F321750
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 142 | 201 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300031250|Ga0265331_10082051|Ga0265331_100820512 |
| Length | 88 |
| Sequence | MNPVINFVEYENRVISATYRNLMVKAKVVLVDKTSGAPLADPVVTISSPVPSGSLMRLPDSVKPGTYYLKALNGHGEFAAQSVDFQVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 2 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 3 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 4 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 5 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 6 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 7 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 8 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 96 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 99 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 100 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 105 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 111 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 133 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 134 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 135 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 136 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 139 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 140 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 141 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 142 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.79 |
| Metatranscriptomes | 0.47 |
| Isolates | 4.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.84 |
| Nodule | 3.79 |
| Rhizoplane | 1.42 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055529_1030334 | 3300003763 | Bacteria | 664 |
| 2 | Ga0070658_10042866 | 3300005327 | Bacteria | 3655 |
| 3 | Ga0070683_100098412 | 3300005329 | Bacteria | 2753 |
| 4 | Ga0070680_100052913 | 3300005336 | Bacteria | 3313 |
| 5 | Ga0070680_100143274 | 3300005336 | Bacteria | 2004 |
| 6 | Ga0070660_100108801 | 3300005339 | Bacteria | 2203 |
| 7 | Ga0070691_10093372 | 3300005341 | Bacteria | 1486 |
| 8 | Ga0070661_100651665 | 3300005344 | Bacteria | 855 |
| 9 | Ga0070714_100074511 | 3300005435 | Bacteria | 2943 |
| 10 | Ga0070713_100001473 | 3300005436 | Bacteria | 15036 |
| 11 | Ga0070711_100110550 | 3300005439 | Bacteria | 2017 |
| 12 | Ga0070711_101285969 | 3300005439 | Bacteria | 634 |
| 13 | Ga0070708_100250776 | 3300005445 | Bacteria | 1663 |
| 14 | Ga0070681_10048291 | 3300005458 | Bacteria | 4254 |
| 15 | Ga0070681_10340579 | 3300005458 | Bacteria | 1409 |
| 16 | Ga0070681_10514859 | 3300005458 | Bacteria | 1110 |
| 17 | Ga0070681_10837494 | 3300005458 | Bacteria | 837 |
| 18 | Ga0070706_100080439 | 3300005467 | Bacteria | 3018 |
| 19 | Ga0070707_100223161 | 3300005468 | Bacteria | 1835 |
| 20 | Ga0070699_100658773 | 3300005518 | Bacteria | 956 |
| 21 | Ga0070699_100889202 | 3300005518 | Bacteria | 816 |
| 22 | Ga0070679_100522867 | 3300005530 | Bacteria | 1130 |
| 23 | Ga0070679_100902556 | 3300005530 | Bacteria | 827 |
| 24 | Ga0070684_100003307 | 3300005535 | Bacteria | 12079 |
| 25 | Ga0070684_101995422 | 3300005535 | Unclassified | 548 |
| 26 | Ga0070697_100061759 | 3300005536 | Bacteria | 3056 |
| 27 | Ga0068853_100005618 | 3300005539 | Bacteria | 9850 |
| 28 | Ga0070693_100556103 | 3300005547 | Bacteria | 822 |
| 29 | Ga0068855_100039686 | 3300005563 | Bacteria | 5588 |
| 30 | Ga0068855_100189019 | 3300005563 | Bacteria | 2324 |
| 31 | Ga0068857_100188332 | 3300005577 | Bacteria | 1879 |
| 32 | Ga0068857_100370191 | 3300005577 | Bacteria | 1329 |
| 33 | Ga0068854_100137867 | 3300005578 | Bacteria | 1869 |
| 34 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 35 | Ga0068856_100438885 | 3300005614 | Bacteria | 1326 |
| 36 | Ga0068852_100163934 | 3300005616 | Bacteria | 2078 |
| 37 | Ga0068852_100517676 | 3300005616 | Bacteria | 1190 |
| 38 | Ga0068852_101192645 | 3300005616 | Bacteria | 782 |
| 39 | Ga0068858_100167410 | 3300005842 | Bacteria | 2071 |
| 40 | Ga0070717_10005694 | 3300006028 | Bacteria | 9110 |
| 41 | Ga0070712_100031931 | 3300006175 | Bacteria | 3552 |
| 42 | Ga0075369_10520384 | 3300006186 | Bacteria | 566 |
| 43 | Ga0068871_101117156 | 3300006358 | Bacteria | 737 |
| 44 | Ga0099794_10014097 | 3300007265 | Bacteria | 3495 |
| 45 | Ga0099794_10028856 | 3300007265 | Bacteria | 2582 |
| 46 | Ga0099794_10344697 | 3300007265 | Bacteria | 774 |
| 47 | Ga0099794_10395168 | 3300007265 | Bacteria | 722 |
| 48 | Ga0105240_10013389 | 3300009093 | Bacteria | 11264 |
| 49 | Ga0105240_10033040 | 3300009093 | Bacteria | 6689 |
| 50 | Ga0105240_10048140 | 3300009093 | Bacteria | 5390 |
| 51 | Ga0105247_10110466 | 3300009101 | Bacteria | 1769 |
| 52 | Ga0105242_10972282 | 3300009176 | Bacteria | 855 |
| 53 | Ga0105248_11918598 | 3300009177 | Bacteria | 672 |
| 54 | Ga0105237_10002947 | 3300009545 | Bacteria | 20608 |
| 55 | Ga0105237_10220303 | 3300009545 | Bacteria | 1898 |
| 56 | Ga0105238_10048381 | 3300009551 | Bacteria | 4286 |
| 57 | Ga0105238_10654243 | 3300009551 | Bacteria | 1061 |
| 58 | Ga0105238_11502180 | 3300009551 | Bacteria | 702 |
| 59 | Ga0105239_10010500 | 3300010375 | Bacteria | 10352 |
| 60 | Ga0105239_12755029 | 3300010375 | Unclassified | 574 |
| 61 | Ga0157370_10063754 | 3300013104 | Bacteria | 3490 |
| 62 | Ga0157370_10067456 | 3300013104 | Bacteria | 3382 |
| 63 | Ga0157370_10638559 | 3300013104 | Bacteria | 973 |
| 64 | Ga0157369_10014337 | 3300013105 | Bacteria | 8950 |
| 65 | Ga0157369_10090669 | 3300013105 | Bacteria | 3263 |
| 66 | Ga0157369_10111574 | 3300013105 | Bacteria | 2906 |
| 67 | Ga0157369_10962655 | 3300013105 | Bacteria | 874 |
| 68 | Ga0157374_11607491 | 3300013296 | Bacteria | 674 |
| 69 | Ga0157372_10146671 | 3300013307 | Bacteria | 2721 |
| 70 | Ga0157372_11428901 | 3300013307 | Bacteria | 797 |
| 71 | Ga0157372_13087082 | 3300013307 | Unclassified | 532 |
| 72 | Ga0157375_11581449 | 3300013308 | Bacteria | 775 |
| 73 | Ga0157379_11051420 | 3300014968 | Bacteria | 778 |
| 74 | Ga0157379_12423302 | 3300014968 | Bacteria | 524 |
| 75 | Ga0213875_10099347 | 3300021388 | Bacteria | 1358 |
| 76 | Ga0207692_10086343 | 3300025898 | Bacteria | 1690 |
| 77 | Ga0207710_10067843 | 3300025900 | Bacteria | 1630 |
| 78 | Ga0207647_10023715 | 3300025904 | Bacteria | 4053 |
| 79 | Ga0207685_10591909 | 3300025905 | Bacteria | 594 |
| 80 | Ga0207699_10373913 | 3300025906 | Bacteria | 1010 |
| 81 | Ga0207705_10068604 | 3300025909 | Bacteria | 2567 |
| 82 | Ga0207684_10381388 | 3300025910 | Bacteria | 1212 |
| 83 | Ga0207707_10005144 | 3300025912 | Bacteria | 11466 |
| 84 | Ga0207707_10035471 | 3300025912 | Bacteria | 4362 |
| 85 | Ga0207707_10457851 | 3300025912 | Bacteria | 1091 |
| 86 | Ga0207695_10027811 | 3300025913 | Bacteria | 6290 |
| 87 | Ga0207671_10169315 | 3300025914 | Bacteria | 1696 |
| 88 | Ga0207671_10421156 | 3300025914 | Bacteria | 1062 |
| 89 | Ga0207671_10594850 | 3300025914 | Bacteria | 882 |
| 90 | Ga0207671_10942367 | 3300025914 | Unclassified | 682 |
| 91 | Ga0207663_10048555 | 3300025916 | Bacteria | 2628 |
| 92 | Ga0207660_10101856 | 3300025917 | Bacteria | 2146 |
| 93 | Ga0207657_10023755 | 3300025919 | Bacteria | 5700 |
| 94 | Ga0207649_10645699 | 3300025920 | Bacteria | 817 |
| 95 | Ga0207652_10153817 | 3300025921 | Bacteria | 2060 |
| 96 | Ga0207652_10434642 | 3300025921 | Bacteria | 1183 |
| 97 | Ga0207646_10161089 | 3300025922 | Bacteria | 2025 |
| 98 | Ga0207694_10075781 | 3300025924 | Bacteria | 2633 |
| 99 | Ga0207694_11176909 | 3300025924 | Bacteria | 649 |
| 100 | Ga0207700_10001134 | 3300025928 | Bacteria | 15287 |
| 101 | Ga0207700_10195657 | 3300025928 | Bacteria | 1701 |
| 102 | Ga0207664_10132840 | 3300025929 | Bacteria | 2097 |
| 103 | Ga0207664_11732977 | 3300025929 | Unclassified | 547 |
| 104 | Ga0207690_10495740 | 3300025932 | Bacteria | 987 |
| 105 | Ga0207686_11221762 | 3300025934 | Bacteria | 616 |
| 106 | Ga0207665_10457144 | 3300025939 | Bacteria | 981 |
| 107 | Ga0207661_10280004 | 3300025944 | Bacteria | 1490 |
| 108 | Ga0207661_11038278 | 3300025944 | Bacteria | 755 |
| 109 | Ga0207661_11885697 | 3300025944 | Bacteria | 543 |
| 110 | Ga0207667_10139421 | 3300025949 | Bacteria | 2497 |
| 111 | Ga0207667_10220677 | 3300025949 | Bacteria | 1942 |
| 112 | Ga0207640_10117068 | 3300025981 | Bacteria | 1901 |
| 113 | Ga0207703_10094344 | 3300026035 | Bacteria | 2522 |
| 114 | Ga0207639_10020071 | 3300026041 | Bacteria | 4779 |
| 115 | Ga0207639_10165905 | 3300026041 | Bacteria | 1866 |
| 116 | Ga0207702_10000243 | 3300026078 | Bacteria | 63718 |
| 117 | Ga0207702_10068029 | 3300026078 | Bacteria | 3059 |
| 118 | Ga0207674_10206184 | 3300026116 | Bacteria | 1915 |
| 119 | Ga0207674_10405546 | 3300026116 | Bacteria | 1317 |
| 120 | Ga0207698_10064941 | 3300026142 | Bacteria | 2863 |
| 121 | Ga0209588_1076004 | 3300027671 | Bacteria | 1085 |
| 122 | Ga0209588_1093943 | 3300027671 | Bacteria | 966 |
| 123 | Ga0209588_1125167 | 3300027671 | Bacteria | 821 |
| 124 | Ga0265334_10104146 | 3300028573 | Bacteria | 1024 |
| 125 | Ga0265338_10177616 | 3300028800 | Bacteria | 1626 |
| 126 | Ga0265330_10003111 | 3300031235 | Bacteria | 8785 |
| 127 | Ga0265332_10021550 | 3300031238 | Bacteria | 2846 |
| 128 | Ga0265332_10021898 | 3300031238 | Bacteria | 2822 |
| 129 | Ga0265328_10021887 | 3300031239 | Bacteria | 2436 |
| 130 | Ga0265325_10002046 | 3300031241 | Bacteria | 13854 |
| 131 | Ga0265340_10001534 | 3300031247 | Bacteria | 13258 |
| 132 | Ga0265340_10226814 | 3300031247 | Bacteria | 836 |
| 133 | Ga0265340_10324395 | 3300031247 | Unclassified | 681 |
| 134 | Ga0265339_10019779 | 3300031249 | Bacteria | 3944 |
| 135 | Ga0265339_10080750 | 3300031249 | Bacteria | 1719 |
| 136 | Ga0265339_10157910 | 3300031249 | Bacteria | 1143 |
| 137 | Ga0265339_10399339 | 3300031249 | Bacteria | 643 |
| 138 | Ga0265331_10082051 | 3300031250 | Bacteria | 1496 |
| 139 | Ga0265331_10128036 | 3300031250 | Bacteria | 1159 |
| 140 | Ga0265331_10216872 | 3300031250 | Bacteria | 860 |
| 141 | Ga0265316_10061240 | 3300031344 | Bacteria | 2924 |
| 142 | Ga0265316_10237766 | 3300031344 | Bacteria | 1340 |
| 143 | Ga0265316_10792342 | 3300031344 | Bacteria | 665 |
| 144 | Ga0307508_10046059 | 3300031616 | Bacteria | 3895 |
| 145 | Ga0307508_10115900 | 3300031616 | Bacteria | 2281 |
| 146 | Ga0265314_10171476 | 3300031711 | Bacteria | 1309 |
| 147 | Ga0265342_10038952 | 3300031712 | Bacteria | 2891 |
| 148 | Ga0265342_10115586 | 3300031712 | Bacteria | 1515 |
| 149 | Ga0316215_1010853 | 3300033544 | Bacteria | 901 |
| 150 | Ga0373923_0579103 | 3300035111 | Bacteria | 552 |
| 151 | Ga0373945_0417478 | 3300035116 | Bacteria | 590 |
| 152 | Ga0373953_0262988 | 3300035117 | Bacteria | 751 |
| 153 | Ga0373927_0002544 | 3300035695 | Bacteria | 13299 |
| 154 | Ga0373947_0084954 | 3300035725 | Bacteria | 1965 |
| 155 | Ga0372808_010807 | 3300036459 | Bacteria | 1288 |
| 156 | Ga0373925_0170945 | 3300037068 | Bacteria | 1716 |
| 157 | Ga0395900_0056855 | 3300037418 | Bacteria | 4027 |
| 158 | Ga0395898_0135249 | 3300037466 | Bacteria | 2360 |
| 159 | Ga0436364_0664790 | 3300037853 | Bacteria | 3384 |
| 160 | Ga0436365_0266119 | 3300039437 | Bacteria | 1780 |
| 161 | Ga0436365_0471875 | 3300039437 | Bacteria | 937 |
| 162 | Ga0436365_1640653 | 3300039437 | Bacteria | 2524 |
| 163 | Ga0466969_0038547 | 3300044656 | Bacteria | 2404 |
| 164 | Ga0466966_0156665 | 3300044684 | Bacteria | 1387 |
| 165 | Ga0466963_0133410 | 3300044694 | Bacteria | 1717 |
| 166 | Ga0466959_0228702 | 3300045049 | Bacteria | 1288 |
| 167 | Ga0466967_0023030 | 3300045976 | Bacteria | 5097 |
| 168 | Ga0466967_0181869 | 3300045976 | Bacteria | 1983 |
| 169 | Ga0495629_0149864 | 3300046459 | Bacteria | 1621 |
| 170 | Ga0495580_0963133 | 3300046472 | Bacteria | 546 |
| 171 | Ga0495665_0566800 | 3300046531 | Bacteria | 569 |
| 172 | Ga0495667_0146366 | 3300046559 | Bacteria | 1521 |
| 173 | Ga0495657_0862386 | 3300046675 | Bacteria | 516 |
| 174 | Ga0495599_0289467 | 3300046678 | Bacteria | 991 |
| 175 | Ga0495623_0031785 | 3300046679 | Bacteria | 3393 |
| 176 | Ga0495646_0049755 | 3300046680 | Bacteria | 2542 |
| 177 | Ga0495613_0088646 | 3300046689 | Bacteria | 2242 |
| 178 | Ga0495613_0090060 | 3300046689 | Bacteria | 2222 |
| 179 | Ga0495600_0150740 | 3300046809 | Bacteria | 1505 |
| 180 | Ga0495675_0023144 | 3300047444 | Bacteria | 3959 |
| 181 | Ga0495673_0024122 | 3300047469 | Bacteria | 2946 |
| 182 | Ga0495673_0367752 | 3300047469 | Bacteria | 505 |
| 183 | Ga0495684_0008461 | 3300047471 | Bacteria | 7965 |
| 184 | Ga0495593_0025017 | 3300047673 | Bacteria | 3304 |
| 185 | Ga0496111_0669146 | 3300048914 | Bacteria | 757 |
| 186 | Ga0496114_0335980 | 3300048917 | Bacteria | 1336 |
| 187 | Ga0496115_0535976 | 3300048918 | Bacteria | 937 |
| 188 | Ga0496118_0376836 | 3300048921 | Bacteria | 746 |
| 189 | Ga0496121_0002300 | 3300048924 | Bacteria | 29639 |
| 190 | Ga0496126_0019583 | 3300048929 | Bacteria | 6662 |
| 191 | Ga0496126_0241952 | 3300048929 | Bacteria | 1507 |
| 192 | Ga0496126_0312164 | 3300048929 | Bacteria | 1294 |
| 193 | Ga0496126_1348347 | 3300048929 | Bacteria | 517 |
| 194 | nmdc:mga0sz30_426088_c1 | 3300050516 | Bacteria | 595 |
| 195 | Ga0495595_0093249 | 3300053084 | Bacteria | 1447 |
| 196 | Ga0495595_0193759 | 3300053084 | Bacteria | 1010 |
| 197 | Ga0495619_0005969 | 3300053085 | Bacteria | 7713 |
| 198 | Ga0495619_0522598 | 3300053085 | Bacteria | 815 |
| 199 | Ga0500556_0091529 | 3300053104 | Bacteria | 1162 |
| 200 | Ga0500595_001094 | 3300053119 | Bacteria | 15053 |
| 201 | Ga0500616_0155293 | 3300053153 | Bacteria | 1055 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2513237095 | 2513647338 | 85 |
| 2 | iso_pu_bacteria | 2524023205 | 2524436430 | 85 |
| 3 | iso_pu_bacteria | 2816332527 | 2818236376 | 85 |
| 4 | iso_pu_bacteria | 2876761206 | 2876764201 | 85 |
| 5 | iso_pu_bacteria | 2888378607 | 2888385273 | 85 |
| 6 | iso_pu_bacteria | 2935959822 | 2935961252 | 85 |
| 7 | iso_pu_bacteria | 2941531003 | 2941531042 | 85 |
| 8 | iso_pu_bacteria | 3005594810 | 3005600123 | 85 |
| 9 | iso_pu_bacteria | 8006926726 | 8006928249 | 85 |
| 10 | iso_pu_bacteria | 8019648815 | 8019649159 | 85 |
| 11 | 3300035117 | Ga0373953_0262988 | Ga0373953_0262988_176_517 | 87 |
| 12 | 3300031250 | Ga0265331_10082051 | Ga0265331_100820512 | 88 |
| 13 | 3300005327 | Ga0070658_10042866 | Ga0070658_100428662 | 89 |
| 14 | 3300005329 | Ga0070683_100098412 | Ga0070683_1000984123 | 89 |
| 15 | 3300005336 | Ga0070680_100052913 | Ga0070680_1000529132 | 89 |
| 16 | 3300005336 | Ga0070680_100143274 | Ga0070680_1001432742 | 89 |
| 17 | 3300005339 | Ga0070660_100108801 | Ga0070660_1001088013 | 89 |
| 18 | 3300005341 | Ga0070691_10093372 | Ga0070691_100933722 | 89 |
| 19 | 3300005344 | Ga0070661_100651665 | Ga0070661_1006516652 | 89 |
| 20 | 3300005435 | Ga0070714_100074511 | Ga0070714_1000745112 | 89 |
| 21 | 3300005436 | Ga0070713_100001473 | Ga0070713_10000147312 | 89 |
| 22 | 3300005439 | Ga0070711_100110550 | Ga0070711_1001105501 | 89 |
| 23 | 3300005439 | Ga0070711_101285969 | Ga0070711_1012859692 | 89 |
| 24 | 3300005445 | Ga0070708_100250776 | Ga0070708_1002507762 | 89 |
| 25 | 3300005458 | Ga0070681_10048291 | Ga0070681_100482912 | 89 |
| 26 | 3300005458 | Ga0070681_10340579 | Ga0070681_103405792 | 89 |
| 27 | 3300005458 | Ga0070681_10514859 | Ga0070681_105148592 | 89 |
| 28 | 3300005458 | Ga0070681_10837494 | Ga0070681_108374942 | 89 |
| 29 | 3300005467 | Ga0070706_100080439 | Ga0070706_1000804392 | 89 |
| 30 | 3300005468 | Ga0070707_100223161 | Ga0070707_1002231612 | 89 |
| 31 | 3300005518 | Ga0070699_100658773 | Ga0070699_1006587732 | 89 |
| 32 | 3300005518 | Ga0070699_100889202 | Ga0070699_1008892022 | 89 |
| 33 | 3300005530 | Ga0070679_100522867 | Ga0070679_1005228672 | 89 |
| 34 | 3300005530 | Ga0070679_100902556 | Ga0070679_1009025561 | 89 |
| 35 | 3300005535 | Ga0070684_100003307 | Ga0070684_1000033072 | 89 |
| 36 | 3300005535 | Ga0070684_101995422 | Ga0070684_1019954221 | 89 |
| 37 | 3300005536 | Ga0070697_100061759 | Ga0070697_1000617592 | 89 |
| 38 | 3300005539 | Ga0068853_100005618 | Ga0068853_1000056182 | 89 |
| 39 | 3300005547 | Ga0070693_100556103 | Ga0070693_1005561032 | 89 |
| 40 | 3300005563 | Ga0068855_100039686 | Ga0068855_1000396861 | 89 |
| 41 | 3300005563 | Ga0068855_100189019 | Ga0068855_1001890192 | 89 |
| 42 | 3300005577 | Ga0068857_100188332 | Ga0068857_1001883322 | 89 |
| 43 | 3300005577 | Ga0068857_100370191 | Ga0068857_1003701912 | 89 |
| 44 | 3300005578 | Ga0068854_100137867 | Ga0068854_1001378672 | 89 |
| 45 | 3300005614 | Ga0068856_100000061 | Ga0068856_1000000614 | 89 |
| 46 | 3300005614 | Ga0068856_100438885 | Ga0068856_1004388852 | 89 |
| 47 | 3300005616 | Ga0068852_100163934 | Ga0068852_1001639342 | 89 |
| 48 | 3300005616 | Ga0068852_100517676 | Ga0068852_1005176762 | 89 |
| 49 | 3300005616 | Ga0068852_101192645 | Ga0068852_1011926451 | 89 |
| 50 | 3300005842 | Ga0068858_100167410 | Ga0068858_1001674102 | 89 |
| 51 | 3300006028 | Ga0070717_10005694 | Ga0070717_1000569411 | 89 |
| 52 | 3300006175 | Ga0070712_100031931 | Ga0070712_1000319313 | 89 |
| 53 | 3300006186 | Ga0075369_10520384 | Ga0075369_105203842 | 89 |
| 54 | 3300006358 | Ga0068871_101117156 | Ga0068871_1011171562 | 89 |
| 55 | 3300007265 | Ga0099794_10014097 | Ga0099794_100140972 | 89 |
| 56 | 3300007265 | Ga0099794_10028856 | Ga0099794_100288563 | 89 |
| 57 | 3300007265 | Ga0099794_10344697 | Ga0099794_103446972 | 89 |
| 58 | 3300007265 | Ga0099794_10395168 | Ga0099794_103951682 | 89 |
| 59 | 3300009093 | Ga0105240_10013389 | Ga0105240_100133894 | 89 |
| 60 | 3300009093 | Ga0105240_10033040 | Ga0105240_100330403 | 89 |
| 61 | 3300009093 | Ga0105240_10048140 | Ga0105240_100481404 | 89 |
| 62 | 3300009101 | Ga0105247_10110466 | Ga0105247_101104662 | 89 |
| 63 | 3300009176 | Ga0105242_10972282 | Ga0105242_109722822 | 89 |
| 64 | 3300009177 | Ga0105248_11918598 | Ga0105248_119185982 | 89 |
| 65 | 3300009545 | Ga0105237_10002947 | Ga0105237_1000294711 | 89 |
| 66 | 3300009545 | Ga0105237_10220303 | Ga0105237_102203032 | 89 |
| 67 | 3300009551 | Ga0105238_10048381 | Ga0105238_100483814 | 89 |
| 68 | 3300009551 | Ga0105238_10654243 | Ga0105238_106542432 | 89 |
| 69 | 3300009551 | Ga0105238_11502180 | Ga0105238_115021802 | 89 |
| 70 | 3300010375 | Ga0105239_10010500 | Ga0105239_1001050011 | 89 |
| 71 | 3300010375 | Ga0105239_12755029 | Ga0105239_127550292 | 89 |
| 72 | 3300013104 | Ga0157370_10063754 | Ga0157370_100637542 | 89 |
| 73 | 3300013104 | Ga0157370_10067456 | Ga0157370_100674563 | 89 |
| 74 | 3300013104 | Ga0157370_10638559 | Ga0157370_106385591 | 89 |
| 75 | 3300013105 | Ga0157369_10014337 | Ga0157369_100143375 | 89 |
| 76 | 3300013105 | Ga0157369_10090669 | Ga0157369_100906694 | 89 |
| 77 | 3300013105 | Ga0157369_10111574 | Ga0157369_101115742 | 89 |
| 78 | 3300013105 | Ga0157369_10962655 | Ga0157369_109626551 | 89 |
| 79 | 3300013296 | Ga0157374_11607491 | Ga0157374_116074911 | 89 |
| 80 | 3300013307 | Ga0157372_10146671 | Ga0157372_101466713 | 89 |
| 81 | 3300013307 | Ga0157372_11428901 | Ga0157372_114289012 | 89 |
| 82 | 3300013307 | Ga0157372_13087082 | Ga0157372_130870822 | 89 |
| 83 | 3300013308 | Ga0157375_11581449 | Ga0157375_115814492 | 89 |
| 84 | 3300014968 | Ga0157379_11051420 | Ga0157379_110514202 | 89 |
| 85 | 3300014968 | Ga0157379_12423302 | Ga0157379_124233021 | 89 |
| 86 | 3300021388 | Ga0213875_10099347 | Ga0213875_100993472 | 89 |
| 87 | 3300025898 | Ga0207692_10086343 | Ga0207692_100863432 | 89 |
| 88 | 3300025900 | Ga0207710_10067843 | Ga0207710_100678432 | 89 |
| 89 | 3300025904 | Ga0207647_10023715 | Ga0207647_100237152 | 89 |
| 90 | 3300025905 | Ga0207685_10591909 | Ga0207685_105919092 | 89 |
| 91 | 3300025906 | Ga0207699_10373913 | Ga0207699_103739132 | 89 |
| 92 | 3300025909 | Ga0207705_10068604 | Ga0207705_100686042 | 89 |
| 93 | 3300025910 | Ga0207684_10381388 | Ga0207684_103813882 | 89 |
| 94 | 3300025912 | Ga0207707_10005144 | Ga0207707_100051443 | 89 |
| 95 | 3300025912 | Ga0207707_10035471 | Ga0207707_100354714 | 89 |
| 96 | 3300025912 | Ga0207707_10457851 | Ga0207707_104578512 | 89 |
| 97 | 3300025913 | Ga0207695_10027811 | Ga0207695_100278115 | 89 |
| 98 | 3300025914 | Ga0207671_10169315 | Ga0207671_101693152 | 89 |
| 99 | 3300025914 | Ga0207671_10421156 | Ga0207671_104211562 | 89 |
| 100 | 3300025914 | Ga0207671_10594850 | Ga0207671_105948502 | 89 |
| 101 | 3300025914 | Ga0207671_10942367 | Ga0207671_109423672 | 89 |
| 102 | 3300025916 | Ga0207663_10048555 | Ga0207663_100485552 | 89 |
| 103 | 3300025917 | Ga0207660_10101856 | Ga0207660_101018563 | 89 |
| 104 | 3300025919 | Ga0207657_10023755 | Ga0207657_100237554 | 89 |
| 105 | 3300025920 | Ga0207649_10645699 | Ga0207649_106456991 | 89 |
| 106 | 3300025921 | Ga0207652_10153817 | Ga0207652_101538172 | 89 |
| 107 | 3300025921 | Ga0207652_10434642 | Ga0207652_104346422 | 89 |
| 108 | 3300025922 | Ga0207646_10161089 | Ga0207646_101610892 | 89 |
| 109 | 3300025924 | Ga0207694_10075781 | Ga0207694_100757812 | 89 |
| 110 | 3300025924 | Ga0207694_11176909 | Ga0207694_111769092 | 89 |
| 111 | 3300025928 | Ga0207700_10001134 | Ga0207700_1000113412 | 89 |
| 112 | 3300025928 | Ga0207700_10195657 | Ga0207700_101956572 | 89 |
| 113 | 3300025929 | Ga0207664_10132840 | Ga0207664_101328402 | 89 |
| 114 | 3300025929 | Ga0207664_11732977 | Ga0207664_117329771 | 89 |
| 115 | 3300025932 | Ga0207690_10495740 | Ga0207690_104957401 | 89 |
| 116 | 3300025934 | Ga0207686_11221762 | Ga0207686_112217621 | 89 |
| 117 | 3300025939 | Ga0207665_10457144 | Ga0207665_104571441 | 89 |
| 118 | 3300025944 | Ga0207661_10280004 | Ga0207661_102800042 | 89 |
| 119 | 3300025944 | Ga0207661_11038278 | Ga0207661_110382782 | 89 |
| 120 | 3300025944 | Ga0207661_11885697 | Ga0207661_118856971 | 89 |
| 121 | 3300025949 | Ga0207667_10139421 | Ga0207667_101394214 | 89 |
| 122 | 3300025949 | Ga0207667_10220677 | Ga0207667_102206772 | 89 |
| 123 | 3300025981 | Ga0207640_10117068 | Ga0207640_101170682 | 89 |
| 124 | 3300026035 | Ga0207703_10094344 | Ga0207703_100943442 | 89 |
| 125 | 3300026041 | Ga0207639_10020071 | Ga0207639_100200712 | 89 |
| 126 | 3300026041 | Ga0207639_10165905 | Ga0207639_101659053 | 89 |
| 127 | 3300026078 | Ga0207702_10000243 | Ga0207702_1000024366 | 89 |
| 128 | 3300026078 | Ga0207702_10068029 | Ga0207702_100680292 | 89 |
| 129 | 3300026116 | Ga0207674_10206184 | Ga0207674_102061842 | 89 |
| 130 | 3300026116 | Ga0207674_10405546 | Ga0207674_104055461 | 89 |
