F321750

General Info

Members Datasets Scaffolds Average Seq Length
211 142 201 89

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10082051|Ga0265331_100820512
Length 88
Sequence MNPVINFVEYENRVISATYRNLMVKAKVVLVDKTSGAPLADPVVTISSPVPSGSLMRLPDSVKPGTYYLKALNGHGEFAAQSVDFQVA

Samples

Sample ID Description Type Environment
1 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
2 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
3 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
4 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
5 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
6 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
7 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
8 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
142 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.79
Metatranscriptomes 0.47
Isolates 4.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 3.79
Rhizoplane 1.42
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1030334 3300003763 Bacteria 664
2 Ga0070658_10042866 3300005327 Bacteria 3655
3 Ga0070683_100098412 3300005329 Bacteria 2753
4 Ga0070680_100052913 3300005336 Bacteria 3313
5 Ga0070680_100143274 3300005336 Bacteria 2004
6 Ga0070660_100108801 3300005339 Bacteria 2203
7 Ga0070691_10093372 3300005341 Bacteria 1486
8 Ga0070661_100651665 3300005344 Bacteria 855
9 Ga0070714_100074511 3300005435 Bacteria 2943
10 Ga0070713_100001473 3300005436 Bacteria 15036
11 Ga0070711_100110550 3300005439 Bacteria 2017
12 Ga0070711_101285969 3300005439 Bacteria 634
13 Ga0070708_100250776 3300005445 Bacteria 1663
14 Ga0070681_10048291 3300005458 Bacteria 4254
15 Ga0070681_10340579 3300005458 Bacteria 1409
16 Ga0070681_10514859 3300005458 Bacteria 1110
17 Ga0070681_10837494 3300005458 Bacteria 837
18 Ga0070706_100080439 3300005467 Bacteria 3018
19 Ga0070707_100223161 3300005468 Bacteria 1835
20 Ga0070699_100658773 3300005518 Bacteria 956
21 Ga0070699_100889202 3300005518 Bacteria 816
22 Ga0070679_100522867 3300005530 Bacteria 1130
23 Ga0070679_100902556 3300005530 Bacteria 827
24 Ga0070684_100003307 3300005535 Bacteria 12079
25 Ga0070684_101995422 3300005535 Unclassified 548
26 Ga0070697_100061759 3300005536 Bacteria 3056
27 Ga0068853_100005618 3300005539 Bacteria 9850
28 Ga0070693_100556103 3300005547 Bacteria 822
29 Ga0068855_100039686 3300005563 Bacteria 5588
30 Ga0068855_100189019 3300005563 Bacteria 2324
31 Ga0068857_100188332 3300005577 Bacteria 1879
32 Ga0068857_100370191 3300005577 Bacteria 1329
33 Ga0068854_100137867 3300005578 Bacteria 1869
34 Ga0068856_100000061 3300005614 Bacteria 100823
35 Ga0068856_100438885 3300005614 Bacteria 1326
36 Ga0068852_100163934 3300005616 Bacteria 2078
37 Ga0068852_100517676 3300005616 Bacteria 1190
38 Ga0068852_101192645 3300005616 Bacteria 782
39 Ga0068858_100167410 3300005842 Bacteria 2071
40 Ga0070717_10005694 3300006028 Bacteria 9110
41 Ga0070712_100031931 3300006175 Bacteria 3552
42 Ga0075369_10520384 3300006186 Bacteria 566
43 Ga0068871_101117156 3300006358 Bacteria 737
