F320331

General Info

Members Datasets Scaffolds Average Seq Length
210 129 420 109

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_12113131|Ga0105239_121131312
Length 111
Sequence MEARVKAQIWVQAALRLGDKDGRPGMVLRRGDADAGGILVVLRDRENRLVVLSQTRSDGGELAWLRATGPDPVDQARADAYVDRQVKFDPDLWVIEFESPDFLPPFEGKIL

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
62 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
63 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
129 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 2.38
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 27.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_12113131 3300010375 Bacteria 654
2 rootH2_10192128 3300003320 Unclassified 1644
3 Ga0070683_100206445 3300005329 Unclassified 1866
4 Ga0070677_10393601 3300005333 Unclassified 728
5 Ga0070682_100702438 3300005337 Bacteria 811
6 Ga0068868_101394410 3300005338 Unclassified 653
7 Ga0070667_100708129 3300005367 Bacteria 932
8 Ga0070709_10035148 3300005434 Bacteria 3043
9 Ga0070714_100077388 3300005435 Bacteria 2889
10 Ga0070714_100309015 3300005435 Bacteria 1476
11 Ga0070714_101313307 3300005435 Bacteria 706
12 Ga0070713_101603598 3300005436 Bacteria 632
13 Ga0070710_10136925 3300005437 Bacteria 1498
14 Ga0070711_100023082 3300005439 Bacteria 4041
15 Ga0070678_100899421 3300005456 Unclassified 809
16 Ga0070706_101693449 3300005467 Bacteria 576
17 Ga0070679_100314092 3300005530 Bacteria 1517
18 Ga0070684_101338698 3300005535 Bacteria 674
19 Ga0068855_101074836 3300005563 Bacteria 842
20 Ga0068857_101413349 3300005577 Bacteria 677
21 Ga0068856_100059550 3300005614 Unclassified 3772
22 Ga0068856_101471916 3300005614 Bacteria 695
23 Ga0068852_100518475 3300005616 Bacteria 1189
24 Ga0068859_102489997 3300005617 Unclassified 570
25 Ga0068858_100454136 3300005842 Bacteria 1235
26 Ga0081455_10389619 3300005937 Unclassified 971
27 Ga0070717_10267085 3300006028 Bacteria 1515
28 Ga0070717_10585397 3300006028 Bacteria 1012
29 Ga0070715_10405143 3300006163 Unclassified 759
30 Ga0070716_100433477 3300006173 Bacteria 954
31 Ga0070712_100008517 3300006175 Bacteria 6453
32 Ga0075369_10110817 3300006186 Bacteria 1237
33 Ga0068871_101239149 3300006358 Unclassified 700
34 Ga0097620_102489283 3300006931 Unclassified 570
35 Ga0105240_10340717 3300009093 Unclassified 1703
36 Ga0105240_10708212 3300009093 Bacteria 1098
37 Ga0111539_11250753 3300009094 Unclassified 862
38 Ga0105248_10076715 3300009177 Bacteria 3756
39 Ga0105238_10925806 3300009551 Bacteria 891
40 Ga0105238_11863413 3300009551 Bacteria 634
41 Ga0105249_12607039 3300009553 Unclassified 578
42 Ga0105246_11719638 3300011119 Bacteria 597
43 Ga0157369_10127958 3300013105 Bacteria 2692
44 Ga0163163_10011027 3300014325 Bacteria 8172
45 Ga0182008_10025123 3300014497 Bacteria 3029
46 Ga0157379_11667088 3300014968 Unclassified 624
47 Ga0157376_10242153 3300014969 Bacteria 1681
48 Ga0157376_10686408 3300014969 Bacteria 1028
49 Ga0213875_10010684 3300021388 Bacteria 4590
50 Ga0213875_10031310 3300021388 Bacteria 2517
51 Ga0213875_10053725 3300021388 Bacteria 1886
52 Ga0213875_10235632 3300021388 Bacteria 862
53 Ga0207692_10084231 3300025898 Bacteria 1708
54 Ga0207647_10516328 3300025904 Bacteria 665
55 Ga0207693_10001446 3300025915 Bacteria 21017
56 Ga0207663_10194936 3300025916 Bacteria 1457
57 Ga0207663_11665329 3300025916 Unclassified 513
58 Ga0207652_11556014 3300025921 Bacteria 565
59 Ga0207694_11465811 3300025924 Bacteria 576
60 Ga0207700_10055833 3300025928 Bacteria 2970
61 Ga0207700_10078831 3300025928 Bacteria 2564
62 Ga0207700_10139434 3300025928 Bacteria 1991
63 Ga0207700_10783166 3300025928 Bacteria 853
64 Ga0207700_11253800 3300025928 Bacteria 661
65 Ga0207664_10222603 3300025929 Unclassified 1637
66 Ga0207665_10498832 3300025939 Bacteria 940
67 Ga0207665_10662872 3300025939 Bacteria 818
68 Ga0207661_10394809 3300025944 Unclassified 1254
69 Ga0207667_11058267 3300025949 Bacteria 796
70 Ga0207658_10647805 3300025986 Bacteria 952
71 Ga0207677_11329746 3300026023 Unclassified 661
72 Ga0207702_10462603 3300026078 Unclassified 1232
73 Ga0207702_10494100 3300026078 Bacteria 1192
74 Ga0207702_11302195 3300026078 Bacteria 721
75 Ga0207683_11074170 3300026121 Unclassified 747
76 Ga0207698_12476845 3300026142 Unclassified 529
77 Ga0265320_10185809 3300031240 Bacteria 931
78 Ga0373926_0106626 3300035083 Bacteria 1051
79 Ga0373926_0415448 3300035083 Bacteria 532
80 Ga0373934_0154367 3300035086 Unclassified 941
81 Ga0373944_0165817 3300035089 Unclassified 786
82 Ga0373923_0027494 3300035111 Unclassified 2270
83 Ga0373923_0206002 3300035111 Bacteria 910
84 Ga0373923_0469261 3300035111 Bacteria 612
85 Ga0373945_0176080 3300035116 Bacteria 879
86 Ga0373953_0047059 3300035117 Unclassified 1734
87 Ga0373954_0050879 3300035118 Unclassified 1945
88 Ga0373956_0073593 3300035119 Unclassified 1561
89 Ga0373957_0046325 3300035120 Unclassified 1650
90 Ga0373943_0139025 3300035170 Bacteria 1307
91 Ga0373946_0011625 3300035171 Bacteria 3289
92 Ga0373955_0027678 3300035172 Bacteria 2933
93 Ga0373955_0670084 3300035172 Bacteria 636
94 Ga0373924_0022343 3300035410 Bacteria 2473
95 Ga0373924_0215401 3300035410 Bacteria 848
96 Ga0373935_0011978 3300035692 Bacteria 5211
97 Ga0373935_0136438 3300035692 Bacteria 1653
98 Ga0373935_0486781 3300035692 Bacteria 894
99 Ga0373935_1330129 3300035692 Unclassified 537
100 Ga0373927_0100406 3300035695 Unclassified 1882
101 Ga0373927_0417123 3300035695 Bacteria 886
102 Ga0373933_0007722 3300035724 Bacteria 5873
103 Ga0373933_0020087 3300035724 Bacteria 3783
104 Ga0373933_0072807 3300035724 Bacteria 2093
105 Ga0373947_0027673 3300035725 Bacteria 3319
106 Ga0373947_0127691 3300035725 Unclassified 1621
107 Ga0373937_0004331 3300036401 Bacteria 12046
108 Ga0373937_0011204 3300036401 Bacteria 7861
109 Ga0373937_0054199 3300036401 Bacteria 3679
110 Ga0373937_0190327 3300036401 Bacteria 1928
111 Ga0373937_0552992 3300036401 Bacteria 1093
112 Ga0373925_0566600 3300037068 Unclassified 934
113 Ga0373925_1049414 3300037068 Bacteria 671
114 Ga0436364_0550146 3300037853 Bacteria 1223
115 Ga0436364_0578870 3300037853 Unclassified 700
116 Ga0436364_0643810 3300037853 Bacteria 794
117 Ga0436364_0957145 3300037853 Bacteria 1774
118 Ga0436364_0971740 3300037853 Bacteria 9346
119 Ga0436364_1438657 3300037853 Bacteria 4729
120 Ga0436364_1503095 3300037853 Bacteria 20513
121 Ga0436365_0074292 3300039437 Bacteria 2360
122 Ga0436365_1077904 3300039437 Unclassified 841
123 Ga0436360_0151501 3300039438 Bacteria 521
124 Ga0436360_0343918 3300039438 Bacteria 3127
125 Ga0436360_0405787 3300039438 Bacteria 867
126 Ga0436360_0909675 3300039438 Bacteria 520
127 Ga0436360_1164321 3300039438 Unclassified 834
128 Ga0436360_1346069 3300039438 Bacteria 992
129 Ga0436361_0910397 3300039447 Unclassified 581
130 Ga0436363_0097949 3300039450 Bacteria 780
131 Ga0436363_0438465 3300039450 Bacteria 2817
132 Ga0436363_0577333 3300039450 Bacteria 1027
133 Ga0436363_1060355 3300039450 Unclassified 668
134 Ga0436363_1079426 3300039450 Bacteria 1021
135 Ga0436363_1158884 3300039450 Unclassified 512
136 Ga0436363_1439574 3300039450 Bacteria 883
137 Ga0436362_0505724 3300039453 Bacteria 838
138 Ga0453683_0033718 3300044673 Bacteria 3229
139 Ga0466963_0259475 3300044694 Unclassified 1220
140 Ga0466963_0681576 3300044694 Bacteria 725
141 Ga0466963_0888838 3300044694 Bacteria 628
142 Ga0451576_0002057 3300045051 Bacteria 31640
143 Ga0451576_0020760 3300045051 Bacteria 7149
144 Ga0451576_0065107 3300045051 Bacteria 3795
145 Ga0451576_0277457 3300045051 Bacteria 1752
146 Ga0451576_2374522 3300045051 Bacteria 543
147 Ga0466958_0769198 3300045836 Bacteria 628
148 Ga0495592_0849840 3300046454 Unclassified 539
149 Ga0495651_0004980 3300046462 Bacteria 10149
150 Ga0495651_0011544 3300046462 Bacteria 6785
151 Ga0495653_0185880 3300046463 Bacteria 1422
152 Ga0495664_0005688 3300046477 Bacteria 6858
153 Ga0495664_0737634 3300046477 Bacteria 581
154 Ga0495608_0064236 3300046511 Bacteria 2406
155 Ga0495608_0099711 3300046511 Unclassified 1873
156 Ga0495618_0851098 3300046514 Bacteria 529
157 Ga0495628_0013510 3300046516 Bacteria 6869
158 Ga0495628_0192666 3300046516 Bacteria 1539
159 Ga0495630_0526800 3300046517 Unclassified 906
160 Ga0495652_0599906 3300046529 Bacteria 751
161 Ga0495665_0333456 3300046531 Bacteria 774
162 Ga0495640_0059708 3300046533 Bacteria 2596
163 Ga0495640_0241001 3300046533 Bacteria 1135
164 Ga0495587_0033469 3300046536 Bacteria 3103
165 Ga0495587_0037028 3300046536 Bacteria 2932
166 Ga0495645_0000240 3300046543 Bacteria 40002
167 Ga0495645_0439342 3300046543 Bacteria 825
168 Ga0495667_0045255 3300046559 Bacteria 2914
169 Ga0495634_0600309 3300046642 Unclassified 639
170 Ga0495635_0012185 3300046663 Bacteria 6029
171 Ga0495635_0517050 3300046663 Unclassified 785
172 Ga0495635_0557962 3300046663 Bacteria 750
173 Ga0495657_0064679 3300046675 Unclassified 2408
174 Ga0495599_0047777 3300046678 Bacteria 2682
175 Ga0495599_0082355 3300046678 Unclassified 2010
176 Ga0495623_0669691 3300046679 Unclassified 534
177 Ga0495646_0044726 3300046680 Bacteria 2707
178 Ga0495646_0300353 3300046680 Unclassified 849
179 Ga0495624_0264476 3300046690 Bacteria 1039
180 Ga0495600_0255441 3300046809 Unclassified 1114
181 Ga0495604_0066226 3300047317 Bacteria 2748
182 Ga0495674_0163824 3300047319 Unclassified 1859
183 Ga0495674_0374847 3300047319 Unclassified 1152
184 Ga0495674_0786500 3300047319 Bacteria 741
185 Ga0495680_0093670 3300047322 Bacteria 2248
186 Ga0495680_0129672 3300047322 Unclassified 1854
187 Ga0495680_0659288 3300047322 Bacteria 695
188 Ga0495675_0005833 3300047444 Bacteria 7524
189 Ga0495675_0157437 3300047444 Unclassified 1400
190 Ga0495684_0137889 3300047471 Bacteria 1830
191 Ga0495684_0475328 3300047471 Bacteria 864
192 Ga0495602_0004223 3300048088 Bacteria 14946
193 Ga0495602_0098664 3300048088 Bacteria 2403
194 Ga0496100_1607395 3300048903 Unclassified 514
195 Ga0496104_1689120 3300048907 Bacteria 536
196 Ga0496108_0159512 3300048911 Unclassified 1949
197 Ga0496112_0972436 3300048915 Unclassified 769
198 Ga0496113_1565232 3300048916 Bacteria 508
199 Ga0496121_0783046 3300048924 Bacteria 563
200 Ga0496126_0149733 3300048929 Bacteria 2001
201 Ga0496126_0814844 3300048929 Bacteria 715
202 Ga0495601_0010166 3300053077 Bacteria 5592
203 Ga0495601_0077143 3300053077 Unclassified 2134
204 Ga0495612_0002277 3300053078 Bacteria 7899
205 Ga0495595_0009625 3300053084 Bacteria 4005
206 Ga0495595_0072063 3300053084 Bacteria 1634
207 Ga0495619_0055008 3300053085 Bacteria 2635
208 Ga0495619_0080351 3300053085 Bacteria 2194
209 2929204229 2929199973 Bacteria 7260745
210 8055915223 8055909800 Bacteria 7278581
211 Ga0105239_12113131
212 rootH2_10192128
213 Ga0070683_100206445
214 Ga0070677_10393601
215 Ga0070682_100702438
216 Ga0068868_101394410
217 Ga0070667_100708129
218 Ga0070709_10035148
219 Ga0070714_100077388
220 Ga0070714_100309015
221 Ga0070714_101313307
222 Ga0070713_101603598
223 Ga0070710_10136925
224 Ga0070711_100023082
225 Ga0070678_100899421
226 Ga0070706_101693449
227 Ga0070679_100314092
228 Ga0070684_101338698
229 Ga0068855_101074836
230 Ga0068857_101413349
231 Ga0068856_100059550
232 Ga0068856_101471916
233 Ga0068852_100518475
234 Ga0068859_102489997
235 Ga0068858_100454136
236 Ga0081455_10389619
237 Ga0070717_10267085
238 Ga0070717_10585397
239 Ga0070715_10405143
240 Ga0070716_100433477
241 Ga0070712_100008517
242 Ga0075369_10110817
243 Ga0068871_101239149
244 Ga0097620_102489283
245 Ga0105240_10340717
246 Ga0105240_10708212
247 Ga0111539_11250753
248 Ga0105248_10076715
249 Ga0105238_10925806
250 Ga0105238_11863413
251 Ga0105249_12607039
252 Ga0105246_11719638
253 Ga0157369_10127958
254 Ga0163163_10011027
255 Ga0182008_10025123
256 Ga0157379_11667088
257 Ga0157376_10242153
258 Ga0157376_10686408
259 Ga0213875_10010684
260 Ga0213875_10031310
261 Ga0213875_10053725
262 Ga0213875_10235632
263 Ga0207692_10084231
264 Ga0207647_10516328
265 Ga0207693_10001446
266 Ga0207663_10194936
267 Ga0207663_11665329
268 Ga0207652_11556014
269 Ga0207694_11465811
270 Ga0207700_10055833
271 Ga0207700_10078831
272 Ga0207700_10139434
273 Ga0207700_10783166
274 Ga0207700_11253800
275 Ga0207664_10222603
276 Ga0207665_10498832
277 Ga0207665_10662872
278 Ga0207661_10394809
279 Ga0207667_11058267
280 Ga0207658_10647805
281 Ga0207677_11329746
282 Ga0207702_10462603
283 Ga0207702_10494100
284 Ga0207702_11302195
285 Ga0207683_11074170
286 Ga0207698_12476845
287 Ga0265320_10185809
288 Ga0373926_0106626
289 Ga0373926_0415448
290 Ga0373934_0154367
291 Ga0373944_0165817
292 Ga0373923_0027494
293 Ga0373923_0206002
294 Ga0373923_0469261
295 Ga0373945_0176080
296 Ga0373953_0047059
297 Ga0373954_0050879
298 Ga0373956_0073593
299 Ga0373957_0046325
300 Ga0373943_0139025
301 Ga0373946_0011625
302 Ga0373955_0027678
303 Ga0373955_0670084
304 Ga0373924_0022343
305 Ga0373924_0215401
306 Ga0373935_0011978
307 Ga0373935_0136438
308 Ga0373935_0486781
309 Ga0373935_1330129
310 Ga0373927_0100406
311 Ga0373927_0417123
312 Ga0373933_0007722
313 Ga0373933_0020087
314 Ga0373933_0072807
315 Ga0373947_0027673
316 Ga0373947_0127691
317 Ga0373937_0004331
318 Ga0373937_0011204
319 Ga0373937_0054199
320 Ga0373937_0190327
321 Ga0373937_0552992
322 Ga0373925_0566600
323 Ga0373925_1049414
324 Ga0436364_0550146
325 Ga0436364_0578870
326 Ga0436364_0643810
327 Ga0436364_0957145
328 Ga0436364_0971740
329 Ga0436364_1438657
330 Ga0436364_1503095
331 Ga0436365_0074292
332 Ga0436365_1077904
333 Ga0436360_0151501
334 Ga0436360_0343918
335 Ga0436360_0405787
336 Ga0436360_0909675
337 Ga0436360_1164321
338 Ga0436360_1346069
339 Ga0436361_0910397
340 Ga0436363_0097949
341 Ga0436363_0438465
342 Ga0436363_0577333
343 Ga0436363_1060355
344 Ga0436363_1079426
345 Ga0436363_1158884
346 Ga0436363_1439574
347 Ga0436362_0505724
348 Ga0453683_0033718
349 Ga0466963_0259475
350 Ga0466963_0681576
351 Ga0466963_0888838
352 Ga0451576_0002057
353 Ga0451576_0020760
354 Ga0451576_0065107
355 Ga0451576_0277457
356 Ga0451576_2374522
357 Ga0466958_0769198
358 Ga0495592_0849840
359 Ga0495651_0004980
360 Ga0495651_0011544
361 Ga0495653_0185880
362 Ga0495664_0005688
363 Ga0495664_0737634
364 Ga0495608_0064236
365 Ga0495608_0099711
366 Ga0495618_0851098
367 Ga0495628_0013510
368 Ga0495628_0192666
369 Ga0495630_0526800
370 Ga0495652_0599906
371 Ga0495665_0333456
372 Ga0495640_0059708
373 Ga0495640_0241001
374 Ga0495587_0033469
375 Ga0495587_0037028
376 Ga0495645_0000240
377 Ga0495645_0439342
378 Ga0495667_0045255
379 Ga0495634_0600309
380 Ga0495635_0012185
381 Ga0495635_0517050
382 Ga0495635_0557962
383 Ga0495657_0064679
384 Ga0495599_0047777
385 Ga0495599_0082355
386 Ga0495623_0669691
387 Ga0495646_0044726
388 Ga0495646_0300353
389 Ga0495624_0264476
390 Ga0495600_0255441
391 Ga0495604_0066226
392 Ga0495674_0163824
393 Ga0495674_0374847
394 Ga0495674_0786500
395 Ga0495680_0093670
396 Ga0495680_0129672
397 Ga0495680_0659288
398 Ga0495675_0005833
399 Ga0495675_0157437
400 Ga0495684_0137889
401 Ga0495684_0475328
402 Ga0495602_0004223
403 Ga0495602_0098664
404 Ga0496100_1607395
405 Ga0496104_1689120
406 Ga0496108_0159512
407 Ga0496112_0972436
408 Ga0496113_1565232
409 Ga0496121_0783046
410 Ga0496126_0149733
411 Ga0496126_0814844
412 Ga0495601_0010166
413 Ga0495601_0077143
414 Ga0495612_0002277
415 Ga0495595_0009625
416 Ga0495595_0072063
417 Ga0495619_0055008
418 Ga0495619_0080351
419 2929204229
420 8055915223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07372

DUF1491

Protein of unknown function (DUF1491)

5

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4goq-assembly5.cif.gz_E crystal structure of a duf1491 family protein (cc_1065) from caulobacter crescentus cb15 at 1.87 a resolution 0.8814 5 111
4goq-assembly3.cif.gz_C crystal structure of a duf1491 family protein (cc_1065) from caulobacter crescentus cb15 at 1.87 a resolution 0.8758 6 111
4goq-assembly5.cif.gz_E crystal structure of a duf1491 family protein (cc_1065) from caulobacter crescentus cb15 at 1.87 a resolution 0.8738 5 111
4goq-assembly2.cif.gz_B crystal structure of a duf1491 family protein (cc_1065) from caulobacter crescentus cb15 at 1.87 a resolution 0.8734 6 111
2n6e-assembly1.cif.gz_A nmr structure of a duf1491 family protein (cc_1065) from caulobacter crescentus cb15 0.8711 6 111
ID Description Score Start End Superfamily
4goqC00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1805;Protein of unknown function (DUF1491) 0.876 5 111 3.40.1530.20
4goqC00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1805;Protein of unknown function (DUF1491) 0.8681 5 111 3.40.1530.20
2knrA00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1805;Protein of unknown function (DUF1491) 0.8423 4 106 3.40.1530.20
2knrA00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1805;Protein of unknown function (DUF1491) 0.7812 4 106 3.40.1530.20
3umvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.754 76 99 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1G6X149-F1-model_v4 DUF1491 domain-containing protein 0.9782 1 111
AF-A0A379N8U8-F1-model_v4 deleted 0.9735 27 111
AF-A0A1Y5E671-F1-model_v4 GTP-binding protein Era 0.9698 3 111
AF-A0A1G6X149-F1-model_v4 DUF1491 domain-containing protein 0.9696 1 111
AF-A0A2G4RCX6-F1-model_v4 DUF1491 domain-containing protein 0.9678 1 111

Map