| 131 | 3300026142 | Ga0207698_10064941 | Ga0207698_100649413 | 89 |
| 132 | 3300027671 | Ga0209588_1076004 | Ga0209588_10760042 | 89 |
| 133 | 3300027671 | Ga0209588_1093943 | Ga0209588_10939432 | 89 |
| 134 | 3300027671 | Ga0209588_1125167 | Ga0209588_11251672 | 89 |
| 135 | 3300028573 | Ga0265334_10104146 | Ga0265334_101041461 | 89 |
| 136 | 3300028800 | Ga0265338_10177616 | Ga0265338_101776162 | 89 |
| 137 | 3300031235 | Ga0265330_10003111 | Ga0265330_100031118 | 89 |
| 138 | 3300031238 | Ga0265332_10021550 | Ga0265332_100215503 | 89 |
| 139 | 3300031238 | Ga0265332_10021898 | Ga0265332_100218982 | 89 |
| 140 | 3300031239 | Ga0265328_10021887 | Ga0265328_100218873 | 89 |
| 141 | 3300031241 | Ga0265325_10002046 | Ga0265325_100020465 | 89 |
| 142 | 3300031247 | Ga0265340_10001534 | Ga0265340_100015348 | 89 |
| 143 | 3300031247 | Ga0265340_10226814 | Ga0265340_102268141 | 89 |
| 144 | 3300031247 | Ga0265340_10324395 | Ga0265340_103243952 | 89 |
| 145 | 3300031249 | Ga0265339_10019779 | Ga0265339_100197792 | 89 |
| 146 | 3300031249 | Ga0265339_10080750 | Ga0265339_100807502 | 89 |
| 147 | 3300031249 | Ga0265339_10157910 | Ga0265339_101579102 | 89 |
| 148 | 3300031249 | Ga0265339_10399339 | Ga0265339_103993391 | 89 |
| 149 | 3300031250 | Ga0265331_10128036 | Ga0265331_101280362 | 89 |
| 150 | 3300031250 | Ga0265331_10216872 | Ga0265331_102168721 | 89 |
| 151 | 3300031344 | Ga0265316_10061240 | Ga0265316_100612404 | 89 |
| 152 | 3300031344 | Ga0265316_10237766 | Ga0265316_102377661 | 89 |
| 153 | 3300031344 | Ga0265316_10792342 | Ga0265316_107923421 | 89 |
| 154 | 3300031616 | Ga0307508_10046059 | Ga0307508_100460592 | 89 |
| 155 | 3300031616 | Ga0307508_10115900 | Ga0307508_101159002 | 89 |
| 156 | 3300031711 | Ga0265314_10171476 | Ga0265314_101714762 | 89 |
| 157 | 3300031712 | Ga0265342_10038952 | Ga0265342_100389522 | 89 |
| 158 | 3300031712 | Ga0265342_10115586 | Ga0265342_101155862 | 89 |
| 159 | 3300033544 | Ga0316215_1010853 | Ga0316215_10108532 | 89 |
| 160 | 3300035111 | Ga0373923_0579103 | Ga0373923_0579103_20_325 | 89 |
| 161 | 3300035116 | Ga0373945_0417478 | Ga0373945_0417478_103_372 | 89 |
| 162 | 3300035695 | Ga0373927_0002544 | Ga0373927_0002544_8833_9102 | 89 |
| 163 | 3300035725 | Ga0373947_0084954 | Ga0373947_0084954_907_1176 | 89 |
| 164 | 3300036459 | Ga0372808_010807 | Ga0372808_010807_351_620 | 89 |
| 165 | 3300037068 | Ga0373925_0170945 | Ga0373925_0170945_907_1176 | 89 |
| 166 | 3300037418 | Ga0395900_0056855 | Ga0395900_0056855_424_693 | 89 |
| 167 | 3300037466 | Ga0395898_0135249 | Ga0395898_0135249_860_1129 | 89 |
| 168 | 3300037853 | Ga0436364_0664790 | Ga0436364_0664790_2090_2359 | 89 |
| 169 | 3300039437 | Ga0436365_0266119 | Ga0436365_0266119_1284_1553 | 89 |
| 170 | 3300039437 | Ga0436365_0471875 | Ga0436365_0471875_92_361 | 89 |
| 171 | 3300039437 | Ga0436365_1640653 | Ga0436365_1640653_700_969 | 89 |
| 172 | 3300044656 | Ga0466969_0038547 | Ga0466969_0038547_2024_2293 | 89 |
| 173 | 3300044684 | Ga0466966_0156665 | Ga0466966_0156665_1056_1325 | 89 |
| 174 | 3300044694 | Ga0466963_0133410 | Ga0466963_0133410_962_1231 | 89 |
| 175 | 3300045049 | Ga0466959_0228702 | Ga0466959_0228702_837_1106 | 89 |
| 176 | 3300045976 | Ga0466967_0023030 | Ga0466967_0023030_3420_3689 | 89 |
| 177 | 3300045976 | Ga0466967_0181869 | Ga0466967_0181869_126_395 | 89 |
| 178 | 3300046459 | Ga0495629_0149864 | Ga0495629_0149864_153_422 | 89 |
| 179 | 3300046472 | Ga0495580_0963133 | Ga0495580_0963133_140_409 | 89 |
| 180 | 3300046531 | Ga0495665_0566800 | Ga0495665_0566800_104_373 | 89 |
| 181 | 3300046559 | Ga0495667_0146366 | Ga0495667_0146366_528_797 | 89 |
| 182 | 3300046675 | Ga0495657_0862386 | Ga0495657_0862386_20_289 | 89 |
| 183 | 3300046678 | Ga0495599_0289467 | Ga0495599_0289467_672_941 | 89 |
| 184 | 3300046679 | Ga0495623_0031785 | Ga0495623_0031785_1172_1441 | 89 |
| 185 | 3300046680 | Ga0495646_0049755 | Ga0495646_0049755_1449_1718 | 89 |
| 186 | 3300046689 | Ga0495613_0088646 | Ga0495613_0088646_989_1258 | 89 |
| 187 | 3300046689 | Ga0495613_0090060 | Ga0495613_0090060_1296_1565 | 89 |
| 188 | 3300046809 | Ga0495600_0150740 | Ga0495600_0150740_537_806 | 89 |
| 189 | 3300047444 | Ga0495675_0023144 | Ga0495675_0023144_457_726 | 89 |
| 190 | 3300047469 | Ga0495673_0024122 | Ga0495673_0024122_1552_1821 | 89 |
| 191 | 3300047469 | Ga0495673_0367752 | Ga0495673_0367752_45_314 | 89 |
| 192 | 3300047471 | Ga0495684_0008461 | Ga0495684_0008461_5145_5414 | 89 |
| 193 | 3300047673 | Ga0495593_0025017 | Ga0495593_0025017_2004_2273 | 89 |
| 194 | 3300048914 | Ga0496111_0669146 | Ga0496111_0669146_217_486 | 89 |
| 195 | 3300048917 | Ga0496114_0335980 | Ga0496114_0335980_173_442 | 89 |
| 196 | 3300048918 | Ga0496115_0535976 | Ga0496115_0535976_107_376 | 89 |
| 197 | 3300048921 | Ga0496118_0376836 | Ga0496118_0376836_267_536 | 89 |
| 198 | 3300048924 | Ga0496121_0002300 | Ga0496121_0002300_4888_5157 | 89 |
| 199 | 3300048929 | Ga0496126_0019583 | Ga0496126_0019583_4700_4969 | 89 |
| 200 | 3300048929 | Ga0496126_0241952 | Ga0496126_0241952_423_692 | 89 |
| 201 | 3300048929 | Ga0496126_0312164 | Ga0496126_0312164_698_967 | 89 |
| 202 | 3300048929 | Ga0496126_1348347 | Ga0496126_1348347_58_327 | 89 |
| 203 | 3300050516 | nmdc:mga0sz30_426088_c1 | nmdc:mga0sz30_426088_c1_279_548 | 89 |
| 204 | 3300053084 | Ga0495595_0093249 | Ga0495595_0093249_966_1235 | 89 |
| 205 | 3300053084 | Ga0495595_0193759 | Ga0495595_0193759_346_615 | 89 |
| 206 | 3300053085 | Ga0495619_0005969 | Ga0495619_0005969_610_879 | 89 |
| 207 | 3300053085 | Ga0495619_0522598 | Ga0495619_0522598_297_566 | 89 |
| 208 | 3300053104 | Ga0500556_0091529 | Ga0500556_0091529_267_536 | 89 |
| 209 | 3300053119 | Ga0500595_001094 | Ga0500595_001094_8151_8420 | 89 |
| 210 | 3300053153 | Ga0500616_0155293 | Ga0500616_0155293_615_884 | 89 |
| 211 | 3300003763 | Ga0055529_1030334 | Ga0055529_10303341 | 96 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tv9-assembly1.cif.gz_A | human complement component c3b in complex with apl-1030 | 0.6578 | 2 | 89 |
| 7qiv-assembly1.cif.gz_A | structure of human c3b in complex with the ewe nanobody | 0.648 | 3 | 89 |
| 6ehg-assembly1.cif.gz_A | complement component c3b in complex with a nanobody | 0.6476 | 3 | 89 |
| 5hcc-assembly1.cif.gz_B | ternary complex of human complement c5 with ornithodoros moubata omci and dermacentor andersoni raci3. | 0.6441 | 3 | 88 |
| 2a74-assembly1.cif.gz_A | human complement component c3c | 0.6362 | 3 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86AC9_688_781_2.60.40.2840 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6712 | 6 | 83 | 2.60.40.2840 |
| af_P76578_387_483_2.60.40.1930 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.6663 | 2 | 89 | 2.60.40.1930 |
| af_A0A1D6EQP6_270_376_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6649 | 3 | 86 | 2.60.40.10 |
| 5jtwA02 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.6522 | 2 | 89 | 2.60.40.1930 |
| 5gaoB12 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6515 | 2 | 72 | 2.60.40.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M5MNI2-F1-model_v4 | Uncharacterized protein | 0.9883 | 1 | 88 |
|
| AF-A0A1M5MNI2-F1-model_v4 | Uncharacterized protein | 0.9666 | 1 | 88 |
|
| AF-A0A1I3CGP9-F1-model_v4 | DUF1929 domain-containing protein | 0.9613 | 1 | 88 |
|
| AF-A0A2U8PLB0-F1-model_v4 | Uncharacterized protein | 0.9593 | 1 | 88 |
|
| AF-A0A4Y9P6D3-F1-model_v4 | Uncharacterized protein | 0.9578 | 1 | 88 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar