 3300025960 | Ga0207651_10003288 | Ga0207651_100032889 | 217 |
| 199 | 3300026088 | Ga0207641_10011027 | Ga0207641_100110275 | 217 |
| 200 | 3300026121 | Ga0207683_10634660 | Ga0207683_106346601 | 217 |
| 201 | 3300044694 | Ga0466963_0000233 | Ga0466963_0000233_8430_9140 | 217 |
| 202 | 3300046459 | Ga0495629_0029414 | Ga0495629_0029414_1358_2068 | 217 |
| 203 | 3300046462 | Ga0495651_0115113 | Ga0495651_0115113_1227_1940 | 217 |
| 204 | 3300046523 | Ga0495644_0002165 | Ga0495644_0002165_6668_7387 | 217 |
| 205 | 3300046529 | Ga0495652_0116183 | Ga0495652_0116183_1079_1792 | 217 |
| 206 | 3300047321 | Ga0495676_0034965 | Ga0495676_0034965_1084_1794 | 217 |
| 207 | 3300048907 | Ga0496104_0000230 | Ga0496104_0000230_2326_3039 | 217 |
| 208 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_73245_73958 | 217 |
| 209 | 3300048916 | Ga0496113_0622284 | Ga0496113_0622284_45_794 | 217 |
| 210 | 3300053077 | Ga0495601_0003205 | Ga0495601_0003205_4152_4865 | 217 |
| 211 | 3300053078 | Ga0495612_0003768 | Ga0495612_0003768_4373_5086 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pw9-assembly1.cif.gz_B | crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti | 0.7521 | 120 | 207 |
| 4pwa-assembly2.cif.gz_D | crystal structure of the c-type cytochrome soru from sinorhizobium meliloti | 0.7215 | 16 | 115 |
| 4pw9-assembly1.cif.gz_B | crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti | 0.7022 | 120 | 207 |
| 4pwa-assembly2.cif.gz_D | crystal structure of the c-type cytochrome soru from sinorhizobium meliloti | 0.6864 | 16 | 115 |
| 4xxl-assembly1.cif.gz_A | crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 | 0.6767 | 115 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8027 | 16 | 107 | 1.10.760.10 |
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7426 | 16 | 107 | 1.10.760.10 |
| 4xxlA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6767 | 115 | 205 | 1.10.760.10 |
| 4xxlA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6648 | 115 | 205 | 1.10.760.10 |
| 1h9yA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6523 | 13 | 109 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537TV08-F1-model_v4 | C-type cytochrome | 0.9916 | 120 | 208 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A7W0TSV4-F1-model_v4 | C-type cytochrome | 0.9892 | 120 | 201 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A3M1YJ04-F1-model_v4 | Cytochrome c domain-containing protein | 0.9528 | 158 | 203 |
GO:0009055
GO:0020037 |
| AF-A0A7V9R9Y1-F1-model_v4 | Cytochrome c | 0.9507 | 120 | 204 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A6J6NDD0-F1-model_v4 | Unannotated protein | 0.9436 | 13 | 109 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar