F319364

General Info

Members Datasets Scaffolds Average Seq Length
209 131 209 442

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0107647|Ga0395898_0107647_1244_2623
Length 459
Sequence VLNWYVLGGKVAKKPVSRYVCSNCGNVTTSWSGKCPHCGEWNTLQEQLAPGTVAGSVAAGSLLQAQTVDKSVARDQKRMQTGMSEVDDVFGGGIVAGSVNLIAGQPGIGKSTLLLQLAYLIAGKSSVLYVSGEESAHQIGLRAERLGTLRNELNLATSNSADDIAATIASDKYDLVIVDSIQTISCSAIASAAGTVSQITNATQLLTLAAKQTNTAIVLVGHVTKEGSIAGPKVLEHVVDVVLQLEGDRYGGFKLLRAIKNRFGSTNEAGIFEMVEQGLKPVENPSAALLSERQVSDGSIVLATMEGSRPILVEVQALVNPTSYGYPKRAASGFDLNRLNLLVAMLERRTKLKLGEHDIYINIVGGIQIREPAADLAICLAIGSAAKGLQLKKNSVVFGEVGLSGEVRHVPFAEKRLAEAKKLGFDGAIGPQQKAGKKLTGLNGVADVRSALNQFLEKD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
44 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
109 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
110 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
114 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
115 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
116 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
117 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
118 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
119 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
120 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
128 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
129 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
130 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
131 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.14
Nodule 0
Rhizoplane 0
Rhizosphere 69.38
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006432 3300001979 Unclassified 4867
2 JGI24737J22298_10000026 3300001990 Bacteria 43680
3 JGI24735J21928_10000080 3300002067 Bacteria 37384
4 JGI24742J22300_10000011 3300002244 Bacteria 31137
5 rootH2_10000244 3300003320 Bacteria 697651
6 Ga0070658_10000012 3300005327 Bacteria 277871
7 Ga0070658_10000015 3300005327 Bacteria 230579
8 Ga0070658_10000491 3300005327 Bacteria 34335
9 Ga0070658_10002757 3300005327 Bacteria 14623
10 Ga0070658_10121414 3300005327 Bacteria 2171
11 Ga0070676_10001049 3300005328 Bacteria 13753
12 Ga0070676_10031204 3300005328 Unclassified 3044
13 Ga0070683_100000138 3300005329 Bacteria 47210
14 Ga0070683_100000261 3300005329 Bacteria 36323
15 Ga0070690_100000942 3300005330 Bacteria 14855
16 Ga0070680_100064809 3300005336 Bacteria 2994
17 Ga0070682_100004111 3300005337 Bacteria 8068
18 Ga0070660_100000341 3300005339 Bacteria 31056
19 Ga0070660_100002064 3300005339 Bacteria 13866
20 Ga0070660_100021243 3300005339 Unclassified 4784
21 Ga0070674_100050327 3300005356 Unclassified 2868
22 Ga0070673_100000224 3300005364 Bacteria 28378
23 Ga0070659_100001500 3300005366 Bacteria 16817
24 Ga0070667_100000001 3300005367 Bacteria 1108638
25 Ga0070667_100003189 3300005367 Bacteria 14048
26 Ga0070678_100000234 3300005456 Bacteria 25286
27 Ga0070681_10014636 3300005458 Bacteria 7804
28 Ga0070685_10005210 3300005466 Bacteria 6593
29 Ga0070679_100043465 3300005530 Bacteria 4476
30 Ga0070679_100245449 3300005530 Unclassified 1747
31 Ga0070684_100001437 3300005535 Bacteria 17157
32 Ga0070665_100057522 3300005548 Unclassified 3898
33 Ga0068855_100000003 3300005563 Bacteria 589862
34 Ga0068855_100001675 3300005563 Bacteria 27736
35 Ga0068855_100003159 3300005563 Bacteria 20166
36 Ga0068855_100147729 3300005563 Unclassified 2674
37 Ga0068857_100000002 3300005577 Bacteria 241401
38 Ga0068863_100031374 3300005841 Bacteria 5071
39 Ga0081455_10000003 3300005937 Bacteria 367763
40 Ga0075365_10000043 3300006038 Bacteria 41148
41 Ga0075365_10000754 3300006038 Bacteria 13136
42 Ga0075365_10021422 3300006038 Unclassified 4033
43 Ga0075365_10036372 3300006038 Bacteria 3190
44 Ga0075363_100000118 3300006048 Bacteria 18520
45 Ga0075364_10002471 3300006051 Bacteria 10346
46 Ga0075362_10011321 3300006177 Bacteria 3512
47 Ga0075362_10015894 3300006177 Bacteria 3070
48 Ga0075369_10000005 3300006186 Bacteria 147699
49 Ga0075369_10000108 3300006186 Bacteria 22404
50 Ga0075366_10000001 3300006195 Bacteria 569172
51 Ga0075366_10000171 3300006195 Bacteria 27869
52 Ga0075366_10000347 3300006195 Bacteria 21166
53 Ga0075366_10000501 3300006195 Bacteria 18164
54 Ga0097621_100000370 3300006237 Bacteria 31223
55 Ga0075370_10005535 3300006353 Bacteria 6293
56 Ga0068871_100000156 3300006358 Bacteria 45103
57 Ga0105240_10060329 3300009093 Unclassified 4729
58 Ga0105240_10075013 3300009093 Unclassified 4173
59 Ga0111539_10001909 3300009094 Bacteria 27751
60 Ga0105245_10000001 3300009098 Bacteria 939270
61 Ga0105245_10000002 3300009098 Bacteria 634374
62 Ga0105245_10086058 3300009098 Bacteria 2882
63 Ga0105245_10155581 3300009098 Bacteria 2165
64 Ga0105241_10000003 3300009174 Bacteria 839043
65 Ga0105241_10001167 3300009174 Bacteria 19988
66 Ga0105242_10004190 3300009176 Bacteria 11242
67 Ga0105238_10005116 3300009551 Bacteria 12969
68 Ga0105249_10000802 3300009553 Bacteria 28271
69 Ga0105033_100811 3300009986 Unclassified 2458
70 Ga0105028_100867 3300009993 Unclassified 3216
71 Ga0105239_10024936 3300010375 Bacteria 6587
72 Ga0105239_10048062 3300010375 Bacteria 4677
73 Ga0157373_10000042 3300013100 Bacteria 113564
74 Ga0157371_10001081 3300013102 Bacteria 29510
75 Ga0157369_10000945 3300013105 Bacteria 36893
76 Ga0157369_10016785 3300013105 Bacteria 8229
77 Ga0157369_10076894 3300013105 Bacteria 3578
78 Ga0157374_10000031 3300013296 Bacteria 204840
79 Ga0157374_10000195 3300013296 Bacteria 56142
80 Ga0157374_10000945 3300013296 Bacteria 25227
81 Ga0157374_10034833 3300013296 Bacteria 4602
82 Ga0157377_10017866 3300014745 Bacteria 3677
83 Ga0207680_10019414 3300025903 Bacteria 3635
84 Ga0207647_10000506 3300025904 Bacteria 31217
85 Ga0207645_10001659 3300025907 Bacteria 18129
86 Ga0207645_10059943 3300025907 Unclassified 2431
87 Ga0207705_10000011 3300025909 Bacteria 517768
88 Ga0207705_10000056 3300025909 Bacteria 157554
89 Ga0207705_10001580 3300025909 Bacteria 18100
90 Ga0207654_10000002 3300025911 Bacteria 1460142
91 Ga0207654_10000623 3300025911 Bacteria 20022
92 Ga0207707_10002145 3300025912 Bacteria 17855
93 Ga0207695_10054691 3300025913 Unclassified 4165
94 Ga0207695_10249184 3300025913 Unclassified 1676
95 Ga0207660_10186508 3300025917 Unclassified 1613
96 Ga0207657_10000931 3300025919 Bacteria 30961
97 Ga0207657_10004217 3300025919 Bacteria 15225
98 Ga0207652_10023233 3300025921 Bacteria 5134
99 Ga0207652_10174948 3300025921 Bacteria 1927
100 Ga0207687_10000001 3300025927 Bacteria 1130810
101 Ga0207687_10000030 3300025927 Bacteria 155548
102 Ga0207661_10000021 3300025944 Bacteria 205381
103 Ga0207661_10006449 3300025944 Bacteria 8296
104 Ga0207667_10000008 3300025949 Bacteria 625138
105 Ga0207667_10008376 3300025949 Bacteria 12286
106 Ga0207667_10012679 3300025949 Bacteria 9686
107 Ga0207651_10000167 3300025960 Bacteria 28415
108 Ga0207712_10004288 3300025961 Bacteria 9001
109 Ga0207658_10000003 3300025986 Bacteria 1151934
110 Ga0207674_10000001 3300026116 Bacteria 616581
111 Ga0207674_10067938 3300026116 Bacteria 3587
112 Ga0209813_10000004 3300027866 Bacteria 139340
113 Ga0268266_10070487 3300028379 Unclassified 3029
114 Ga0265334_10000184 3300028573 Bacteria 36597
115 Ga0265338_10000192 3300028800 Bacteria 115195
116 Ga0265338_10000601 3300028800 Bacteria 63282
117 Ga0265327_10002516 3300031251 Bacteria 19138
118 Ga0265327_10007594 3300031251 Bacteria 8324
119 Ga0395900_0000232 3300037418 Bacteria 87268
120 Ga0395900_0001560 3300037418 Bacteria 27209
121 Ga0395900_0033105 3300037418 Bacteria 5320
122 Ga0395898_0003425 3300037466 Bacteria 17764
123 Ga0395898_0107647 3300037466 Bacteria 2673
124 Ga0395905_0000238 3300037471 Bacteria 83164
125 Ga0395905_0003963 3300037471 Bacteria 15579
126 Ga0395905_0066571 3300037471 Unclassified 3374
127 Ga0395905_0184464 3300037471 Unclassified 1959
128 Ga0395901_0012871 3300038443 Bacteria 8484
129 Ga0395901_0049452 3300038443 Bacteria 4368
130 Ga0395901_0110464 3300038443 Bacteria 2886
131 Ga0395901_0363783 3300038443 Bacteria 1491
132 Ga0495629_0011007 3300046459 Bacteria 6569
133 Ga0495583_0012043 3300046506 Bacteria 4925
134 Ga0495622_0000082 3300046557 Bacteria 85266
135 Ga0495588_0000116 3300046674 Bacteria 135919
136 Ga0495658_0002992 3300046683 Bacteria 8461
137 Ga0495600_0006475 3300046809 Bacteria 7129
138 Ga0495672_0078067 3300047320 Bacteria 1853
139 Ga0495676_0145791 3300047321 Bacteria 1691
140 Ga0501032_0002152 3300049569 Bacteria 15515
141 Ga0501033_0125553 3300049570 Bacteria 1861
142 Ga0501034_0002756 3300049571 Bacteria 20637
143 Ga0501034_0106405 3300049571 Bacteria 2798
144 Ga0501034_0163521 3300049571 Bacteria 2195
145 Ga0501036_0011701 3300049572 Bacteria 7271
146 Ga0501036_0122617 3300049572 Bacteria 2195
147 Ga0501037_0026967 3300049573 Bacteria 4244
148 Ga0501042_0019841 3300049578 Bacteria 4674
149 Ga0501043_0017889 3300049579 Bacteria 5558
150 Ga0501046_0000038 3300049580 Bacteria 159193
151 Ga0501046_0068683 3300049580 Bacteria 2758
152 Ga0501047_0000229 3300049581 Bacteria 66412
153 Ga0501047_0007808 3300049581 Bacteria 10074
154 Ga0501048_0000033 3300049582 Bacteria 64896
155 Ga0501048_0085020 3300049582 Bacteria 2231
156 Ga0501070_0013568 3300049586 Bacteria 6868
157 Ga0501070_0109938 3300049586 Bacteria 2278
158 Ga0501083_0018960 3300049744 Bacteria 4789
159 Ga0501083_0207923 3300049744 Bacteria 1276
160 Ga0501035_0000033 3300049822 Bacteria 175087
161 Ga0501044_0014829 3300049823 Bacteria 8402
162 nmdc:mga03683_20_c1 3300050489 Bacteria 6354
163 nmdc:mga03683_544_c2 3300050489 Bacteria 4218
164 nmdc:mga03n38_44_c1 3300050490 Bacteria 26398
165 nmdc:mga00v17_11084_c1 3300050491 Bacteria 4945
166 nmdc:mga00v17_2780_c2 3300050491 Bacteria 6418
167 nmdc:mga0yw44_29534_c1 3300050492 Unclassified 3165
168 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
169 nmdc:mga0yw44_36948_c1 3300050492 Bacteria 2881
170 nmdc:mga0yw44_87918_c1 3300050492 Bacteria 1959
171 nmdc:mga0yw44_885_c1 3300050492 Bacteria 11271
172 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
173 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
174 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
175 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
176 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
177 nmdc:mga07m45_12558_c1 3300050496 Bacteria 4479
178 nmdc:mga08y16_1132_c1 3300050511 Bacteria 26248
179 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
180 nmdc:mga0sz30_8_c2 3300050516 Bacteria 48225
181 Ga0500610_0000001 3300053079 Bacteria 185468
182 Ga0500643_000010 3300053087 Bacteria 408084
183 Ga0500644_0001591 3300053088 Bacteria 5942
184 Ga0500644_0026833 3300053088 Bacteria 1786
185 Ga0500583_0001319 3300053092 Bacteria 7086
186 Ga0500651_0000045 3300053093 Bacteria 85481
187 Ga0500566_0000001 3300053094 Bacteria 1101031
188 Ga0500650_0000001 3300053098 Bacteria 818797
189 Ga0500555_000001 3300053103 Bacteria 1353713
190 Ga0500555_000002 3300053103 Bacteria 1314346
191 Ga0500556_0000295 3300053104 Bacteria 38375
192 Ga0500562_000002 3300053108 Bacteria 977234
193 Ga0500593_000001 3300053117 Bacteria 784404
194 Ga0500594_0000001 3300053118 Bacteria 1178472
195 Ga0500594_0001130 3300053118 Bacteria 5742
196 Ga0500614_000001 3300053123 Bacteria 1274484
197 Ga0500614_000280 3300053123 Bacteria 13247
198 Ga0500628_000012 3300053129 Bacteria 106556
199 Ga0500628_002247 3300053129 Bacteria 3221
200 Ga0500652_000020 3300053131 Bacteria 119198
201 Ga0500655_000373 3300053133 Bacteria 9721
202 Ga0500561_0000001 3300053137 Bacteria 957685
203 Ga0500568_0022057 3300053139 Bacteria 2731
204 Ga0500577_0005603 3300053142 Unclassified 3399
205 Ga0500577_0012935 3300053142 Bacteria 2536
206 Ga0500579_054037 3300053143 Bacteria 2435
207 Ga0500589_000016 3300053147 Bacteria 107090
208 Ga0500633_0030034 3300053160 Bacteria 1744
209 Ga0500649_000013 3300053722 Bacteria 73694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0001591 Ga0500644_0001591_3864_5012 378
2 3300053129 Ga0500628_000012 Ga0500628_000012_68873_70021 378
3 3300053093 Ga0500651_0000045 Ga0500651_0000045_1398_2549 379
4 3300053123 Ga0500614_000280 Ga0500614_000280_10837_11988 379
5 3300046674 Ga0495588_0000116 Ga0495588_0000116_73947_75119 390
6 3300047321 Ga0495676_0145791 Ga0495676_0145791_186_1358 390
7 3300053722 Ga0500649_000013 Ga0500649_000013_20557_21729 390
8 3300009993 Ga0105028_100867 Ga0105028_1008672 393
9 3300006051 Ga0075364_10002471 Ga0075364_100024715 399
10 3300053129 Ga0500628_002247 Ga0500628_002247_1589_2842 401
11 3300006195 Ga0075366_10000171 Ga0075366_1000017113 402
12 3300038443 Ga0395901_0110464 Ga0395901_0110464_272_1504 404
13 3300009176 Ga0105242_10004190 Ga0105242_100041902 407
14 3300009551 Ga0105238_10005116 Ga0105238_100051162 407
15 3300005330 Ga0070690_100000942 Ga0070690_1000009422 410
16 3300025921 Ga0207652_10174948 Ga0207652_101749482 410
17 3300025944 Ga0207661_10000021 Ga0207661_10000021111 410
18 3300009553 Ga0105249_10000802 Ga0105249_1000080216 412
19 3300025961 Ga0207712_10004288 Ga0207712_100042883 412
20 3300038443 Ga0395901_0363783 Ga0395901_0363783_104_1360 412
21 3300053118 Ga0500594_0001130 Ga0500594_0001130_3036_4286 412
22 3300006195 Ga0075366_10000347 Ga0075366_100003472 413
23 3300049744 Ga0501083_0207923 Ga0501083_0207923_14_1261 415
24 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_749_2005 418
25 3300006038 Ga0075365_10000043 Ga0075365_1000004331 419
26 3300037418 Ga0395900_0001560 Ga0395900_0001560_3616_4911 419
27 3300037466 Ga0395898_0003425 Ga0395898_0003425_5462_6757 419
28 3300037471 Ga0395905_0184464 Ga0395905_0184464_306_1601 419
29 3300038443 Ga0395901_0049452 Ga0395901_0049452_2927_4222 419
30 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_250019_251278 419
31 3300028573 Ga0265334_10000184 Ga0265334_1000018416 421
32 3300028800 Ga0265338_10000192 Ga0265338_10000192101 421
33 3300053147 Ga0500589_000016 Ga0500589_000016_73845_75110 421
34 3300050491 nmdc:mga00v17_11084_c1 nmdc:mga00v17_11084_c1_3216_4520 422
35 3300005327 Ga0070658_10000491 Ga0070658_1000049128 423
36 3300013296 Ga0157374_10000195 Ga0157374_1000019526 425
37 3300049570 Ga0501033_0125553 Ga0501033_0125553_72_1421 432
38 3300049571 Ga0501034_0163521 Ga0501034_0163521_164_1513 432
39 3300049572 Ga0501036_0122617 Ga0501036_0122617_611_1960 432
40 3300049581 Ga0501047_0000229 Ga0501047_0000229_28715_30064 432
41 3300049582 Ga0501048_0085020 Ga0501048_0085020_697_2046 432
42 3300049822 Ga0501035_0000033 Ga0501035_0000033_126759_128108 432
43 3300002244 JGI24742J22300_10000011 JGI24742J22300_100000115 434
44 3300005328 Ga0070676_10001049 Ga0070676_100010495 434
45 3300025907 Ga0207645_10001659 Ga0207645_100016595 434
46 3300049578 Ga0501042_0019841 Ga0501042_0019841_674_1978 434
47 3300050492 nmdc:mga0yw44_885_c1 nmdc:mga0yw44_885_c1_3135_4448 434
48 3300005327 Ga0070658_10002757 Ga0070658_100027574 435
49 3300050492 nmdc:mga0yw44_29534_c1 nmdc:mga0yw44_29534_c1_1599_2969 435
50 3300053087 Ga0500643_000010 Ga0500643_000010_376412_377728 435
51 3300053103 Ga0500555_000001 Ga0500555_000001_729006_730316 435
52 3300009174 Ga0105241_10001167 Ga0105241_100011672 436
53 3300025911 Ga0207654_10000623 Ga0207654_100006232 436
54 3300037418 Ga0395900_0033105 Ga0395900_0033105_3198_4508 436
55 3300053108 Ga0500562_000002 Ga0500562_000002_882098_883408 436
56 3300009098 Ga0105245_10155581 Ga0105245_101555811 437
57 3300003320 rootH2_10000244 rootH2_10000244400 438
58 3300005367 Ga0070667_100003189 Ga0070667_10000318912 438
59 3300005327 Ga0070658_10121414 Ga0070658_101214142 439
60 3300005327 Ga0070658_10000015 Ga0070658_1000001564 442
61 3300013296 Ga0157374_10000945 Ga0157374_100009452 442
62 3300014745 Ga0157377_10017866 Ga0157377_100178662 442
63 3300025909 Ga0207705_10000011 Ga0207705_10000011281 442
64 3300005327 Ga0070658_10000012 Ga0070658_10000012293 443
65 3300005328 Ga0070676_10031204 Ga0070676_100312042 443
66 3300005339 Ga0070660_100021243 Ga0070660_1000212432 443
67 3300005356 Ga0070674_100050327 Ga0070674_1000503272 443
68 3300005364 Ga0070673_100000224 Ga0070673_10000022422 443
69 3300005456 Ga0070678_100000234 Ga0070678_10000023415 443
70 3300005466 Ga0070685_10005210 Ga0070685_100052104 443
71 3300005548 Ga0070665_100057522 Ga0070665_1000575222 443
72 3300010375 Ga0105239_10048062 Ga0105239_100480623 443
73 3300013102 Ga0157371_10001081 Ga0157371_100010812 443
74 3300025907 Ga0207645_10059943 Ga0207645_100599432 443
75 3300025909 Ga0207705_10000056 Ga0207705_10000056131 443
76 3300025960 Ga0207651_10000167 Ga0207651_1000016721 443
77 3300028379 Ga0268266_10070487 Ga0268266_100704872 443
78 3300005563 Ga0068855_100000003 Ga0068855_10000000398 446
79 3300005563 Ga0068855_100003159 Ga0068855_10000315911 446
80 3300009174 Ga0105241_10000003 Ga0105241_10000003204 446
81 3300013105 Ga0157369_10000945 Ga0157369_1000094530 446
82 3300025911 Ga0207654_10000002 Ga0207654_100000021005 446
83 3300025949 Ga0207667_10000008 Ga0207667_1000000897 446
84 3300025949 Ga0207667_10012679 Ga0207667_100126797 446
85 3300028800 Ga0265338_10000601 Ga0265338_1000060148 446
86 3300053117 Ga0500593_000001 Ga0500593_000001_597106_598452 446
87 3300005329 Ga0070683_100000138 Ga0070683_10000013833 447
88 3300005535 Ga0070684_100001437 Ga0070684_1000014372 447
89 3300001990 JGI24737J22298_10000026 JGI24737J22298_100000267 448
90 3300002067 JGI24735J21928_10000080 JGI24735J21928_100000807 448
91 3300005336 Ga0070680_100064809 Ga0070680_1000648092 448
92 3300005337 Ga0070682_100004111 Ga0070682_1000041113 448
93 3300005339 Ga0070660_100002064 Ga0070660_1000020642 448
94 3300005366 Ga0070659_100001500 Ga0070659_1000015002 448
95 3300005458 Ga0070681_10014636 Ga0070681_100146364 448
96 3300005530 Ga0070679_100043465 Ga0070679_1000434652 448
97 3300005563 Ga0068855_100001675 Ga0068855_10000167510 448
98 3300005563 Ga0068855_100147729 Ga0068855_1001477291 448
99 3300005577 Ga0068857_100000002 Ga0068857_1000000028 448
100 3300005841 Ga0068863_100031374 Ga0068863_1000313742 448
101 3300009093 Ga0105240_10075013 Ga0105240_100750132 448
102 3300009098 Ga0105245_10000001 Ga0105245_10000001372 448
103 3300013105 Ga0157369_10016785 Ga0157369_100167855 448
104 3300013105 Ga0157369_10076894 Ga0157369_100768942 448
105 3300013296 Ga0157374_10034833 Ga0157374_100348333 448
106 3300025909 Ga0207705_10001580 Ga0207705_100015802 448
107 3300025912 Ga0207707_10002145 Ga0207707_1000214513 448
108 3300025913 Ga0207695_10249184 Ga0207695_102491842 448
109 3300025917 Ga0207660_10186508 Ga0207660_101865081 448
110 3300025919 Ga0207657_10004217 Ga0207657_1000421710 448
111 3300025921 Ga0207652_10023233 Ga0207652_100232332 448
112 3300025927 Ga0207687_10000030 Ga0207687_1000003067 448
113 3300025949 Ga0207667_10008376 Ga0207667_100083762 448
114 3300026116 Ga0207674_10000001 Ga0207674_10000001433 448
115 3300026116 Ga0207674_10067938 Ga0207674_100679382 448
116 3300046506 Ga0495583_0012043 Ga0495583_0012043_1365_2714 448
117 3300049571 Ga0501034_0106405 Ga0501034_0106405_964_2328 448
118 3300049586 Ga0501070_0109938 Ga0501070_0109938_402_1748 448
119 3300053088 Ga0500644_0026833 Ga0500644_0026833_261_1625 448
120 3300053092 Ga0500583_0001319 Ga0500583_0001319_695_2059 448
121 3300053098 Ga0500650_0000001 Ga0500650_0000001_445487_446851 448
122 3300053118 Ga0500594_0000001 Ga0500594_0000001_1106564_1107928 448
123 3300053133 Ga0500655_000373 Ga0500655_000373_686_2050 448
124 3300053142 Ga0500577_0005603 Ga0500577_0005603_559_1923 448
125 3300053143 Ga0500579_054037 Ga0500579_054037_310_1674 448
126 3300053160 Ga0500633_0030034 Ga0500633_0030034_210_1574 448
127 3300005339 Ga0070660_100000341 Ga0070660_1000003413 449
128 3300005530 Ga0070679_100245449 Ga0070679_1002454492 449
129 3300005937 Ga0081455_10000003 Ga0081455_10000003324 449
130 3300006186 Ga0075369_10000005 Ga0075369_1000000594 449
131 3300006186 Ga0075369_10000108 Ga0075369_1000010821 449
132 3300006195 Ga0075366_10000001 Ga0075366_10000001419 449
133 3300009094 Ga0111539_10001909 Ga0111539_1000190919 449
134 3300009098 Ga0105245_10086058 Ga0105245_100860582 449
135 3300025919 Ga0207657_10000931 Ga0207657_100009313 449
136 3300031251 Ga0265327_10007594 Ga0265327_100075943 449
137 3300037418 Ga0395900_0000232 Ga0395900_0000232_14659_16008 449
138 3300037466 Ga0395898_0107647 Ga0395898_0107647_1244_2623 449
139 3300037471 Ga0395905_0000238 Ga0395905_0000238_25813_27180 449
140 3300037471 Ga0395905_0003963 Ga0395905_0003963_10968_12347 449
141 3300037471 Ga0395905_0066571 Ga0395905_0066571_1003_2352 449
142 3300038443 Ga0395901_0012871 Ga0395901_0012871_402_1781 449
143 3300049569 Ga0501032_0002152 Ga0501032_0002152_11567_12916 449
144 3300049571 Ga0501034_0002756 Ga0501034_0002756_7428_8777 449
145 3300049572 Ga0501036_0011701 Ga0501036_0011701_1534_2883 449
146 3300049573 Ga0501037_0026967 Ga0501037_0026967_310_1659 449
147 3300049579 Ga0501043_0017889 Ga0501043_0017889_1071_2420 449
148 3300049580 Ga0501046_0000038 Ga0501046_0000038_152755_154104 449
149 3300049580 Ga0501046_0068683 Ga0501046_0068683_961_2310 449
150 3300049581 Ga0501047_0007808 Ga0501047_0007808_6471_7820 449
151 3300049582 Ga0501048_0000033 Ga0501048_0000033_10459_11808 449
152 3300049586 Ga0501070_0013568 Ga0501070_0013568_159_1508 449
153 3300049744 Ga0501083_0018960 Ga0501083_0018960_1750_3108 449
154 3300049823 Ga0501044_0014829 Ga0501044_0014829_5603_6952 449
155 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_695295_696644 449
156 3300050511 nmdc:mga08y16_1132_c1 nmdc:mga08y16_1132_c1_3878_5227 449
157 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_242117_243466 449
158 3300050516 nmdc:mga0sz30_8_c2 nmdc:mga0sz30_8_c2_45059_46408 449
159 3300053104 Ga0500556_0000295 Ga0500556_0000295_9363_10712 449
160 3300053142 Ga0500577_0012935 Ga0500577_0012935_468_1817 449
161 3300006038 Ga0075365_10000754 Ga0075365_100007544 450
162 3300006048 Ga0075363_100000118 Ga0075363_10000011817 450
163 3300006353 Ga0075370_10005535 Ga0075370_100055352 450
164 3300027866 Ga0209813_10000004 Ga0209813_10000004131 450
165 3300031251 Ga0265327_10002516 Ga0265327_1000251615 450
166 3300046459 Ga0495629_0011007 Ga0495629_0011007_2509_3861 450
167 3300046557 Ga0495622_0000082 Ga0495622_0000082_8812_10164 450
168 3300046683 Ga0495658_0002992 Ga0495658_0002992_1560_2912 450
169 3300046809 Ga0495600_0006475 Ga0495600_0006475_3670_5022 450
170 3300047320 Ga0495672_0078067 Ga0495672_0078067_195_1547 450
171 3300050490 nmdc:mga03n38_44_c1 nmdc:mga03n38_44_c1_15282_16634 450
172 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_82681_84033 450
173 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_15388_16740 450
174 3300050496 nmdc:mga07m45_12558_c1 nmdc:mga07m45_12558_c1_1110_2462 450
175 3300053079 Ga0500610_0000001 Ga0500610_0000001_96509_97861 450
176 3300053094 Ga0500566_0000001 Ga0500566_0000001_636301_637653 450
177 3300053103 Ga0500555_000002 Ga0500555_000002_513026_514378 450
178 3300053131 Ga0500652_000020 Ga0500652_000020_1076_2428 450
179 3300053139 Ga0500568_0022057 Ga0500568_0022057_1301_2662 450
180 3300005367 Ga0070667_100000001 Ga0070667_100000001763 451
181 3300006038 Ga0075365_10021422 Ga0075365_100214223 451
182 3300006038 Ga0075365_10036372 Ga0075365_100363722 451
183 3300006177 Ga0075362_10015894 Ga0075362_100158943 451
184 3300006195 Ga0075366_10000501 Ga0075366_100005014 451
185 3300006237 Ga0097621_100000370 Ga0097621_1000003703 451
186 3300006358 Ga0068871_100000156 Ga0068871_10000015640 451
187 3300009098 Ga0105245_10000002 Ga0105245_10000002216 451
188 3300009986 Ga0105033_100811 Ga0105033_1008112 451
189 3300013296 Ga0157374_10000031 Ga0157374_10000031156 451
190 3300025903 Ga0207680_10019414 Ga0207680_100194142 451
191 3300025904 Ga0207647_10000506 Ga0207647_1000050620 451
192 3300025927 Ga0207687_10000001 Ga0207687_10000001995 451
193 3300025986 Ga0207658_10000003 Ga0207658_10000003616 451
194 3300050489 nmdc:mga03683_544_c2 nmdc:mga03683_544_c2_1300_2655 451
195 3300050491 nmdc:mga00v17_2780_c2 nmdc:mga00v17_2780_c2_3379_4734 451
196 3300050492 nmdc:mga0yw44_36948_c1 nmdc:mga0yw44_36948_c1_998_2353 451
197 3300050492 nmdc:mga0yw44_87918_c1 nmdc:mga0yw44_87918_c1_37_1392 451
198 3300053123 Ga0500614_000001 Ga0500614_000001_272855_274210 451
199 3300006177 Ga0075362_10011321 Ga0075362_100113213 452
200 3300010375 Ga0105239_10024936 Ga0105239_100249362 452
201 3300050489 nmdc:mga03683_20_c1 nmdc:mga03683_20_c1_3665_5023 452
202 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_54265_55623 452
203 3300053137 Ga0500561_0000001 Ga0500561_0000001_578368_579729 453
204 3300001979 JGI24740J21852_10006432 JGI24740J21852_100064322 455
205 3300005329 Ga0070683_100000261 Ga0070683_10000026123 455
206 3300009093 Ga0105240_10060329 Ga0105240_100603293 455
207 3300013100 Ga0157373_10000042 Ga0157373_1000004249 455
208 3300025913 Ga0207695_10054691 Ga0207695_100546912 455
209 3300025944 Ga0207661_10006449 Ga0207661_100064493 455

