F319914

General Info

Members Datasets Scaffolds Average Seq Length
210 122 420 154

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10768174|Ga0070658_107681741
Length 171
Sequence MASRKPVKAAKSPAAKKXXXSSKVSGAIPTIDARHTGFQLIVRPSKIHRWGVYAGEDIPARRKVIEYTGERISRRETRRRSDAQDKMIYLFTLDNYWTIDGAVGGSGAEFINHCCDPNIVTEIRNGHILYMSRRPIRRGEELTVDYHFGKDIEEVPCHCGAKTCRGTINVK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 19.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10768174 3300005327 Bacteria 837
2 Ga0070658_10184360 3300005327 Bacteria 1757
3 Ga0070658_10404436 3300005327 Bacteria 1173
4 Ga0070658_10496449 3300005327 Bacteria 1054
5 Ga0070683_100214231 3300005329 Bacteria 1830
6 Ga0070680_100002639 3300005336 Bacteria 13286
7 Ga0070673_100708952 3300005364 Bacteria 924
8 Ga0070714_100020621 3300005435 Bacteria 5386
9 Ga0070713_100222277 3300005436 Bacteria 1713
10 Ga0070713_100772647 3300005436 Bacteria 920
11 Ga0070678_100906120 3300005456 Unclassified 806
12 Ga0070699_100306122 3300005518 Unclassified 1426
13 Ga0070679_100186115 3300005530 Bacteria 2047
14 Ga0070679_100495877 3300005530 Bacteria 1165
15 Ga0070679_102109775 3300005530 Unclassified 513
16 Ga0070684_100000007 3300005535 Bacteria 217174
17 Ga0068853_101244056 3300005539 Bacteria 719
18 Ga0070665_100442655 3300005548 Unclassified 1309
19 Ga0070665_100482772 3300005548 Bacteria 1250
20 Ga0068855_100053905 3300005563 Bacteria 4730
21 Ga0068855_100097384 3300005563 Bacteria 3389
22 Ga0068855_100136661 3300005563 Bacteria 2796
23 Ga0068855_101394385 3300005563 Bacteria 722
24 Ga0070664_101761361 3300005564 Bacteria 587
25 Ga0068857_100860473 3300005577 Bacteria 868
26 Ga0068856_100211833 3300005614 Bacteria 1953
27 Ga0068856_100302640 3300005614 Bacteria 1617
28 Ga0068856_101355731 3300005614 Unclassified 726
29 Ga0068852_100031475 3300005616 Bacteria 4378
30 Ga0068852_100300705 3300005616 Unclassified 1553
31 Ga0068852_101032385 3300005616 Unclassified 841
32 Ga0068859_101234924 3300005617 Bacteria 823
33 Ga0068864_102666893 3300005618 Unclassified 505
34 Ga0068863_101694457 3300005841 Unclassified 642
35 Ga0068858_100636521 3300005842 Bacteria 1036
36 Ga0070717_10007095 3300006028 Bacteria 8300
37 Ga0097621_100273971 3300006237 Bacteria 1484
38 Ga0097621_100456032 3300006237 Bacteria 1152
39 Ga0075430_100088443 3300006846 Bacteria 2592
40 Ga0075431_100194540 3300006847 Bacteria 2077
41 Ga0075433_10929427 3300006852 Unclassified 758
42 Ga0097620_101235028 3300006931 Bacteria 823
43 Ga0105240_10003340 3300009093 Bacteria 24982
44 Ga0105240_10173218 3300009093 Bacteria 2554
45 Ga0105240_10600978 3300009093 Bacteria 1211
46 Ga0105245_10261241 3300009098 Bacteria 1685
47 Ga0105245_10851534 3300009098 Bacteria 952
48 Ga0114129_10794206 3300009147 Bacteria 1208
49 Ga0105243_10700715 3300009148 Unclassified 987
50 Ga0105241_10298207 3300009174 Bacteria 1382
51 Ga0105242_10161375 3300009176 Bacteria 1962
52 Ga0105242_10890969 3300009176 Bacteria 889
53 Ga0105248_10052619 3300009177 Bacteria 4569
54 Ga0105248_10124281 3300009177 Unclassified 2910
55 Ga0105248_10143138 3300009177 Bacteria 2698
56 Ga0105248_10262256 3300009177 Unclassified 1945
57 Ga0105248_10845722 3300009177 Bacteria 1033
58 Ga0105248_10933516 3300009177 Unclassified 980
59 Ga0105237_10029103 3300009545 Bacteria 5619
60 Ga0105237_10109694 3300009545 Unclassified 2751
61 Ga0105237_11209826 3300009545 Bacteria 762
62 Ga0105238_10550000 3300009551 Unclassified 1158
63 Ga0105239_10131097 3300010375 Bacteria 2788
64 Ga0105239_11661181 3300010375 Unclassified 739
65 Ga0157370_10019493 3300013104 Bacteria 6803
66 Ga0157370_10259949 3300013104 Bacteria 1605
67 Ga0157370_10365909 3300013104 Bacteria 1329
68 Ga0157370_10610055 3300013104 Unclassified 999
69 Ga0157370_10612159 3300013104 Bacteria 997
70 Ga0157369_10013939 3300013105 Bacteria 9084
71 Ga0157369_10695717 3300013105 Bacteria 1047
72 Ga0157374_10454320 3300013296 Bacteria 1283
73 Ga0157374_10889990 3300013296 Bacteria 908
74 Ga0157378_11515507 3300013297 Bacteria 715
75 Ga0163162_10613748 3300013306 Bacteria 1213
76 Ga0163162_11655172 3300013306 Bacteria 730
77 Ga0163162_12255728 3300013306 Unclassified 625
78 Ga0157372_10018679 3300013307 Bacteria 7459
79 Ga0157372_10125635 3300013307 Bacteria 2949
80 Ga0157372_12431111 3300013307 Unclassified 601
81 Ga0157375_10667277 3300013308 Bacteria 1195
82 Ga0157375_10980999 3300013308 Bacteria 985
83 Ga0163163_10020650 3300014325 Bacteria 6207
84 Ga0163163_10554708 3300014325 Bacteria 1211
85 Ga0157376_10005214 3300014969 Bacteria 9068
86 Ga0157376_10491406 3300014969 Unclassified 1204
87 Ga0213874_10011919 3300021377 Bacteria 2216
88 Ga0213876_10117733 3300021384 Bacteria 1410
89 Ga0213876_10506507 3300021384 Bacteria 642
90 Ga0213875_10001250 3300021388 Bacteria 17154
91 Ga0213875_10010256 3300021388 Bacteria 4699
92 Ga0213875_10025778 3300021388 Bacteria 2799
93 Ga0213875_10422449 3300021388 Unclassified 637
94 Ga0207642_10470793 3300025899 Bacteria 764
95 Ga0207643_10349093 3300025908 Unclassified 929
96 Ga0207705_10149951 3300025909 Bacteria 1747
97 Ga0207705_10289277 3300025909 Unclassified 1255
98 Ga0207705_10303784 3300025909 Bacteria 1224
99 Ga0207705_10397710 3300025909 Bacteria 1065
100 Ga0207705_10421823 3300025909 Bacteria 1033
101 Ga0207654_10672707 3300025911 Bacteria 742
102 Ga0207707_10107825 3300025912 Bacteria 2435
103 Ga0207695_10006943 3300025913 Bacteria 14539
104 Ga0207695_10160218 3300025913 Bacteria 2182
105 Ga0207671_10155673 3300025914 Bacteria 1767
106 Ga0207671_10180299 3300025914 Bacteria 1643
107 Ga0207660_10017633 3300025917 Bacteria 4747
108 Ga0207652_10155608 3300025921 Bacteria 2048
109 Ga0207687_10246820 3300025927 Unclassified 1417
110 Ga0207687_11012707 3300025927 Bacteria 712
111 Ga0207700_10431694 3300025928 Unclassified 1158
112 Ga0207690_10344263 3300025932 Bacteria 1177
113 Ga0207686_10330345 3300025934 Bacteria 1142
114 Ga0207704_10560994 3300025938 Unclassified 929
115 Ga0207711_10131350 3300025941 Bacteria 2246
116 Ga0207711_10409624 3300025941 Bacteria 1260
117 Ga0207661_10000003 3300025944 Bacteria 611941
118 Ga0207661_10121993 3300025944 Bacteria 2220
119 Ga0207667_10066520 3300025949 Bacteria 3757
120 Ga0207667_10116227 3300025949 Bacteria 2757
121 Ga0207667_10585734 3300025949 Bacteria 1126
122 Ga0207651_10492775 3300025960 Bacteria 1058
123 Ga0207677_10949765 3300026023 Bacteria 777
124 Ga0207702_10088374 3300026078 Bacteria 2707
125 Ga0207702_10322209 3300026078 Bacteria 1472
126 Ga0207641_10674026 3300026088 Unclassified 1017
127 Ga0207641_10798836 3300026088 Bacteria 933
128 Ga0207683_10794720 3300026121 Unclassified 878
129 Ga0207698_10063143 3300026142 Bacteria 2897
130 Ga0207698_10855227 3300026142 Unclassified 915
131 Ga0268266_10072599 3300028379 Bacteria 2985
132 Ga0268266_10225802 3300028379 Bacteria 1723
133 Ga0268264_10698981 3300028381 Bacteria 1007
134 Ga0265338_10147657 3300028800 Bacteria 1832
135 Ga0265760_10099511 3300031090 Unclassified 918
136 Ga0265329_10119900 3300031242 Unclassified 843
137 Ga0265339_10434343 3300031249 Unclassified 611
138 Ga0265316_10006866 3300031344 Bacteria 10808
139 Ga0265316_10079607 3300031344 Bacteria 2514
140 Ga0265316_10112297 3300031344 Bacteria 2063
141 Ga0265316_10161990 3300031344 Bacteria 1672
142 Ga0373936_0043455 3300035113 Bacteria 1806
143 Ga0373953_0134237 3300035117 Bacteria 1057
144 Ga0373943_0120796 3300035170 Bacteria 1392
145 Ga0373927_0159275 3300035695 Bacteria 1479
146 Ga0373933_0056056 3300035724 Bacteria 2365
147 Ga0373937_0246093 3300036401 Bacteria 1685
148 Ga0373937_1319102 3300036401 Bacteria 670
149 Ga0373925_0364208 3300037068 Bacteria 1175
150 Ga0395898_0257560 3300037466 Bacteria 1664
151 Ga0395898_0367105 3300037466 Unclassified 1373
152 Ga0436364_0044406 3300037853 Bacteria 2292
153 Ga0436364_0091686 3300037853 Unclassified 1153
154 Ga0436364_0314847 3300037853 Bacteria 1712
155 Ga0436364_0503448 3300037853 Bacteria 873
156 Ga0436364_0520737 3300037853 Unclassified 673
157 Ga0436364_0589860 3300037853 Bacteria 38748
158 Ga0436364_0629303 3300037853 Bacteria 1007
159 Ga0436364_0740516 3300037853 Unclassified 714
160 Ga0436364_0748068 3300037853 Bacteria 528910
161 Ga0436364_0944751 3300037853 Bacteria 18572
162 Ga0436364_1139831 3300037853 Bacteria 1940
163 Ga0395901_0203659 3300038443 Bacteria 2074
164 Ga0436365_0480142 3300039437 Bacteria 656
165 Ga0436365_1198256 3300039437 Bacteria 11815
166 Ga0436365_1900598 3300039437 Bacteria 2667
167 Ga0436360_0281013 3300039438 Bacteria 1506
168 Ga0436363_0045340 3300039450 Unclassified 810
169 Ga0436363_0214427 3300039450 Bacteria 10782
170 Ga0436362_0223003 3300039453 Bacteria 1502
