F319252

General Info

Members Datasets Scaffolds Average Seq Length
209 158 207 108

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10642839|Ga0307509_106428391
Length 119
Sequence MPKQKLSKAVGEGQIMDAFQVIADPGRRQMLALLYKKSLTINALAENFDMSRPAVSKHVKILYSAGFISIQDIGRERHCILKQDGFRQLQEWINYFDGFWQNKLGKLEKLLSEKKSANN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
150 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 1.44
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.35
Nodule 0
Rhizoplane 1.44
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1005373 3300002741 Bacteria 2102
2 JGI25164J39214_1003120 3300002772 Bacteria 2205
3 JGI25159J45721_1013718 3300002987 Unclassified 1862
4 JGI25165J46597_1001507 3300003214 Bacteria 11842
5 rootH1_10010057 3300003316 Bacteria 9661
6 rootH2_10034182 3300003320 Bacteria 51191
7 rootH2_10072926 3300003320 Bacteria 1143
8 rootH2_10089447 3300003320 Bacteria 4958
9 rootL2_10261082 3300003322 Bacteria 3547
10 rootH1_10008609 3300003323 Bacteria 127787
11 rootH1_10329357 3300003323 Unclassified 1306
12 rootH1_10355361 3300003323 Bacteria 3815
13 JGI25160J50197_1025916 3300003354 Unclassified 1627
14 Ga0065714_10028026 3300005288 Bacteria 1368
15 Ga0065715_10187722 3300005293 Unclassified 1420
16 Ga0070683_101049563 3300005329 Bacteria 782
17 Ga0070666_10030939 3300005335 Unclassified 3530
18 Ga0070668_100161863 3300005347 Bacteria 1816
19 Ga0070669_100892371 3300005353 Unclassified 759
20 Ga0070659_100558710 3300005366 Bacteria 980
21 Ga0070700_101200234 3300005441 Unclassified 633
22 Ga0070678_100437357 3300005456 Bacteria 1143
23 Ga0070679_100641326 3300005530 Unclassified 1005
24 Ga0068853_100227254 3300005539 Unclassified 1706
25 Ga0068853_101205633 3300005539 Unclassified 731
26 Ga0068853_102344000 3300005539 Bacteria 517
27 Ga0070665_100000008 3300005548 Bacteria 606341
28 Ga0068855_100000622 3300005563 Bacteria 43596
29 Ga0068855_100045391 3300005563 Bacteria 5198
30 Ga0068855_100116517 3300005563 Bacteria 3062
31 Ga0070664_100896682 3300005564 Unclassified 831
32 Ga0068856_100000108 3300005614 Bacteria 81559
33 Ga0068856_100179496 3300005614 Bacteria 2130
34 Ga0068852_100190669 3300005616 Bacteria 1934
35 Ga0068852_100228741 3300005616 Bacteria 1772
36 Ga0068852_100325755 3300005616 Bacteria 1493
37 Ga0068861_100580416 3300005719 Bacteria 1026
38 Ga0068861_100614938 3300005719 Unclassified 999
39 Ga0068858_100096142 3300005842 Bacteria 2760
40 Ga0068860_100000029 3300005843 Bacteria 259192
41 Ga0068860_102098790 3300005843 Unclassified 586
42 Ga0075366_10247709 3300006195 Bacteria 1087
43 Ga0068871_100009714 3300006358 Bacteria 6985
44 Ga0105240_10000269 3300009093 Bacteria 102625
45 Ga0105240_10662082 3300009093 Bacteria 1143
46 Ga0105240_10677628 3300009093 Bacteria 1128
47 Ga0105241_10089180 3300009174 Bacteria 2429
48 Ga0105241_10181066 3300009174 Bacteria 1748
49 Ga0105241_10189562 3300009174 Bacteria 1711
50 Ga0105242_11375300 3300009176 Bacteria 732
51 Ga0105237_11441585 3300009545 Bacteria 695
52 Ga0105238_10022472 3300009551 Bacteria 6428
53 Ga0105238_10361548 3300009551 Bacteria 1441
54 Ga0105249_10070562 3300009553 Unclassified 3225
55 Ga0105249_10439649 3300009553 Bacteria 1341
56 Ga0105239_10000068 3300010375 Bacteria 144666
57 Ga0105239_11320184 3300010375 Bacteria 832
58 Ga0157371_10267531 3300013102 Bacteria 1233
59 Ga0157370_10352465 3300013104 Bacteria 1356
60 Ga0157369_10348887 3300013105 Bacteria 1537
61 Ga0157369_11711132 3300013105 Bacteria 639
62 Ga0157374_10052376 3300013296 Bacteria 3801
63 Ga0157374_10895650 3300013296 Unclassified 905
64 Ga0157378_11312617 3300013297 Unclassified 765
65 Ga0163162_10023324 3300013306 Bacteria 6107
66 Ga0157372_10081756 3300013307 Bacteria 3657
67 Ga0157372_10081817 3300013307 Bacteria 3655
68 Ga0157372_10142094 3300013307 Bacteria 2766
69 Ga0157375_12241488 3300013308 Unclassified 651
70 Ga0163163_10100872 3300014325 Bacteria 2909
71 Ga0157379_10194423 3300014968 Unclassified 1833
72 Ga0157379_11167273 3300014968 Bacteria 740
73 Ga0206352_10211512 3300020078 Bacteria 1268
74 Ga0206350_10977495 3300020080 Bacteria 675
75 Ga0213876_10653988 3300021384 Bacteria 559
76 Ga0224712_10117009 3300022467 Bacteria 1150
77 Ga0209436_103765 3300025208 Unclassified 3919
78 Ga0207427_100268 3300025231 Bacteria 39724
79 Ga0209437_100008 3300025233 Bacteria 921142
80 Ga0209437_100030 3300025233 Bacteria 532466
81 Ga0209026_1000991 3300025250 Bacteria 14111
82 Ga0209129_1002627 3300025258 Bacteria 8545
83 Ga0209233_1000024 3300025261 Bacteria 695418
84 Ga0209130_1001099 3300025284 Bacteria 20092
85 Ga0207426_1000096 3300025302 Bacteria 271627
86 Ga0207642_10351206 3300025899 Bacteria 870
87 Ga0207680_10017109 3300025903 Unclassified 3824
88 Ga0207654_10003979 3300025911 Bacteria 7440
89 Ga0207654_10284771 3300025911 Bacteria 1119
90 Ga0207695_10000244 3300025913 Bacteria 141138
91 Ga0207695_10132260 3300025913 Bacteria 2451
92 Ga0207695_10172380 3300025913 Bacteria 2088
93 Ga0207695_11727647 3300025913 Bacteria 507
94 Ga0207671_10005833 3300025914 Bacteria 11190
95 Ga0207671_10007117 3300025914 Bacteria 9773
96 Ga0207671_10028137 3300025914 Bacteria 4202
97 Ga0207681_11563919 3300025923 Bacteria 552
98 Ga0207694_10331258 3300025924 Bacteria 1258
99 Ga0207694_10380999 3300025924 Bacteria 1171
100 Ga0207706_10923589 3300025933 Bacteria 736
101 Ga0207686_11040336 3300025934 Bacteria 666
102 Ga0207689_10896991 3300025942 Bacteria 748
103 Ga0207661_10469190 3300025944 Bacteria 1148
104 Ga0207667_10000420 3300025949 Bacteria 57190
105 Ga0207667_10212162 3300025949 Bacteria 1984
106 Ga0207667_10444041 3300025949 Bacteria 1319
107 Ga0207712_10588535 3300025961 Unclassified 961
108 Ga0207668_10266620 3300025972 Unclassified 1398
109 Ga0207668_10384932 3300025972 Bacteria 1182
110 Ga0207640_10004038 3300025981 Bacteria 7927
111 Ga0207658_10164032 3300025986 Bacteria 1823
112 Ga0207703_10532006 3300026035 Bacteria 1107
113 Ga0207639_10408600 3300026041 Unclassified 1225
114 Ga0207708_11090847 3300026075 Unclassified 696
115 Ga0207702_10000183 3300026078 Bacteria 75210
116 Ga0207702_10696028 3300026078 Bacteria 1001
117 Ga0207641_10249402 3300026088 Bacteria 1657
118 Ga0207675_100052541 3300026118 Unclassified 3802
119 Ga0207675_101089467 3300026118 Unclassified 818
120 Ga0207683_10229476 3300026121 Bacteria 1693
121 Ga0207698_10172687 3300026142 Bacteria 1905
122 Ga0207698_11420751 3300026142 Unclassified 709
123 Ga0268266_10000016 3300028379 Bacteria 629101
124 Ga0268265_10411520 3300028380 Bacteria 1253
125 Ga0268264_10000072 3300028381 Bacteria 260791
126 Ga0268264_10026441 3300028381 Bacteria 4743
127 Ga0268264_12566944 3300028381 Bacteria 514
128 Ga0265334_10003636 3300028573 Bacteria 6984
129 Ga0307517_10091433 3300028786 Bacteria 2486
130 Ga0265327_10234364 3300031251 Unclassified 822
131 Ga0265327_10274611 3300031251 Bacteria 746
132 Ga0307509_10642839 3300031507 Unclassified 730
133 Ga0265314_10345414 3300031711 Bacteria 820
134 Ga0307516_10062543 3300031730 Unclassified 3607
135 Ga0307414_10249533 3300032004 Bacteria 1474
136 Ga0307510_10000231 3300033180 Bacteria 50152
137 Ga0373943_0345758 3300035170 Bacteria 852
138 Ga0373924_0295622 3300035410 Bacteria 719
139 Ga0373935_0352025 3300035692 Bacteria 1050
140 Ga0373937_0105334 3300036401 Bacteria 2621
141 Ga0373937_2006180 3300036401 Unclassified 525
142 Ga0395905_0236632 3300037471 Bacteria 1707
143 Ga0395905_1803387 3300037471 Unclassified 517
144 Ga0436365_0505272 3300039437 Bacteria 1087
145 Ga0436365_0603520 3300039437 Bacteria 4478
146 Ga0451807_0828287 3300041486 Bacteria 592
147 Ga0439445_0200769 3300042004 Unclassified 589
148 Ga0466972_0023682 3300044658 Unclassified 3052
149 Ga0466968_0194003 3300044735 Bacteria 949
150 Ga0466960_0038693 3300044901 Unclassified 2245
151 Ga0495629_0383990 3300046459 Bacteria 956
152 Ga0495638_0097371 3300046460 Bacteria 1764
153 Ga0495641_0544822 3300046461 Bacteria 530
154 Ga0495580_0688344 3300046472 Bacteria 670
155 Ga0495582_0074565 3300046473 Bacteria 1879
156 Ga0495585_0000071 3300046492 Bacteria 105916
157 Ga0495585_0594227 3300046492 Bacteria 521
158 Ga0495596_0198666 3300046500 Bacteria 779
159 Ga0495606_0108065 3300046507 Bacteria 1682
160 Ga0495606_0507313 3300046507 Bacteria 608
161 Ga0495630_0126611 3300046517 Bacteria 1939
162 Ga0495630_0300646 3300046517 Bacteria 1226
163 Ga0495637_0199336 3300046520 Bacteria 736
164 Ga0495648_0000348 3300046524 Bacteria 50841
165 Ga0495640_0313811 3300046533 Bacteria 972
166 Ga0495587_0329339 3300046536 Bacteria 853
167 Ga0495597_0048857 3300046542 Bacteria 1871
168 Ga0495625_0083282 3300046660 Bacteria 2224
169 Ga0495625_0453406 3300046660 Bacteria 792
170 Ga0495588_0435353 3300046674 Bacteria 688
171 Ga0495669_0186461 3300046684 Bacteria 989
172 Ga0495613_0309647 3300046689 Bacteria 1092
173 Ga0495604_0269626 3300047317 Bacteria 1154
174 Ga0495674_0048075 3300047319 Bacteria 3778
175 Ga0495683_0015433 3300047323 Bacteria 3975
176 Ga0495687_000004 3300047443 Bacteria 779298
177 Ga0495684_0353917 3300047471 Bacteria 1042
178 Ga0495686_0002864 3300047472 Bacteria 15534
179 Ga0496115_0276215 3300048918 Bacteria 1380