44 Ga0099794_10014097 3300007265 Bacteria 3495
45 Ga0099794_10028856 3300007265 Bacteria 2582
46 Ga0099794_10344697 3300007265 Bacteria 774
47 Ga0099794_10395168 3300007265 Bacteria 722
48 Ga0105240_10013389 3300009093 Bacteria 11264
49 Ga0105240_10033040 3300009093 Bacteria 6689
50 Ga0105240_10048140 3300009093 Bacteria 5390
51 Ga0105247_10110466 3300009101 Bacteria 1769
52 Ga0105242_10972282 3300009176 Bacteria 855
53 Ga0105248_11918598 3300009177 Bacteria 672
54 Ga0105237_10002947 3300009545 Bacteria 20608
55 Ga0105237_10220303 3300009545 Bacteria 1898
56 Ga0105238_10048381 3300009551 Bacteria 4286
57 Ga0105238_10654243 3300009551 Bacteria 1061
58 Ga0105238_11502180 3300009551 Bacteria 702
59 Ga0105239_10010500 3300010375 Bacteria 10352
60 Ga0105239_12755029 3300010375 Unclassified 574
61 Ga0157370_10063754 3300013104 Bacteria 3490
62 Ga0157370_10067456 3300013104 Bacteria 3382
63 Ga0157370_10638559 3300013104 Bacteria 973
64 Ga0157369_10014337 3300013105 Bacteria 8950
65 Ga0157369_10090669 3300013105 Bacteria 3263
66 Ga0157369_10111574 3300013105 Bacteria 2906
67 Ga0157369_10962655 3300013105 Bacteria 874
68 Ga0157374_11607491 3300013296 Bacteria 674
69 Ga0157372_10146671 3300013307 Bacteria 2721
70 Ga0157372_11428901 3300013307 Bacteria 797
71 Ga0157372_13087082 3300013307 Unclassified 532
72 Ga0157375_11581449 3300013308 Bacteria 775
73 Ga0157379_11051420 3300014968 Bacteria 778
74 Ga0157379_12423302 3300014968 Bacteria 524
75 Ga0213875_10099347 3300021388 Bacteria 1358
76 Ga0207692_10086343 3300025898 Bacteria 1690
77 Ga0207710_10067843 3300025900 Bacteria 1630
78 Ga0207647_10023715 3300025904 Bacteria 4053
79 Ga0207685_10591909 3300025905 Bacteria 594
80 Ga0207699_10373913 3300025906 Bacteria 1010
81 Ga0207705_10068604 3300025909 Bacteria 2567
82 Ga0207684_10381388 3300025910 Bacteria 1212
83 Ga0207707_10005144 3300025912 Bacteria 11466
84 Ga0207707_10035471 3300025912 Bacteria 4362
85 Ga0207707_10457851 3300025912 Bacteria 1091
86 Ga0207695_10027811 3300025913 Bacteria 6290
87 Ga0207671_10169315 3300025914 Bacteria 1696
88 Ga0207671_10421156 3300025914 Bacteria 1062
89 Ga0207671_10594850 3300025914 Bacteria 882
90 Ga0207671_10942367 3300025914 Unclassified 682
91 Ga0207663_10048555 3300025916 Bacteria 2628
92 Ga0207660_10101856 3300025917 Bacteria 2146
93 Ga0207657_10023755 3300025919 Bacteria 5700
94 Ga0207649_10645699 3300025920 Bacteria 817
95 Ga0207652_10153817 3300025921 Bacteria 2060
96 Ga0207652_10434642 3300025921 Bacteria 1183
97 Ga0207646_10161089 3300025922 Bacteria 2025
98 Ga0207694_10075781 3300025924 Bacteria 2633
99 Ga0207694_11176909 3300025924 Bacteria 649
100 Ga0207700_10001134 3300025928 Bacteria 15287
101 Ga0207700_10195657 3300025928 Bacteria 1701
102 Ga0207664_10132840 3300025929 Bacteria 2097
103 Ga0207664_11732977 3300025929 Unclassified 547
104 Ga0207690_10495740 3300025932 Bacteria 987
105 Ga0207686_11221762 3300025934 Bacteria 616
106 Ga0207665_10457144 3300025939 Bacteria 981
107 Ga0207661_10280004 3300025944 Bacteria 1490
