F321574

General Info

Members Datasets Scaffolds Average Seq Length
211 102 422 252

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10048933|Ga0105248_100489334
Length 275
Sequence MTTSAEPYEETVRRDFGGYGRTVVREGELLRHPTYTRFLHWTVAIFFFAALLSGLAIYSPWTFRWLAPLFGGGPMTRFLHPWFGLGFAIAWFFQFLNWRELMTWTDGDSKWLRSIGRYVKNEDKVEPEYVGFYNGGQKLQFWEIVFGGLVLLITGVLMWFPESTGRIAVAISYVLHDIAALIMLGGIFIHIYLSTIGQPGTLEAMTRGVVTRAWAWTNHPGWYRDVTGRDPRSDYEDARRRLANREHAMDALERGDRSPEPKPLAPEAHESKRRD

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.95
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 23.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10048933 3300009177 Bacteria 4742
2 SwRhRL3b_contig_1441939 2162886006 Unclassified 1563
3 rootH1_10006476 3300003323 Unclassified 1146
4 Ga0065715_10021789 3300005293 Bacteria 2317
5 Ga0070676_10121483 3300005328 Bacteria 1640
6 Ga0070682_100335661 3300005337 Bacteria 1122
7 Ga0070703_10000087 3300005406 Bacteria 46150
8 Ga0070709_10000232 3300005434 Bacteria 36020
9 Ga0070709_10000318 3300005434 Bacteria 30634
10 Ga0070709_10055946 3300005434 Bacteria 2493
11 Ga0070714_100002222 3300005435 Bacteria 14300
12 Ga0070714_100002934 3300005435 Bacteria 12627
13 Ga0070714_100156051 3300005435 Unclassified 2060
14 Ga0070714_100160823 3300005435 Unclassified 2032
15 Ga0070714_100403787 3300005435 Bacteria 1292
16 Ga0070713_100000909 3300005436 Bacteria 18927
17 Ga0070713_100005782 3300005436 Bacteria 8500
18 Ga0070713_100024419 3300005436 Bacteria 4707
19 Ga0070713_100043254 3300005436 Bacteria 3681
20 Ga0070713_100043657 3300005436 Bacteria 3666
21 Ga0070713_100118445 3300005436 Bacteria 2319
22 Ga0070713_100296296 3300005436 Bacteria 1488
23 Ga0070713_100456572 3300005436 Unclassified 1201
24 Ga0070710_10010292 3300005437 Bacteria 4593
25 Ga0070710_10122278 3300005437 Unclassified 1577
26 Ga0070710_10132875 3300005437 Bacteria 1519
27 Ga0070701_10203683 3300005438 Unclassified 1171
28 Ga0070711_100000007 3300005439 Bacteria 182651
29 Ga0070711_100000291 3300005439 Bacteria 26041
30 Ga0070711_100017867 3300005439 Bacteria 4520
31 Ga0070705_100000036 3300005440 Bacteria 67281
32 Ga0070700_100215361 3300005441 Bacteria 1358
33 Ga0070694_100043845 3300005444 Bacteria 2993
34 Ga0070708_100014264 3300005445 Bacteria 6531
35 Ga0070708_100030487 3300005445 Bacteria 4661
36 Ga0070708_100110234 3300005445 Bacteria 2529
37 Ga0070708_100134999 3300005445 Bacteria 2285
38 Ga0070681_10040526 3300005458 Bacteria 4666
39 Ga0070706_100000042 3300005467 Bacteria 147128
40 Ga0070706_100034614 3300005467 Bacteria 4666
41 Ga0070706_100058529 3300005467 Bacteria 3556
42 Ga0070706_100069453 3300005467 Bacteria 3258
43 Ga0070706_100072596 3300005467 Bacteria 3184
44 Ga0070706_100103508 3300005467 Bacteria 2647
45 Ga0070706_100148584 3300005467 Unclassified 2188
46 Ga0070706_100159433 3300005467 Unclassified 2106
47 Ga0070706_100705974 3300005467 Unclassified 935
48 Ga0070707_100017804 3300005468 Bacteria 6679
49 Ga0070707_100099194 3300005468 Bacteria 2822
50 Ga0070707_100168081 3300005468 Bacteria 2137
51 Ga0070707_100295333 3300005468 Bacteria 1574
52 Ga0070707_100479584 3300005468 Unclassified 1205
53 Ga0070707_100756363 3300005468 Unclassified 935
54 Ga0070698_100046030 3300005471 Bacteria 4462
55 Ga0070698_100110786 3300005471 Bacteria 2710
56 Ga0070698_100127241 3300005471 Unclassified 2505
57 Ga0070698_100187447 3300005471 Bacteria 2006
58 Ga0070699_100000029 3300005518 Bacteria 151185
59 Ga0070699_100031942 3300005518 Bacteria 4546
60 Ga0070697_100054296 3300005536 Bacteria 3257
61 Ga0070697_100070752 3300005536 Bacteria 2861
62 Ga0070686_100003149 3300005544 Bacteria 9036
63 Ga0070695_100026448 3300005545 Bacteria 3589
64 Ga0070695_100043302 3300005545 Unclassified 2862
65 Ga0070696_100034324 3300005546 Bacteria 3489
66 Ga0070693_100008781 3300005547 Bacteria 5006
67 Ga0068857_100030591 3300005577 Bacteria 4755
68 Ga0068854_100090252 3300005578 Bacteria 2278
69 Ga0070717_10002115 3300006028 Bacteria 13932
70 Ga0070717_10003600 3300006028 Bacteria 11114
71 Ga0070717_10009063 3300006028 Bacteria 7471
72 Ga0070717_10037405 3300006028 Bacteria 3941
73 Ga0070717_10375632 3300006028 Bacteria 1274
74 Ga0070717_10630401 3300006028 Unclassified 973
75 Ga0070715_10131706 3300006163 Unclassified 1204
76 Ga0070716_100001531 3300006173 Bacteria 10353
77 Ga0070716_100055408 3300006173 Bacteria 2269
78 Ga0070716_100096207 3300006173 Unclassified 1804
79 Ga0070716_100103871 3300006173 Unclassified 1748
80 Ga0070716_100377810 3300006173 Bacteria 1012
81 Ga0070712_100000183 3300006175 Bacteria 34712
82 Ga0070712_100003994 3300006175 Bacteria 9067
83 Ga0070712_100103530 3300006175 Bacteria 2110
84 Ga0070712_100455550 3300006175 Unclassified 1066
85 Ga0075428_100022161 3300006844 Bacteria 7032
86 Ga0075433_10126595 3300006852 Bacteria 2269
87 Ga0075433_10230384 3300006852 Bacteria 1645
88 Ga0075436_100051465 3300006914 Bacteria 2842
89 Ga0075435_100156939 3300007076 Bacteria 1915
90 Ga0099794_10096458 3300007265 Unclassified 1472
91 Ga0114129_10046372 3300009147 Bacteria 6107
92 Ga0114129_10635130 3300009147 Unclassified 1380
93 Ga0157373_10476975 3300013100 Unclassified 900
94 Ga0163163_10554491 3300014325 Unclassified 1212
95 Ga0207653_10000078 3300025885 Bacteria 70193
96 Ga0207692_10053770 3300025898 Bacteria 2052
97 Ga0207680_10006007 3300025903 Bacteria 5841
98 Ga0207699_10000009 3300025906 Bacteria 323355
99 Ga0207699_10000270 3300025906 Bacteria 28509
100 Ga0207699_10029130 3300025906 Bacteria 3076
101 Ga0207699_10105649 3300025906 Bacteria 1796
102 Ga0207684_10000061 3300025910 Bacteria 203286
103 Ga0207684_10049782 3300025910 Bacteria 3554
104 Ga0207684_10071804 3300025910 Bacteria 2941
105 Ga0207684_10136325 3300025910 Bacteria 2108
106 Ga0207684_10500884 3300025910 Bacteria 1041
107 Ga0207684_10582813 3300025910 Unclassified 956
108 Ga0207707_10082253 3300025912 Bacteria 2811
109 Ga0207707_10136556 3300025912 Bacteria 2144
110 Ga0207693_10000011 3300025915 Bacteria 160684
111 Ga0207693_10000016 3300025915 Bacteria 145892
112 Ga0207693_10015484 3300025915 Bacteria 6118
113 Ga0207663_10000001 3300025916 Bacteria 591990
114 Ga0207663_10003308 3300025916 Bacteria 7863
115 Ga0207663_10004657 3300025916 Bacteria 6842
116 Ga0207663_10056849 3300025916 Bacteria 2463
117 Ga0207660_10240550 3300025917 Bacteria 1426
118 Ga0207646_10209502 3300025922 Bacteria 1760
119 Ga0207646_10276992 3300025922 Unclassified 1516
120 Ga0207646_10707247 3300025922 Unclassified 901
121 Ga0207700_10014721 3300025928 Bacteria 5135
122 Ga0207700_10025073 3300025928 Bacteria 4135
123 Ga0207700_10032242 3300025928 Bacteria 3735
124 Ga0207700_10096227 3300025928 Bacteria 2350
125 Ga0207700_10217591 3300025928 Unclassified 1617
126 Ga0207700_10267373 3300025928 Bacteria 1466
127 Ga0207700_10385119 3300025928 Unclassified 1227
128 Ga0207664_10000337 3300025929 Bacteria 34549
129 Ga0207664_10171449 3300025929 Bacteria 1857
130 Ga0207665_10061388 3300025939 Bacteria 2547
131 Ga0207665_10126978 3300025939 Unclassified 1807
132 Ga0207665_10442469 3300025939 Unclassified 996
133 Ga0268265_10609052 3300028380 Unclassified 1045
134 Ga0268265_10675146 3300028380 Bacteria 996
135 Ga0265338_10018083 3300028800 Bacteria 7563
136 Ga0265338_10045212 3300028800 Unclassified 4052
137 Ga0265338_10174152 3300028800 Bacteria 1647
138 Ga0265760_10002897 3300031090 Bacteria 5013
139 Ga0265760_10053667 3300031090 Unclassified 1216
140 Ga0265328_10071294 3300031239 Unclassified 1277
141 Ga0265325_10102751 3300031241 Bacteria 1397
142 Ga0265340_10115150 3300031247 Bacteria 1240
143 Ga0265339_10008076 3300031249 Bacteria 6725
144 Ga0265339_10015458 3300031249 Bacteria 4574
145 Ga0265339_10047445 3300031249 Bacteria 2358
146 Ga0265339_10049895 3300031249 Unclassified 2290
147 Ga0265331_10027735 3300031250 Bacteria 2837
148 Ga0265316_10466340 3300031344 Unclassified 905
149 Ga0265314_10016348 3300031711 Bacteria 5861
150 Ga0265314_10113026 3300031711 Unclassified 1722
151 Ga0373926_0023135 3300035083 Bacteria 2157
152 Ga0373926_0095029 3300035083 Unclassified 1111
153 Ga0373934_0089488 3300035086 Unclassified 1240
154 Ga0373936_0005619 3300035113 Bacteria 4728
155 Ga0373945_0004530 3300035116 Bacteria 4416
156 Ga0373945_0059958 3300035116 Bacteria 1418
157 Ga0373953_0008454 3300035117 Bacteria 3497
158 Ga0373954_0024494 3300035118 Bacteria 2752
159 Ga0373943_0002399 3300035170 Bacteria 8492
160 Ga0373943_0123569 3300035170 Unclassified 1378
161 Ga0373946_0007930 3300035171 Bacteria 3898
162 Ga0373955_0088645 3300035172 Bacteria 1760
163 Ga0373955_0254820 3300035172 Unclassified 1052
164 Ga0373924_0010784 3300035410 Bacteria 3382
165 Ga0373931_0431768 3300035691 Unclassified 839
166 Ga0373935_0001166 3300035692 Bacteria 14432
167 Ga0373935_0026329 3300035692 Bacteria 3588
168 Ga0373935_0089584 3300035692 Bacteria 2012
169 Ga0373927_0012695 3300035695 Bacteria 5602
170 Ga0373927_0134729 3300035695 Unclassified 1614
171 Ga0373947_0000576 3300035725 Bacteria 21462
172 Ga0373947_0017176 3300035725 Bacteria 4161
173 Ga0373937_0126850 3300036401 Bacteria 2381
174 Ga0373937_0133322 3300036401 Bacteria 2321
175 Ga0373925_0004973 3300037068 Bacteria 9981
176 Ga0373925_0008993 3300037068 Bacteria 7277
177 Ga0373925_0013897 3300037068 Bacteria 5827
178 Ga0436363_0158848 3300039450 Bacteria 1348
179 Ga0453683_0228591 3300044673 Bacteria 1184
180 Ga0451576_0039330 3300045051 Bacteria 5006
181 Ga0495629_0004647 3300046459 Bacteria 10281
182 Ga0495580_0000774 3300046472 Bacteria 27522
183 Ga0495580_0000873 3300046472 Bacteria 26074
184 Ga0495580_0001776 3300046472 Bacteria 18958
185 Ga0495580_0012763 3300046472 Bacteria 6439
186 Ga0495580_0046379 3300046472 Unclassified 3084
187 Ga0495582_0001668 3300046473 Bacteria 12525
188 Ga0495582_0096697 3300046473 Bacteria 1651
189 Ga0495664_0345248 3300046477 Unclassified 897
190 Ga0495630_0065229 3300046517 Bacteria 2736
191 Ga0495630_0266720 3300046517 Unclassified 1308
192 Ga0495665_0045229 3300046531 Bacteria 2339
193 Ga0495645_0143183 3300046543 Bacteria 1666
194 Ga0495645_0246257 3300046543 Unclassified 1190
195 Ga0495599_0138939 3300046678 Bacteria 1507
196 Ga0495674_0010001 3300047319 Bacteria 8987
197 Ga0495674_0030462 3300047319 Bacteria 4906
198 Ga0495684_0222380 3300047471 Unclassified 1384
199 Ga0495593_0053368 3300047673 Bacteria 2134
200 Ga0495602_0111849 3300048088 Bacteria 2217
201 Ga0495602_0226665 3300048088 Unclassified 1407
202 Ga0496105_0112793 3300048908 Bacteria 2244
203 Ga0496114_0204451 3300048917 Unclassified 1731
204 nmdc:mga05p37_1110_c1 3300050507 Bacteria 30930
205 nmdc:mga05p37_217128_c1 3300050507 Bacteria 2309
206 nmdc:mga0n895_161390_c1 3300050512 Bacteria 2273
207 nmdc:mga0n895_589886_c1 3300050512 Bacteria 1114
208 nmdc:mga0rr50_143340_c1 3300050513 Bacteria 1924
209 nmdc:mga08x19_201643_c1 3300050514 Bacteria 1364
210 nmdc:mga08x19_28_c1 3300050514 Bacteria 224933
211 nmdc:mga0a205_32644_c1 3300050515 Bacteria 4991
212 Ga0105248_10048933
213 SwRhRL3b_contig_1441939
214 rootH1_10006476
215 Ga0065715_10021789
216 Ga0070676_10121483
217 Ga0070682_100335661
218 Ga0070703_10000087
219 Ga0070709_10000232
220 Ga0070709_10000318
221 Ga0070709_10055946
222 Ga0070714_100002222
223 Ga0070714_100002934
224 Ga0070714_100156051
225 Ga0070714_100160823
226 Ga0070714_100403787
227 Ga0070713_100000909
228 Ga0070713_100005782
229 Ga0070713_100024419
230 Ga0070713_100043254
231 Ga0070713_100043657
232 Ga0070713_100118445
233 Ga0070713_100296296
234 Ga0070713_100456572
235 Ga0070710_10010292
236 Ga0070710_10122278
237 Ga0070710_10132875
238 Ga0070701_10203683
239 Ga0070711_100000007
240 Ga0070711_100000291
241 Ga0070711_100017867
242 Ga0070705_100000036
243 Ga0070700_100215361
244 Ga0070694_100043845
245 Ga0070708_100014264
246 Ga0070708_100030487
247 Ga0070708_100110234
248 Ga0070708_100134999
249 Ga0070681_10040526
250 Ga0070706_100000042
251 Ga0070706_100034614
252 Ga0070706_100058529
253 Ga0070706_100069453
254 Ga0070706_100072596
255 Ga0070706_100103508
256 Ga0070706_100148584
257 Ga0070706_100159433
258 Ga0070706_100705974
259 Ga0070707_100017804
260 Ga0070707_100099194
261 Ga0070707_100168081
262 Ga0070707_100295333
263 Ga0070707_100479584
264 Ga0070707_100756363
265 Ga0070698_100046030
266 Ga0070698_100110786
267 Ga0070698_100127241
268 Ga0070698_100187447
269 Ga0070699_100000029
270 Ga0070699_100031942
271 Ga0070697_100054296
272 Ga0070697_100070752
273 Ga0070686_100003149
274 Ga0070695_100026448
275 Ga0070695_100043302
276 Ga0070696_100034324
277 Ga0070693_100008781
278 Ga0068857_100030591
279 Ga0068854_100090252
280 Ga0070717_10002115
281 Ga0070717_10003600
282 Ga0070717_10009063
283 Ga0070717_10037405
284 Ga0070717_10375632
285 Ga0070717_10630401
286 Ga0070715_10131706
287 Ga0070716_100001531
288 Ga0070716_100055408
289 Ga0070716_100096207
290 Ga0070716_100103871
291 Ga0070716_100377810
292 Ga0070712_100000183
293 Ga0070712_100003994
294 Ga0070712_100103530
295 Ga0070712_100455550
296 Ga0075428_100022161
297 Ga0075433_10126595
298 Ga0075433_10230384
299 Ga0075436_100051465
300 Ga0075435_100156939
301 Ga0099794_10096458
302 Ga0114129_10046372
303 Ga0114129_10635130
304 Ga0157373_10476975
305 Ga0163163_10554491
306 Ga0207653_10000078
307 Ga0207692_10053770
308 Ga0207680_10006007
309 Ga0207699_10000009
310 Ga0207699_10000270
311 Ga0207699_10029130
312 Ga0207699_10105649
313 Ga0207684_10000061
314 Ga0207684_10049782
315 Ga0207684_10071804
316 Ga0207684_10136325
317 Ga0207684_10500884
318 Ga0207684_10582813
319 Ga0207707_10082253
320 Ga0207707_10136556
321 Ga0207693_10000011
322 Ga0207693_10000016
323 Ga0207693_10015484
324 Ga0207663_10000001
325 Ga0207663_10003308
326 Ga0207663_10004657
327 Ga0207663_10056849
328 Ga0207660_10240550
329 Ga0207646_10209502
330 Ga0207646_10276992
331 Ga0207646_10707247
332 Ga0207700_10014721
333 Ga0207700_10025073
334 Ga0207700_10032242
335 Ga0207700_10096227
336 Ga0207700_10217591
337 Ga0207700_10267373
338 Ga0207700_10385119
339 Ga0207664_10000337
340 Ga0207664_10171449
341 Ga0207665_10061388
342 Ga0207665_10126978
343 Ga0207665_10442469
344 Ga0268265_10609052
345 Ga0268265_10675146
346 Ga0265338_10018083
347 Ga0265338_10045212
348 Ga0265338_10174152
349 Ga0265760_10002897
350 Ga0265760_10053667
351 Ga0265328_10071294
352 Ga0265325_10102751
353 Ga0265340_10115150
354 Ga0265339_10008076
355 Ga0265339_10015458
356 Ga0265339_10047445
357 Ga0265339_10049895
358 Ga0265331_10027735
359 Ga0265316_10466340
360 Ga0265314_10016348
361 Ga0265314_10113026
362 Ga0373926_0023135
363 Ga0373926_0095029
364 Ga0373934_0089488
365 Ga0373936_0005619
366 Ga0373945_0004530
367 Ga0373945_0059958
368 Ga0373953_0008454
369 Ga0373954_0024494
370 Ga0373943_0002399
371 Ga0373943_0123569
372 Ga0373946_0007930
373 Ga0373955_0088645
374 Ga0373955_0254820
375 Ga0373924_0010784
376 Ga0373931_0431768
377 Ga0373935_0001166
378 Ga0373935_0026329
379 Ga0373935_0089584
380 Ga0373927_0012695
381 Ga0373927_0134729
382 Ga0373947_0000576
383 Ga0373947_0017176
384 Ga0373937_0126850
385 Ga0373937_0133322
386 Ga0373925_0004973
387 Ga0373925_0008993
388 Ga0373925_0013897
389 Ga0436363_0158848
390 Ga0453683_0228591
391 Ga0451576_0039330
392 Ga0495629_0004647
393 Ga0495580_0000774
394 Ga0495580_0000873
395 Ga0495580_0001776
396 Ga0495580_0012763
397 Ga0495580_0046379
398 Ga0495582_0001668
399 Ga0495582_0096697
400 Ga0495664_0345248
401 Ga0495630_0065229
402 Ga0495630_0266720
403 Ga0495665_0045229
404 Ga0495645_0143183
405 Ga0495645_0246257
406 Ga0495599_0138939
407 Ga0495674_0010001
408 Ga0495674_0030462
409 Ga0495684_0222380
410 Ga0495593_0053368
411 Ga0495602_0111849
412 Ga0495602_0226665
413 Ga0496105_0112793
414 Ga0496114_0204451
415 nmdc:mga05p37_1110_c1
416 nmdc:mga05p37_217128_c1
417 nmdc:mga0n895_161390_c1
418 nmdc:mga0n895_589886_c1
419 nmdc:mga0rr50_143340_c1
420 nmdc:mga08x19_201643_c1
421 nmdc:mga08x19_28_c1
422 nmdc:mga0a205_32644_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

31

208

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wqz-assembly1.cif.gz_C structure of human atg9a, the only transmembrane protein of the core autophagy machinery 0.6681 31 94
6o7t-assembly1.cif.gz_f saccharomyces cerevisiae v-atpase vph1-vo 0.6558 36 100
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.6359 27 229
6o7t-assembly1.cif.gz_f saccharomyces cerevisiae v-atpase vph1-vo 0.6184 36 100
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.601 27 229
ID Description Score Start End Superfamily
af_A4HV16_365_494_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.726 34 99 3.30.40.10
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6825 25 222 1.20.950.20
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6445 27 229 1.20.950.20
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6439 25 222 1.20.950.20
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6092 27 229 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A3N5ZZT7-F1-model_v4 Formate dehydrogenase cytochrome b556 subunit 0.819 29 146 GO:0005886
GO:0009055
GO:0009061
GO:0009326
GO:0015944
GO:0022904
GO:0036397
AF-A0A836VIM7-F1-model_v4 Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein 0.8189 23 143 GO:0005886
GO:0009055
GO:0009061
GO:0009326
GO:0015944
GO:0022904
GO:0036397
AF-A0A2V8DYX0-F1-model_v4 Formate dehydrogenase subunit gamma 0.8175 5 232 GO:0005886
GO:0008863
GO:0009055
GO:0009061
GO:0009326
GO:0015944
GO:0022904
GO:0036397
AF-A0A317HR96-F1-model_v4 deleted 0.815 22 118
AF-A0A258C4K6-F1-model_v4 Formate dehydrogenase cytochrome b556 subunit 0.8124 24 138 GO:0005886
GO:0009055
GO:0009061
GO:0009326
GO:0015944
GO:0022904
GO:0036397

Map