180 Ga0501034_0584986 3300049571 Bacteria 1023
181 Ga0501037_0197154 3300049573 Bacteria 1424
182 Ga0501047_0951857 3300049581 Bacteria 672
183 Ga0501202_120934 3300049652 Bacteria 658
184 Ga0501249_027133 3300049679 Bacteria 1267
185 Ga0501225_0011417 3300049705 Bacteria 2498
186 Ga0501080_0189563 3300049742 Bacteria 1890
187 Ga0501083_0363583 3300049744 Bacteria 941
188 Ga0501035_0121043 3300049822 Bacteria 2288
189 Ga0501044_0981861 3300049823 Bacteria 717
190 nmdc:mga0k408_220236_c1 3300050493 Bacteria 1133
191 Ga0495612_0512434 3300053078 Bacteria 551
192 Ga0500635_0002934 3300053080 Bacteria 4244
193 Ga0500646_0067639 3300053090 Bacteria 1065
194 Ga0500583_0025798 3300053092 Unclassified 2515
195 Ga0500651_0451622 3300053093 Bacteria 715
196 Ga0500553_234695 3300053101 Bacteria 579
197 Ga0500608_010225 3300053122 Bacteria 4021
198 Ga0500618_000050 3300053125 Bacteria 105238
199 Ga0500642_0366735 3300053130 Bacteria 636
200 Ga0500658_0032067 3300053134 Bacteria 2059
201 Ga0500568_0067759 3300053139 Bacteria 1371
202 Ga0500568_0315726 3300053139 Unclassified 567
203 Ga0500588_0003030 3300053146 Bacteria 3505
204 Ga0500616_0168895 3300053153 Bacteria 995
205 Ga0500616_0184695 3300053153 Unclassified 936
206 Ga0500622_0002892 3300053156 Bacteria 11988
207 Ga0500637_0068778 3300053178 Bacteria 2035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_2006180 Ga0373937_2006180_155_466 103
2 3300046517 Ga0495630_0300646 Ga0495630_0300646_808_1119 103
3 3300003320 rootH2_10034182 rootH2_1003418250 104
4 3300005842 Ga0068858_100096142 Ga0068858_1000961422 104
5 3300026035 Ga0207703_10532006 Ga0207703_105320062 104
6 3300053139 Ga0500568_0067759 Ga0500568_0067759_868_1182 104
7 iso_pu_bacteria 2599185184 2599480901 104
8 iso_pu_bacteria 2928078545 2928080817 104
9 3300003323 rootH1_10355361 rootH1_103553612 105
10 3300005293 Ga0065715_10187722 Ga0065715_101877221 105
11 3300005616 Ga0068852_100190669 Ga0068852_1001906693 105
12 3300009093 Ga0105240_10662082 Ga0105240_106620822 105
13 3300009553 Ga0105249_10439649 Ga0105249_104396493 105
14 3300013306 Ga0163162_10023324 Ga0163162_100233245 105
15 3300025913 Ga0207695_11727647 Ga0207695_117276472 105
16 3300014968 Ga0157379_10194423 Ga0157379_101944233 106
17 3300025913 Ga0207695_10172380 Ga0207695_101723803 106
18 3300025942 Ga0207689_10896991 Ga0207689_108969912 106
19 3300025972 Ga0207668_10384932 Ga0207668_103849321 106
20 3300025986 Ga0207658_10164032 Ga0207658_101640323 106
21 3300026088 Ga0207641_10249402 Ga0207641_102494023 106
22 3300026118 Ga0207675_100052541 Ga0207675_1000525412 106
23 3300028380 Ga0268265_10411520 Ga0268265_104115202 106
24 3300028381 Ga0268264_10026441 Ga0268264_100264417 106
25 3300028381 Ga0268264_12566944 Ga0268264_125669441 106
26 3300028786 Ga0307517_10091433 Ga0307517_100914332 106
27 3300031711 Ga0265314_10345414 Ga0265314_103454142 106
28 3300049822 Ga0501035_0121043 Ga0501035_0121043_681_1001 106
29 3300005288 Ga0065714_10028026 Ga0065714_100280263 107
30 3300005329 Ga0070683_101049563 Ga0070683_1010495631 107
31 3300005335 Ga0070666_10030939 Ga0070666_100309394 107
32 3300005353 Ga0070669_100892371 Ga0070669_1008923711 107
33 3300005366 Ga0070659_100558710 Ga0070659_1005587103 107
34 3300005530 Ga0070679_100641326 Ga0070679_1006413262 107
35 3300005539 Ga0068853_100227254 Ga0068853_1002272542 107
36 3300005539 Ga0068853_102344000 Ga0068853_1023440002 107
37 3300005564 Ga0070664_100896682 Ga0070664_1008966822 107
38 3300005616 Ga0068852_100228741 Ga0068852_1002287413 107
39 3300009174 Ga0105241_10181066 Ga0105241_101810662 107
40 3300009176 Ga0105242_11375300 Ga0105242_113753002 107
41 3300009551 Ga0105238_10361548 Ga0105238_103615481 107
42 3300013102 Ga0157371_10267531 Ga0157371_102675312 107
43 3300013105 Ga0157369_10348887 Ga0157369_103488871 107
44 3300013296 Ga0157374_10052376 Ga0157374_100523765 107
45 3300013307 Ga0157372_10081817 Ga0157372_100818173 107
46 3300014325 Ga0163163_10100872 Ga0163163_101008724 107
47 3300014968 Ga0157379_11167273 Ga0157379_111672732 107
48 3300021384 Ga0213876_10653988 Ga0213876_106539882 107
49 3300025899 Ga0207642_10351206 Ga0207642_103512062 107
50 3300025903 Ga0207680_10017109 Ga0207680_100171094 107
51 3300025923 Ga0207681_11563919 Ga0207681_115639191 107
52 3300025924 Ga0207694_10380999 Ga0207694_103809991 107
53 3300025934 Ga0207686_11040336 Ga0207686_110403362 107
54 3300025944 Ga0207661_10469190 Ga0207661_104691903 107
55 3300026142 Ga0207698_10172687 Ga0207698_101726874 107
56 3300028573 Ga0265334_10003636 Ga0265334_100036363 107
57 3300031251 Ga0265327_10274611 Ga0265327_102746112 107
58 3300031730 Ga0307516_10062543 Ga0307516_100625435 107
59 3300033180 Ga0307510_10000231 Ga0307510_100002315 107
60 3300035170 Ga0373943_0345758 Ga0373943_0345758_489_812 107
61 3300035410 Ga0373924_0295622 Ga0373924_0295622_102_425 107
62 3300035692 Ga0373935_0352025 Ga0373935_0352025_514_837 107
63 3300036401 Ga0373937_0105334 Ga0373937_0105334_381_704 107
64 3300037471 Ga0395905_1803387 Ga0395905_1803387_164_493 107
65 3300039437 Ga0436365_0505272 Ga0436365_0505272_722_1051 107
66 3300039437 Ga0436365_0603520 Ga0436365_0603520_1900_2223 107
67 3300041486 Ga0451807_0828287 Ga0451807_0828287_137_460 107
68 3300046459 Ga0495629_0383990 Ga0495629_0383990_68_391 107
69 3300046461 Ga0495641_0544822 Ga0495641_0544822_101_424 107
70 3300046472 Ga0495580_0688344 Ga0495580_0688344_285_608 107
71 3300046473 Ga0495582_0074565 Ga0495582_0074565_640_963 107
72 3300046492 Ga0495585_0594227 Ga0495585_0594227_122_445 107
73 3300046500 Ga0495596_0198666 Ga0495596_0198666_375_698 107
74 3300046507 Ga0495606_0108065 Ga0495606_0108065_690_1013 107
75 3300046507 Ga0495606_0507313 Ga0495606_0507313_64_387 107
76 3300046517 Ga0495630_0126611 Ga0495630_0126611_698_1021 107
77 3300046533 Ga0495640_0313811 Ga0495640_0313811_119_442 107
78 3300046536 Ga0495587_0329339 Ga0495587_0329339_32_355 107
79 3300046660 Ga0495625_0083282 Ga0495625_0083282_352_675 107
80 3300046660 Ga0495625_0453406 Ga0495625_0453406_19_342 107
81 3300046684 Ga0495669_0186461 Ga0495669_0186461_564_887 107
82 3300046689 Ga0495613_0309647 Ga0495613_0309647_397_720 107
83 3300047317 Ga0495604_0269626 Ga0495604_0269626_302_625 107
84 3300047319 Ga0495674_0048075 Ga0495674_0048075_2933_3256 107
85 3300047323 Ga0495683_0015433 Ga0495683_0015433_1536_1859 107
86 3300047471 Ga0495684_0353917 Ga0495684_0353917_128_451 107
87 3300049742 Ga0501080_0189563 Ga0501080_0189563_431_754 107
88 3300053078 Ga0495612_0512434 Ga0495612_0512434_26_349 107
89 3300053080 Ga0500635_0002934 Ga0500635_0002934_3753_4076 107
90 3300053101 Ga0500553_234695 Ga0500553_234695_117_440 107
91 3300053122 Ga0500608_010225 Ga0500608_010225_682_1005 107
92 3300053146 Ga0500588_0003030 Ga0500588_0003030_369_692 107
93 3300053178 Ga0500637_0068778 Ga0500637_0068778_45_371 107
94 3300002741 JGI25157J39369_1005373 JGI25157J39369_10053732 108
95 3300002772 JGI25164J39214_1003120 JGI25164J39214_10031202 108
96 3300002987 JGI25159J45721_1013718 JGI25159J45721_10137182 108
97 3300003214 JGI25165J46597_1001507 JGI25165J46597_100150710 108
98 3300003316 rootH1_10010057 rootH1_100100575 108
99 3300003320 rootH2_10072926 rootH2_100729262 108
100 3300003320 rootH2_10089447 rootH2_100894473 108
101 3300003322 rootL2_10261082 rootL2_102610823 108
102 3300003323 rootH1_10008609 rootH1_10008609104 108
103 3300003323 rootH1_10329357 rootH1_103293574 108
104 3300003354 JGI25160J50197_1025916 JGI25160J50197_10259162 108
105 3300005347 Ga0070668_100161863 Ga0070668_1001618633 108
106 3300005441 Ga0070700_101200234 Ga0070700_1012002342 108
107 3300005456 Ga0070678_100437357 Ga0070678_1004373572 108
108 3300005539 Ga0068853_101205633 Ga0068853_1012056332 108
109 3300005548 Ga0070665_100000008 Ga0070665_100000008222 108
110 3300005563 Ga0068855_100000622 Ga0068855_10000062215 108
111 3300005563 Ga0068855_100045391 Ga0068855_1000453913 108
112 3300005563 Ga0068855_100116517 Ga0068855_1001165173 108
113 3300005614 Ga0068856_100000108 Ga0068856_10000010870 108
114 3300005614 Ga0068856_100179496 Ga0068856_1001794963 108
115 3300005616 Ga0068852_100325755 Ga0068852_1003257552 108
116 3300005719 Ga0068861_100580416 Ga0068861_1005804163 108
117 3300005719 Ga0068861_100614938 Ga0068861_1006149382 108
118 3300005843 Ga0068860_100000029 Ga0068860_10000002971 108
119 3300005843 Ga0068860_102098790 Ga0068860_1020987901 108
120 3300006195 Ga0075366_10247709 Ga0075366_102477093 108
121 3300006358 Ga0068871_100009714 Ga0068871_1000097144 108
122 3300009093 Ga0105240_10000269 Ga0105240_1000026925 108
123 3300009093 Ga0105240_10677628 Ga0105240_106776282 108
124 3300009174 Ga0105241_10089180 Ga0105241_100891802 108
125 3300009174 Ga0105241_10189562 Ga0105241_101895622 108
126 3300009545 Ga0105237_11441585 Ga0105237_114415852 108
127 3300009551 Ga0105238_10022472 Ga0105238_100224725 108
128 3300009553 Ga0105249_10070562 Ga0105249_100705623 108
129 3300010375 Ga0105239_10000068 Ga0105239_1000006890 108
130 3300010375 Ga0105239_11320184 Ga0105239_113201842 108
131 3300013104 Ga0157370_10352465 Ga0157370_103524652 108
132 3300013105 Ga0157369_11711132 Ga0157369_117111322 108
133 3300013296 Ga0157374_10895650 Ga0157374_108956502 108
134 3300013297 Ga0157378_11312617 Ga0157378_113126171 108
135 3300013307 Ga0157372_10081756 Ga0157372_100817564 108
136 3300013307 Ga0157372_10142094 Ga0157372_101420942 108
137 3300013308 Ga0157375_12241488 Ga0157375_122414882 108
138 3300020078 Ga0206352_10211512 Ga0206352_102115122 108
139 3300020080 Ga0206350_10977495 Ga0206350_109774951 108
140 3300022467 Ga0224712_10117009 Ga0224712_101170092 108
141 3300025208 Ga0209436_103765 Ga0209436_1037652 108
142 3300025231 Ga0207427_100268 Ga0207427_10026811 108
143 3300025233 Ga0209437_100008 Ga0209437_100008194 108
144 3300025233 Ga0209437_100030 Ga0209437_100030189 108
145 3300025250 Ga0209026_1000991 Ga0209026_100099114 108
146 3300025258 Ga0209129_1002627 Ga0209129_10026272 108
147 3300025261 Ga0209233_1000024 Ga0209233_1000024465 108
148 3300025284 Ga0209130_1001099 Ga0209130_100109920 108
149 3300025302 Ga0207426_1000096 Ga0207426_100009629 108
150 3300025911 Ga0207654_10003979 Ga0207654_100039795 108
151 3300025911 Ga0207654_10284771 Ga0207654_102847712 108
152 3300025913 Ga0207695_10000244 Ga0207695_1000024438 108
153 3300025913 Ga0207695_10132260 Ga0207695_101322602 108
154 3300025914 Ga0207671_10005833 Ga0207671_100058333 108
155 3300025914 Ga0207671_10007117 Ga0207671_100071175 108
156 3300025914 Ga0207671_10028137 Ga0207671_100281373 108
157 3300025924 Ga0207694_10331258 Ga0207694_103312582 108
158 3300025933 Ga0207706_10923589 Ga0207706_109235892 108
159 3300025949 Ga0207667_10000420 Ga0207667_100004205 108
160 3300025949 Ga0207667_10212162 Ga0207667_102121623 108
161 3300025949 Ga0207667_10444041 Ga0207667_104440412 108
162 3300025961 Ga0207712_10588535 Ga0207712_105885352 108
163 3300025972 Ga0207668_10266620 Ga0207668_102666202 108
164 3300025981 Ga0207640_10004038 Ga0207640_100040385 108
165 3300026041 Ga0207639_10408600 Ga0207639_104086002 108
166 3300026075 Ga0207708_11090847 Ga0207708_110908471 108
167 3300026078 Ga0207702_10000183 Ga0207702_1000018362 108
168 3300026078 Ga0207702_10696028 Ga0207702_106960282 108
169 3300026118 Ga0207675_101089467 Ga0207675_1010894671 108
170 3300026121 Ga0207683_10229476 Ga0207683_102294763 108
171 3300026142 Ga0207698_11420751 Ga0207698_114207512 108
172 3300028379 Ga0268266_10000016 Ga0268266_10000016220 108
173 3300028381 Ga0268264_10000072 Ga0268264_1000007272 108
174 3300031251 Ga0265327_10234364 Ga0265327_102343641 108
175 3300031507 Ga0307509_10642839 Ga0307509_106428391 108
176 3300032004 Ga0307414_10249533 Ga0307414_102495332 108
177 3300037471 Ga0395905_0236632 Ga0395905_0236632_523_849 108
178 3300042004 Ga0439445_0200769 Ga0439445_0200769_205_531 108
179 3300044658 Ga0466972_0023682 Ga0466972_0023682_928_1254 108
180 3300044735 Ga0466968_0194003 Ga0466968_0194003_90_428 108
181 3300044901 Ga0466960_0038693 Ga0466960_0038693_1146_1472 108
182 3300046460 Ga0495638_0097371 Ga0495638_0097371_716_1042 108
183 3300046492 Ga0495585_0000071 Ga0495585_0000071_14576_14902 108