108 Ga0207661_11038278 3300025944 Bacteria 755
109 Ga0207661_11885697 3300025944 Bacteria 543
110 Ga0207667_10139421 3300025949 Bacteria 2497
111 Ga0207667_10220677 3300025949 Bacteria 1942
112 Ga0207640_10117068 3300025981 Bacteria 1901
113 Ga0207703_10094344 3300026035 Bacteria 2522
114 Ga0207639_10020071 3300026041 Bacteria 4779
115 Ga0207639_10165905 3300026041 Bacteria 1866
116 Ga0207702_10000243 3300026078 Bacteria 63718
117 Ga0207702_10068029 3300026078 Bacteria 3059
118 Ga0207674_10206184 3300026116 Bacteria 1915
119 Ga0207674_10405546 3300026116 Bacteria 1317
120 Ga0207698_10064941 3300026142 Bacteria 2863
121 Ga0209588_1076004 3300027671 Bacteria 1085
122 Ga0209588_1093943 3300027671 Bacteria 966
123 Ga0209588_1125167 3300027671 Bacteria 821
124 Ga0265334_10104146 3300028573 Bacteria 1024
125 Ga0265338_10177616 3300028800 Bacteria 1626
126 Ga0265330_10003111 3300031235 Bacteria 8785
127 Ga0265332_10021550 3300031238 Bacteria 2846
128 Ga0265332_10021898 3300031238 Bacteria 2822
129 Ga0265328_10021887 3300031239 Bacteria 2436
130 Ga0265325_10002046 3300031241 Bacteria 13854
131 Ga0265340_10001534 3300031247 Bacteria 13258
132 Ga0265340_10226814 3300031247 Bacteria 836
133 Ga0265340_10324395 3300031247 Unclassified 681
134 Ga0265339_10019779 3300031249 Bacteria 3944
135 Ga0265339_10080750 3300031249 Bacteria 1719
136 Ga0265339_10157910 3300031249 Bacteria 1143
137 Ga0265339_10399339 3300031249 Bacteria 643
138 Ga0265331_10082051 3300031250 Bacteria 1496
139 Ga0265331_10128036 3300031250 Bacteria 1159
140 Ga0265331_10216872 3300031250 Bacteria 860
141 Ga0265316_10061240 3300031344 Bacteria 2924
142 Ga0265316_10237766 3300031344 Bacteria 1340
143 Ga0265316_10792342 3300031344 Bacteria 665
144 Ga0307508_10046059 3300031616 Bacteria 3895
145 Ga0307508_10115900 3300031616 Bacteria 2281
146 Ga0265314_10171476 3300031711 Bacteria 1309
147 Ga0265342_10038952 3300031712 Bacteria 2891
148 Ga0265342_10115586 3300031712 Bacteria 1515
149 Ga0316215_1010853 3300033544 Bacteria 901
150 Ga0373923_0579103 3300035111 Bacteria 552
151 Ga0373945_0417478 3300035116 Bacteria 590
152 Ga0373953_0262988 3300035117 Bacteria 751
153 Ga0373927_0002544 3300035695 Bacteria 13299
154 Ga0373947_0084954 3300035725 Bacteria 1965
155 Ga0372808_010807 3300036459 Bacteria 1288
156 Ga0373925_0170945 3300037068 Bacteria 1716
157 Ga0395900_0056855 3300037418 Bacteria 4027
158 Ga0395898_0135249 3300037466 Bacteria 2360
159 Ga0436364_0664790 3300037853 Bacteria 3384
160 Ga0436365_0266119 3300039437 Bacteria 1780
161 Ga0436365_0471875 3300039437 Bacteria 937
162 Ga0436365_1640653 3300039437 Bacteria 2524
163 Ga0466969_0038547 3300044656 Bacteria 2404
164 Ga0466966_0156665 3300044684 Bacteria 1387
165 Ga0466963_0133410 3300044694 Bacteria 1717
166 Ga0466959_0228702 3300045049 Bacteria 1288
167 Ga0466967_0023030 3300045976 Bacteria 5097
168 Ga0466967_0181869 3300045976 Bacteria 1983
169 Ga0495629_0149864 3300046459 Bacteria 1621
170 Ga0495580_0963133 3300046472 Bacteria 546
171 Ga0495665_0566800 3300046531 Bacteria 569
172 Ga0495667_0146366 3300046559 Bacteria 1521
173 Ga0495657_0862386 3300046675 Bacteria 516
174 Ga0495599_0289467 3300046678 Bacteria 991
175 Ga0495623_0031785 3300046679 Bacteria 3393
176 Ga0495646_0049755 3300046680 Bacteria 2542
177 Ga0495613_0088646 3300046689 Bacteria 2242
178 Ga0495613_0090060 3300046689 Bacteria 2222
179 Ga0495600_0150740 3300046809 Bacteria 1505
180 Ga0495675_0023144 3300047444 Bacteria 3959
181 Ga0495673_0024122 3300047469 Bacteria 2946
182 Ga0495673_0367752 3300047469 Bacteria 505
183 Ga0495684_0008461 3300047471 Bacteria 7965
184 Ga0495593_0025017 3300047673 Bacteria 3304
185 Ga0496111_0669146 3300048914 Bacteria 757
186 Ga0496114_0335980 3300048917 Bacteria 1336
187 Ga0496115_0535976 3300048918 Bacteria 937
188 Ga0496118_0376836 3300048921 Bacteria 746
189 Ga0496121_0002300 3300048924 Bacteria 29639
190 Ga0496126_0019583 3300048929 Bacteria 6662
191 Ga0496126_0241952 3300048929 Bacteria 1507
192 Ga0496126_0312164 3300048929 Bacteria 1294
193 Ga0496126_1348347 3300048929 Bacteria 517
194 nmdc:mga0sz30_426088_c1 3300050516 Bacteria 595
195 Ga0495595_0093249 3300053084 Bacteria 1447
196 Ga0495595_0193759 3300053084 Bacteria 1010
197 Ga0495619_0005969 3300053085 Bacteria 7713
198 Ga0495619_0522598 3300053085 Bacteria 815
199 Ga0500556_0091529 3300053104 Bacteria 1162
200 Ga0500595_001094 3300053119 Bacteria 15053
201 Ga0500616_0155293 3300053153 Bacteria 1055

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237095 2513647338 85
2 iso_pu_bacteria 2524023205 2524436430 85
3 iso_pu_bacteria 2816332527 2818236376 85
4 iso_pu_bacteria 2876761206 2876764201 85
5 iso_pu_bacteria 2888378607 2888385273 85
6 iso_pu_bacteria 2935959822 2935961252 85
7 iso_pu_bacteria 2941531003 2941531042 85
8 iso_pu_bacteria 3005594810 3005600123 85
9 iso_pu_bacteria 8006926726 8006928249 85
10 iso_pu_bacteria 8019648815 8019649159 85
11 3300035117 Ga0373953_0262988 Ga0373953_0262988_176_517 87
12 3300031250 Ga0265331_10082051 Ga0265331_100820512 88
13 3300005327 Ga0070658_10042866 Ga0070658_100428662 89
14 3300005329 Ga0070683_100098412 Ga0070683_1000984123 89
15 3300005336 Ga0070680_100052913 Ga0070680_1000529132 89
16 3300005336 Ga0070680_100143274 Ga0070680_1001432742 89
17 3300005339 Ga0070660_100108801 Ga0070660_1001088013 89
18 3300005341 Ga0070691_10093372 Ga0070691_100933722 89
19 3300005344 Ga0070661_100651665 Ga0070661_1006516652 89
20 3300005435 Ga0070714_100074511 Ga0070714_1000745112 89
21 3300005436 Ga0070713_100001473 Ga0070713_10000147312 89
22 3300005439 Ga0070711_100110550 Ga0070711_1001105501 89
23 3300005439 Ga0070711_101285969 Ga0070711_1012859692 89
24 3300005445 Ga0070708_100250776 Ga0070708_1002507762 89
25 3300005458 Ga0070681_10048291 Ga0070681_100482912 89
26 3300005458 Ga0070681_10340579 Ga0070681_103405792 89
27 3300005458 Ga0070681_10514859 Ga0070681_105148592 89
28 3300005458 Ga0070681_10837494 Ga0070681_108374942 89
29 3300005467 Ga0070706_100080439 Ga0070706_1000804392 89
30 3300005468 Ga0070707_100223161 Ga0070707_1002231612 89
31 3300005518 Ga0070699_100658773 Ga0070699_1006587732 89
32 3300005518 Ga0070699_100889202 Ga0070699_1008892022 89
33 3300005530 Ga0070679_100522867 Ga0070679_1005228672 89
34 3300005530 Ga0070679_100902556 Ga0070679_1009025561 89
35 3300005535 Ga0070684_100003307 Ga0070684_1000033072 89
36 3300005535 Ga0070684_101995422 Ga0070684_1019954221 89
37 3300005536 Ga0070697_100061759 Ga0070697_1000617592 89
38 3300005539 Ga0068853_100005618 Ga0068853_1000056182 89
39 3300005547 Ga0070693_100556103 Ga0070693_1005561032 89
40 3300005563 Ga0068855_100039686 Ga0068855_1000396861 89
41 3300005563 Ga0068855_100189019 Ga0068855_1001890192 89
42 3300005577 Ga0068857_100188332 Ga0068857_1001883322 89
43 3300005577 Ga0068857_100370191 Ga0068857_1003701912 89
44 3300005578 Ga0068854_100137867 Ga0068854_1001378672 89
45 3300005614 Ga0068856_100000061 Ga0068856_1000000614 89
46 3300005614 Ga0068856_100438885 Ga0068856_1004388852 89
47 3300005616 Ga0068852_100163934 Ga0068852_1001639342 89
48 3300005616 Ga0068852_100517676 Ga0068852_1005176762 89
49 3300005616 Ga0068852_101192645 Ga0068852_1011926451 89
50 3300005842 Ga0068858_100167410 Ga0068858_1001674102 89
51 3300006028 Ga0070717_10005694 Ga0070717_1000569411 89
52 3300006175 Ga0070712_100031931 Ga0070712_1000319313 89
53 3300006186 Ga0075369_10520384 Ga0075369_105203842 89
54 3300006358 Ga0068871_101117156 Ga0068871_1011171562 89
55 3300007265 Ga0099794_10014097 Ga0099794_100140972 89
56 3300007265 Ga0099794_10028856 Ga0099794_100288563 89
57 3300007265 Ga0099794_10344697 Ga0099794_103446972 89
58 3300007265 Ga0099794_10395168 Ga0099794_103951682 89
59 3300009093 Ga0105240_10013389 Ga0105240_100133894 89
60 3300009093 Ga0105240_10033040 Ga0105240_100330403 89
61 3300009093 Ga0105240_10048140 Ga0105240_100481404 89
62 3300009101 Ga0105247_10110466 Ga0105247_101104662 89
63 3300009176 Ga0105242_10972282 Ga0105242_109722822 89
64 3300009177 Ga0105248_11918598 Ga0105248_119185982 89
65 3300009545 Ga0105237_10002947 Ga0105237_1000294711 89
66 3300009545 Ga0105237_10220303 Ga0105237_102203032 89
67 3300009551 Ga0105238_10048381 Ga0105238_100483814 89
68 3300009551 Ga0105238_10654243 Ga0105238_106542432 89
69 3300009551 Ga0105238_11502180 Ga0105238_115021802 89
70 3300010375 Ga0105239_10010500 Ga0105239_1001050011 89
71 3300010375 Ga0105239_12755029 Ga0105239_127550292 89
72 3300013104 Ga0157370_10063754 Ga0157370_100637542 89
73 3300013104 Ga0157370_10067456 Ga0157370_100674563 89
74 3300013104 Ga0157370_10638559 Ga0157370_106385591 89
75 3300013105 Ga0157369_10014337 Ga0157369_100143375 89
76 3300013105 Ga0157369_10090669 Ga0157369_100906694 89
77 3300013105 Ga0157369_10111574 Ga0157369_101115742 89
78 3300013105 Ga0157369_10962655 Ga0157369_109626551 89
79 3300013296 Ga0157374_11607491 Ga0157374_116074911 89
80 3300013307 Ga0157372_10146671 Ga0157372_101466713 89
81 3300013307 Ga0157372_11428901 Ga0157372_114289012 89
82 3300013307 Ga0157372_13087082 Ga0157372_130870822 89
83 3300013308 Ga0157375_11581449 Ga0157375_115814492 89
84 3300014968 Ga0157379_11051420 Ga0157379_110514202 89
85 3300014968 Ga0157379_12423302 Ga0157379_124233021 89
86 3300021388 Ga0213875_10099347 Ga0213875_100993472 89
87 3300025898 Ga0207692_10086343 Ga0207692_100863432 89
88 3300025900 Ga0207710_10067843 Ga0207710_100678432 89
89 3300025904 Ga0207647_10023715 Ga0207647_100237152 89
90 3300025905 Ga0207685_10591909 Ga0207685_105919092 89
91 3300025906 Ga0207699_10373913 Ga0207699_103739132 89
92 3300025909 Ga0207705_10068604 Ga0207705_100686042 89
93 3300025910 Ga0207684_10381388 Ga0207684_103813882 89
94 3300025912 Ga0207707_10005144 Ga0207707_100051443 89
95 3300025912 Ga0207707_10035471 Ga0207707_100354714 89
96 3300025912 Ga0207707_10457851 Ga0207707_104578512 89
97 3300025913 Ga0207695_10027811 Ga0207695_100278115 89
98 3300025914 Ga0207671_10169315 Ga0207671_101693152 89
99 3300025914 Ga0207671_10421156 Ga0207671_104211562 89
100 3300025914 Ga0207671_10594850 Ga0207671_105948502 89
101 3300025914 Ga0207671_10942367 Ga0207671_109423672 89
102 3300025916 Ga0207663_10048555 Ga0207663_100485552 89
103 3300025917 Ga0207660_10101856 Ga0207660_101018563 89
104 3300025919 Ga0207657_10023755 Ga0207657_100237554 89
105 3300025920 Ga0207649_10645699 Ga0207649_106456991 89
106 3300025921 Ga0207652_10153817 Ga0207652_101538172 89
107 3300025921 Ga0207652_10434642 Ga0207652_104346422 89
108 3300025922 Ga0207646_10161089 Ga0207646_101610892 89
109 3300025924 Ga0207694_10075781 Ga0207694_100757812 89
110 3300025924 Ga0207694_11176909 Ga0207694_111769092 89
111 3300025928 Ga0207700_10001134 Ga0207700_1000113412 89
112 3300025928 Ga0207700_10195657 Ga0207700_101956572 89
113 3300025929 Ga0207664_10132840 Ga0207664_101328402 89
114 3300025929 Ga0207664_11732977 Ga0207664_117329771 89
115 3300025932 Ga0207690_10495740 Ga0207690_104957401 89
116 3300025934 Ga0207686_11221762 Ga0207686_112217621 89
117 3300025939 Ga0207665_10457144 Ga0207665_104571441 89
118 3300025944 Ga0207661_10280004 Ga0207661_102800042 89
119 3300025944 Ga0207661_11038278 Ga0207661_110382782 89
120 3300025944 Ga0207661_11885697 Ga0207661_118856971 89
121 3300025949 Ga0207667_10139421 Ga0207667_101394214 89
122 3300025949 Ga0207667_10220677 Ga0207667_102206772 89
123 3300025981 Ga0207640_10117068 Ga0207640_101170682 89
124 3300026035 Ga0207703_10094344 Ga0207703_100943442 89
125 3300026041 Ga0207639_10020071 Ga0207639_100200712 89
126 3300026041 Ga0207639_10165905 Ga0207639_101659053 89
127 3300026078 Ga0207702_10000243 Ga0207702_1000024366 89
128 3300026078 Ga0207702_10068029 Ga0207702_100680292 89
129 3300026116 Ga0207674_10206184 Ga0207674_102061842 89
130 3300026116 Ga0207674_10405546 Ga0207674_104055461 89
131 3300026142 Ga0207698_10064941 Ga0207698_100649413 89
132 3300027671 Ga0209588_1076004 Ga0209588_10760042 89
133 3300027671 Ga0209588_1093943 Ga0209588_10939432 89
134 3300027671 Ga0209588_1125167 Ga0209588_11251672 89
135 3300028573 Ga0265334_10104146 Ga0265334_101041461 89
136 3300028800 Ga0265338_10177616 Ga0265338_101776162 89
137 3300031235 Ga0265330_10003111 Ga0265330_100031118 89
138 3300031238 Ga0265332_10021550 Ga0265332_100215503 89
139 3300031238 Ga0265332_10021898 Ga0265332_100218982 89
140 3300031239 Ga0265328_10021887 Ga0265328_100218873 89
141 3300031241 Ga0265325_10002046 Ga0265325_100020465 89
142 3300031247 Ga0265340_10001534 Ga0265340_100015348 89
143 3300031247 Ga0265340_10226814 Ga0265340_102268141 89
144 3300031247 Ga0265340_10324395 Ga0265340_103243952 89
145 3300031249 Ga0265339_10019779 Ga0265339_100197792 89
146 3300031249 Ga0265339_10080750 Ga0265339_100807502 89
147 3300031249 Ga0265339_10157910 Ga0265339_101579102 89
148 3300031249 Ga0265339_10399339 Ga0265339_103993391 89
149 3300031250 Ga0265331_10128036 Ga0265331_101280362 89
150 3300031250 Ga0265331_10216872 Ga0265331_102168721 89
151 3300031344 Ga0265316_10061240 Ga0265316_100612404 89
152 3300031344 Ga0265316_10237766 Ga0265316_102377661 89
153 3300031344 Ga0265316_10792342 Ga0265316_107923421 89
154 3300031616 Ga0307508_10046059 Ga0307508_100460592 89
155 3300031616 Ga0307508_10115900 Ga0307508_101159002 89
156 3300031711 Ga0265314_10171476 Ga0265314_101714762 89
157 3300031712 Ga0265342_10038952 Ga0265342_100389522 89
158 3300031712 Ga0265342_10115586 Ga0265342_101155862 89
159 3300033544 Ga0316215_1010853 Ga0316215_10108532 89
160 3300035111 Ga0373923_0579103 Ga0373923_0579103_20_325 89
161 3300035116 Ga0373945_0417478 Ga0373945_0417478_103_372 89
162 3300035695 Ga0373927_0002544 Ga0373927_0002544_8833_9102 89
163 3300035725 Ga0373947_0084954 Ga0373947_0084954_907_1176 89
164 3300036459 Ga0372808_010807 Ga0372808_010807_351_620 89
165 3300037068 Ga0373925_0170945 Ga0373925_0170945_907_1176 89
166 3300037418 Ga0395900_0056855 Ga0395900_0056855_424_693 89
167 3300037466 Ga0395898_0135249 Ga0395898_0135249_860_1129 89
168 3300037853 Ga0436364_0664790 Ga0436364_0664790_2090_2359 89
169 3300039437 Ga0436365_0266119 Ga0436365_0266119_1284_1553 89
170 3300039437 Ga0436365_0471875 Ga0436365_0471875_92_361 89
171 3300039437 Ga0436365_1640653 Ga0436365_1640653_700_969 89
172 3300044656 Ga0466969_0038547 Ga0466969_0038547_2024_2293 89
173 3300044684 Ga0466966_0156665 Ga0466966_0156665_1056_1325 89
174 3300044694 Ga0466963_0133410 Ga0466963_0133410_962_1231 89
175 3300045049 Ga0466959_0228702 Ga0466959_0228702_837_1106 89
176 3300045976 Ga0466967_0023030 Ga0466967_0023030_3420_3689 89
177 3300045976 Ga0466967_0181869 Ga0466967_0181869_126_395 89
178 3300046459 Ga0495629_0149864 Ga0495629_0149864_153_422 89
179 3300046472 Ga0495580_0963133 Ga0495580_0963133_140_409 89
180 3300046531 Ga0495665_0566800 Ga0495665_0566800_104_373 89
181 3300046559 Ga0495667_0146366 Ga0495667_0146366_528_797 89
182 3300046675 Ga0495657_0862386 Ga0495657_0862386_20_289 89
183 3300046678 Ga0495599_0289467 Ga0495599_0289467_672_941 89
184 3300046679 Ga0495623_0031785 Ga0495623_0031785_1172_1441 89
185 3300046680 Ga0495646_0049755 Ga0495646_0049755_1449_1718 89
186 3300046689 Ga0495613_0088646 Ga0495613_0088646_989_1258 89
187 3300046689 Ga0495613_0090060 Ga0495613_0090060_1296_1565 89
188 3300046809 Ga0495600_0150740 Ga0495600_0150740_537_806 89
189 3300047444 Ga0495675_0023144 Ga0495675_0023144_457_726 89
190 3300047469 Ga0495673_0024122 Ga0495673_0024122_1552_1821 89
191 3300047469 Ga0495673_0367752 Ga0495673_0367752_45_314 89
192 3300047471 Ga0495684_0008461 Ga0495684_0008461_5145_5414 89
193 3300047673 Ga0495593_0025017 Ga0495593_0025017_2004_2273 89
194 3300048914 Ga0496111_0669146 Ga0496111_0669146_217_486 89
195 3300048917 Ga0496114_0335980 Ga0496114_0335980_173_442 89
196 3300048918 Ga0496115_0535976 Ga0496115_0535976_107_376 89
197 3300048921 Ga0496118_0376836 Ga0496118_0376836_267_536 89
198 3300048924 Ga0496121_0002300 Ga0496121_0002300_4888_5157 89
199 3300048929 Ga0496126_0019583 Ga0496126_0019583_4700_4969 89
200 3300048929 Ga0496126_0241952 Ga0496126_0241952_423_692 89
201 3300048929 Ga0496126_0312164 Ga0496126_0312164_698_967 89
202 3300048929 Ga0496126_1348347 Ga0496126_1348347_58_327 89
203 3300050516 nmdc:mga0sz30_426088_c1 nmdc:mga0sz30_426088_c1_279_548 89
204 3300053084 Ga0495595_0093249 Ga0495595_0093249_966_1235 89
205 3300053084 Ga0495595_0193759 Ga0495595_0193759_346_615 89
206 3300053085 Ga0495619_0005969 Ga0495619_0005969_610_879 89
207 3300053085 Ga0495619_0522598 Ga0495619_0522598_297_566 89
208 3300053104 Ga0500556_0091529 Ga0500556_0091529_267_536 89
209 3300053119 Ga0500595_001094 Ga0500595_001094_8151_8420 89
210 3300053153 Ga0500616_0155293 Ga0500616_0155293_615_884 89
211 3300003763 Ga0055529_1030334 Ga0055529_10303341 96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tv9-assembly1.cif.gz_A human complement component c3b in complex with apl-1030 0.6578 2 89
7qiv-assembly1.cif.gz_A structure of human c3b in complex with the ewe nanobody 0.648 3 89
6ehg-assembly1.cif.gz_A complement component c3b in complex with a nanobody 0.6476 3 89
5hcc-assembly1.cif.gz_B ternary complex of human complement c5 with ornithodoros moubata omci and dermacentor andersoni raci3. 0.6441 3 88
2a74-assembly1.cif.gz_A human complement component c3c 0.6362 3 89
ID Description Score Start End Superfamily
af_Q86AC9_688_781_2.60.40.2840 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6712 6 83 2.60.40.2840
af_P76578_387_483_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6663 2 89 2.60.40.1930
af_A0A1D6EQP6_270_376_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6649 3 86 2.60.40.10
5jtwA02 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6522 2 89 2.60.40.1930
5gaoB12 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6515 2 72 2.60.40.150
ID Description Score Start End GO Terms
AF-A0A1M5MNI2-F1-model_v4 Uncharacterized protein 0.9883 1 88
AF-A0A1M5MNI2-F1-model_v4 Uncharacterized protein 0.9666 1 88
AF-A0A1I3CGP9-F1-model_v4 DUF1929 domain-containing protein 0.9613 1 88
AF-A0A2U8PLB0-F1-model_v4 Uncharacterized protein 0.9593 1 88
AF-A0A4Y9P6D3-F1-model_v4 Uncharacterized protein 0.9578 1 88

Feature Viewer

pLDDT pTM Quality
89 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map