171 Ga0436362_0858923 3300039453 Bacteria 547
172 Ga0451576_0061560 3300045051 Unclassified 3914
173 Ga0466967_1160178 3300045976 Bacteria 770
174 Ga0495592_0003292 3300046454 Bacteria 11574
175 Ga0495653_0369468 3300046463 Bacteria 918
176 Ga0495580_0001231 3300046472 Bacteria 22586
177 Ga0495580_0259047 3300046472 Bacteria 1190
178 Ga0495662_0026994 3300046476 Bacteria 2773
179 Ga0495664_0001274 3300046477 Bacteria 13217
180 Ga0495628_0003981 3300046516 Bacteria 13159
181 Ga0495628_0033036 3300046516 Bacteria 4173
182 Ga0495630_0021378 3300046517 Bacteria 4778
183 Ga0495652_0095011 3300046529 Bacteria 2430
184 Ga0495640_0096959 3300046533 Bacteria 1939
185 Ga0495640_0619585 3300046533 Bacteria 653
186 Ga0495586_0010429 3300046535 Bacteria 4940
187 Ga0495586_0199823 3300046535 Bacteria 1133
188 Ga0495586_0392691 3300046535 Bacteria 798
189 Ga0495587_0150894 3300046536 Bacteria 1324
190 Ga0495645_0011284 3300046543 Bacteria 6282
191 Ga0495645_0362601 3300046543 Bacteria 931
192 Ga0495667_0018023 3300046559 Bacteria 4769
193 Ga0495634_0011490 3300046642 Bacteria 6441
194 Ga0495635_0071621 3300046663 Bacteria 2376
195 Ga0495635_0075376 3300046663 Bacteria 2311
196 Ga0495635_0087836 3300046663 Bacteria 2127
197 Ga0495635_0154395 3300046663 Bacteria 1563
198 Ga0495599_0197130 3300046678 Bacteria 1238
199 Ga0495623_0162113 3300046679 Bacteria 1313
200 Ga0495658_0236864 3300046683 Bacteria 1146
201 Ga0495581_0476414 3300047315 Bacteria 726
202 Ga0495604_0117081 3300047317 Bacteria 1933
203 Ga0495674_0017467 3300047319 Bacteria 6676
204 Ga0495674_0127323 3300047319 Bacteria 2147
205 Ga0495684_0288821 3300047471 Bacteria 1181
206 Ga0495602_0198838 3300048088 Bacteria 1531
207 Ga0495614_0330283 3300048089 Bacteria 708
208 Ga0496115_0011239 3300048918 Bacteria 6709
209 nmdc:mga0qj67_80284_c1 3300050509 Bacteria 2613
210 nmdc:mga08y16_2017030_c1 3300050511 Unclassified 526
211 Ga0070658_10768174
212 Ga0070658_10184360
213 Ga0070658_10404436
214 Ga0070658_10496449
215 Ga0070683_100214231
216 Ga0070680_100002639
217 Ga0070673_100708952
218 Ga0070714_100020621
219 Ga0070713_100222277
220 Ga0070713_100772647
221 Ga0070678_100906120
222 Ga0070699_100306122
223 Ga0070679_100186115
224 Ga0070679_100495877
225 Ga0070679_102109775
226 Ga0070684_100000007
227 Ga0068853_101244056
228 Ga0070665_100442655
229 Ga0070665_100482772
230 Ga0068855_100053905
231 Ga0068855_100097384
232 Ga0068855_100136661
233 Ga0068855_101394385
234 Ga0070664_101761361
235 Ga0068857_100860473
236 Ga0068856_100211833
237 Ga0068856_100302640
238 Ga0068856_101355731
239 Ga0068852_100031475
240 Ga0068852_100300705
241 Ga0068852_101032385
242 Ga0068859_101234924
243 Ga0068864_102666893
244 Ga0068863_101694457
245 Ga0068858_100636521
246 Ga0070717_10007095
247 Ga0097621_100273971
248 Ga0097621_100456032
249 Ga0075430_100088443
250 Ga0075431_100194540
251 Ga0075433_10929427
252 Ga0097620_101235028
253 Ga0105240_10003340
254 Ga0105240_10173218
255 Ga0105240_10600978
256 Ga0105245_10261241
257 Ga0105245_10851534
258 Ga0114129_10794206
259 Ga0105243_10700715
260 Ga0105241_10298207
261 Ga0105242_10161375
262 Ga0105242_10890969
263 Ga0105248_10052619
264 Ga0105248_10124281
265 Ga0105248_10143138
266 Ga0105248_10262256
267 Ga0105248_10845722
268 Ga0105248_10933516
269 Ga0105237_10029103
270 Ga0105237_10109694
271 Ga0105237_11209826
272 Ga0105238_10550000
273 Ga0105239_10131097
274 Ga0105239_11661181
275 Ga0157370_10019493
276 Ga0157370_10259949
277 Ga0157370_10365909
278 Ga0157370_10610055
279 Ga0157370_10612159
280 Ga0157369_10013939
281 Ga0157369_10695717
282 Ga0157374_10454320
283 Ga0157374_10889990
284 Ga0157378_11515507
285 Ga0163162_10613748
286 Ga0163162_11655172
287 Ga0163162_12255728
288 Ga0157372_10018679
289 Ga0157372_10125635
290 Ga0157372_12431111
291 Ga0157375_10667277
292 Ga0157375_10980999
293 Ga0163163_10020650
294 Ga0163163_10554708
295 Ga0157376_10005214
296 Ga0157376_10491406
297 Ga0213874_10011919
298 Ga0213876_10117733
299 Ga0213876_10506507
300 Ga0213875_10001250
301 Ga0213875_10010256
302 Ga0213875_10025778
303 Ga0213875_10422449
304 Ga0207642_10470793
305 Ga0207643_10349093
306 Ga0207705_10149951
307 Ga0207705_10289277
308 Ga0207705_10303784
309 Ga0207705_10397710
310 Ga0207705_10421823
311 Ga0207654_10672707
312 Ga0207707_10107825
313 Ga0207695_10006943
314 Ga0207695_10160218
315 Ga0207671_10155673
316 Ga0207671_10180299
317 Ga0207660_10017633
318 Ga0207652_10155608
319 Ga0207687_10246820
320 Ga0207687_11012707
321 Ga0207700_10431694
322 Ga0207690_10344263
323 Ga0207686_10330345
324 Ga0207704_10560994
325 Ga0207711_10131350
326 Ga0207711_10409624
327 Ga0207661_10000003
328 Ga0207661_10121993
329 Ga0207667_10066520
330 Ga0207667_10116227
331 Ga0207667_10585734
332 Ga0207651_10492775
333 Ga0207677_10949765
334 Ga0207702_10088374
335 Ga0207702_10322209
336 Ga0207641_10674026
337 Ga0207641_10798836
338 Ga0207683_10794720
339 Ga0207698_10063143
340 Ga0207698_10855227
341 Ga0268266_10072599
342 Ga0268266_10225802
343 Ga0268264_10698981
344 Ga0265338_10147657
345 Ga0265760_10099511
346 Ga0265329_10119900
347 Ga0265339_10434343
348 Ga0265316_10006866
349 Ga0265316_10079607
350 Ga0265316_10112297
351 Ga0265316_10161990
352 Ga0373936_0043455
353 Ga0373953_0134237
354 Ga0373943_0120796
355 Ga0373927_0159275
356 Ga0373933_0056056
357 Ga0373937_0246093
358 Ga0373937_1319102
359 Ga0373925_0364208
360 Ga0395898_0257560
361 Ga0395898_0367105
362 Ga0436364_0044406
363 Ga0436364_0091686
364 Ga0436364_0314847
365 Ga0436364_0503448
366 Ga0436364_0520737
367 Ga0436364_0589860
368 Ga0436364_0629303
369 Ga0436364_0740516
370 Ga0436364_0748068
371 Ga0436364_0944751
372 Ga0436364_1139831
373 Ga0395901_0203659
374 Ga0436365_0480142
375 Ga0436365_1198256
376 Ga0436365_1900598
377 Ga0436360_0281013
378 Ga0436363_0045340
379 Ga0436363_0214427
380 Ga0436362_0223003
381 Ga0436362_0858923
382 Ga0451576_0061560
383 Ga0466967_1160178
384 Ga0495592_0003292
385 Ga0495653_0369468
386 Ga0495580_0001231
387 Ga0495580_0259047
388 Ga0495662_0026994
389 Ga0495664_0001274
390 Ga0495628_0003981
391 Ga0495628_0033036
392 Ga0495630_0021378
393 Ga0495652_0095011
394 Ga0495640_0096959
395 Ga0495640_0619585
396 Ga0495586_0010429
397 Ga0495586_0199823
398 Ga0495586_0392691
399 Ga0495587_0150894
400 Ga0495645_0011284
401 Ga0495645_0362601
402 Ga0495667_0018023
403 Ga0495634_0011490
404 Ga0495635_0071621
405 Ga0495635_0075376
406 Ga0495635_0087836
407 Ga0495635_0154395
408 Ga0495599_0197130
409 Ga0495623_0162113
410 Ga0495658_0236864
411 Ga0495581_0476414
412 Ga0495604_0117081
413 Ga0495674_0017467
414 Ga0495674_0127323
415 Ga0495684_0288821
416 Ga0495602_0198838
417 Ga0495614_0330283
418 Ga0496115_0011239
419 nmdc:mga0qj67_80284_c1
420 nmdc:mga08y16_2017030_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00856

SET

SET domain

49

147

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kkl-assembly1.cif.gz_B structure of ctprc2 in complex with h3k27me3 and h3k27m 0.9336 22 132
7td5-assembly1.cif.gz_A structure of human prc2-ezh1 containing phosphorylated suz12 0.9302 24 132
4w2r-assembly1.cif.gz_A structure of hs/acprc2 in complex with 5,8-dichloro-2-[(4-methoxy-6-methyl-2-oxo-1,2-dihydropyridin-3-yl)methyl]-7-[(r)-methoxy(oxetan-3-yl)methyl]-3,4-dihydroisoquinolin-1(2h)-one 0.9296 24 132
5wg6-assembly2.cif.gz_C human polycomb repressive complex 2 in complex with gsk126 inhibitor 0.9258 24 132
5wg6-assembly1.cif.gz_A human polycomb repressive complex 2 in complex with gsk126 inhibitor 0.925 24 132
ID Description Score Start End Superfamily
af_Q8IDE8_189_274_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.9431 95 132 2.170.270.10
af_Q4CYF5_557_642_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.9343 94 132 2.170.270.10
af_Q8IE95_2027_2275_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.9317 26 152 2.170.270.10
af_Q8I422_351_496_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.9309 95 130 2.170.270.10
af_A0A1D6Q4P2_267_472_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.9272 24 132 2.170.270.10
ID Description Score Start End GO Terms
AF-A0A2N9MXY7-F1-model_v4 Nuclear protein SET (Modular protein) 0.9789 16 155 GO:0006325
GO:0008168
GO:0032259
AF-A0A7S7NK18-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9761 11 158 GO:0005694
GO:0016279
GO:0032259
GO:0140938
AF-A0A7X2TZ12-F1-model_v4 SET domain-containing protein 0.9749 15 158 GO:0005694
GO:0032259
GO:0046974
AF-A0A2V8RVV7-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9715 15 156 GO:0005694
GO:0032259
GO:0046974
AF-A0A7X2PM60-F1-model_v4 SET domain-containing protein 0.9678 12 156 GO:0005694
GO:0016279
GO:0032259
GO:0140938

Map