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

19

46

0.98

PF13541

ChlI

Subunit ChlI of Mg-chelatase

341

434

0.91

PF06745

ATPase

KaiC

79

157

0.9

PF13481

AAA_25

AAA domain

67

228

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzb-assembly1.cif.gz_B lipopolysaccharide assembly protein lapb (open) 0.9204 8 38
5lkq-assembly1.cif.gz_B protease domain of rada 0.9118 281 450
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9114 287 452
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9003 287 452
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.8825 290 453
ID Description Score Start End Superfamily
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 69 275 3.40.50.300
af_P9WHJ9_62_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 68 275 3.40.50.300
af_F4K8X8_240_443_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9548 80 277 3.40.50.300
af_P9WHJ9_288_461_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9385 292 449 3.30.230.10
af_P9WHJ9_62_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9323 68 275 3.40.50.300
ID Description Score Start End GO Terms
AF-T1A795-F1-model_v4 DNA repair protein RadA 0.9819 306 397 GO:0000725
GO:0005829
AF-A0A3S5EYQ2-F1-model_v4 deleted 0.9759 297 380
AF-W1XIA3-F1-model_v4 DNA repair protein RadA 0.9755 296 404 GO:0000725
GO:0005829
AF-A0A2G6C7D6-F1-model_v4 DNA repair protein RadA 0.9726 325 452 GO:0000725
GO:0005829
AF-A0A7W4HUD1-F1-model_v4 DNA repair protein RadA 0.9664 304 453 GO:0000725
GO:0005829

Feature Viewer

pLDDT pTM Quality
80.33 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map