184 3300046520 Ga0495637_0199336 Ga0495637_0199336_313_639 108
185 3300046524 Ga0495648_0000348 Ga0495648_0000348_15829_16155 108
186 3300046542 Ga0495597_0048857 Ga0495597_0048857_1361_1687 108
187 3300046674 Ga0495588_0435353 Ga0495588_0435353_257_583 108
188 3300047443 Ga0495687_000004 Ga0495687_000004_339228_339554 108
189 3300047472 Ga0495686_0002864 Ga0495686_0002864_3412_3738 108
190 3300048918 Ga0496115_0276215 Ga0496115_0276215_697_1023 108
191 3300049571 Ga0501034_0584986 Ga0501034_0584986_388_726 108
192 3300049573 Ga0501037_0197154 Ga0501037_0197154_56_394 108
193 3300049581 Ga0501047_0951857 Ga0501047_0951857_243_581 108
194 3300049652 Ga0501202_120934 Ga0501202_120934_213_557 108
195 3300049679 Ga0501249_027133 Ga0501249_027133_850_1194 108
196 3300049705 Ga0501225_0011417 Ga0501225_0011417_380_736 108
197 3300049744 Ga0501083_0363583 Ga0501083_0363583_90_416 108
198 3300049823 Ga0501044_0981861 Ga0501044_0981861_157_483 108
199 3300050493 nmdc:mga0k408_220236_c1 nmdc:mga0k408_220236_c1_176_502 108
200 3300053090 Ga0500646_0067639 Ga0500646_0067639_305_643 108
201 3300053092 Ga0500583_0025798 Ga0500583_0025798_617_943 108
202 3300053093 Ga0500651_0451622 Ga0500651_0451622_53_391 108
203 3300053125 Ga0500618_000050 Ga0500618_000050_26083_26415 108
204 3300053130 Ga0500642_0366735 Ga0500642_0366735_153_491 108
205 3300053134 Ga0500658_0032067 Ga0500658_0032067_1243_1581 108
206 3300053139 Ga0500568_0315726 Ga0500568_0315726_155_481 108
207 3300053153 Ga0500616_0168895 Ga0500616_0168895_351_686 108
208 3300053153 Ga0500616_0184695 Ga0500616_0184695_593_919 108
209 3300053156 Ga0500622_0002892 Ga0500622_0002892_5009_5335 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

24

69

0.98

PF12840

HTH_20

Helix-turn-helix domain

22

71

0.96

PF08279

HTH_11

HTH domain

19

75

0.91

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

27

69

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9641 8 75
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9332 8 88
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9189 14 72
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9009 17 72
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9006 14 75
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9518 14 70 1.10.10.10
af_P9WMI9_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 10 71 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9259 14 73 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9181 14 59 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9093 14 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6P1IEJ3-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9623 8 72 GO:0003700
AF-A0A6H3J026-F1-model_v4 deleted 0.9599 6 87
AF-A0A3D3QNL0-F1-model_v4 deleted 0.9527 5 86
AF-A0A1I2XAN2-F1-model_v4 Transcriptional regulator, ArsR family 0.9505 9 87 GO:0003700
AF-A0A523C3Y9-F1-model_v4 ArsR family transcriptional regulator 0.9476 8 84 GO:0003700

Feature Viewer

pLDDT pTM Quality
93.39 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map