F319051

General Info

Members Datasets Scaffolds Average Seq Length
209 128 419 289

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10042986|Ga0105237_100429863
Length 337
Sequence MDGASQKKPNTPFGAIHPETVVYPPRPIQKQSIALNRQQPPNYRSTPIMRNVFKTPLKTILAATILFAAASRTTAQQLKPSASGYAPVNGIKVYYEVYGEGKPLILLHGAFYTIGLNWSQLLPGLSKTHKVIALEMQGHGHTPYSDRKLDIATLASDVVAVMDYLKIDSADVAGYSMGGSIAYQFAVTYPKRLRKLVILSSTYKNSGWIAAVNGGFKDFKPEFFDNTPIKTAYDAVAPDKTKWRKWLEQMVAFAGDPFDVGDANIAKITVPVLIISGDNDGLDKVELAKTYQLLGGGVSADLGPMPKSQLAIVPAQSHVGVMMQTATILNYMDNFLQ

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
125 2818991444 Filimonas endophytica 3197 Isolate Unclassified
126 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
127 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
128 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.96
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 0.96
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10042986 3300009545 Unclassified 4554
2 JGI24737J22298_10006576 3300001990 Bacteria 3962
3 JGI24735J21928_10000020 3300002067 Bacteria 108706
4 rootH1_10005676 3300003316 Bacteria 11468
5 rootH1_10005676 3300003323 Bacteria 4854
6 Ga0065714_10068165 3300005288 Bacteria 4919
7 Ga0065704_10072765 3300005289 Bacteria 8042
8 Ga0065712_10007470 3300005290 Bacteria 3089
9 Ga0065715_10180088 3300005293 Bacteria 1483
10 Ga0070658_10078570 3300005327 Bacteria 2709
11 Ga0070658_10367920 3300005327 Unclassified 1232
12 Ga0070658_10469656 3300005327 Unclassified 1085
13 Ga0070683_100016494 3300005329 Bacteria 6516
14 Ga0070683_100023558 3300005329 Bacteria 5508
15 Ga0070666_10045818 3300005335 Bacteria 2931
16 Ga0070680_100040623 3300005336 Bacteria 3768
17 Ga0070682_100000018 3300005337 Bacteria 229427
18 Ga0070682_100039583 3300005337 Bacteria 2897
19 Ga0068868_100177398 3300005338 Bacteria 1766
20 Ga0070660_100000634 3300005339 Bacteria 23376
21 Ga0070660_100002475 3300005339 Bacteria 12664
22 Ga0070660_100086649 3300005339 Bacteria 2464
23 Ga0070668_100006142 3300005347 Bacteria 8904
24 Ga0070669_100143350 3300005353 Bacteria 1844
25 Ga0070675_100234121 3300005354 Bacteria 1603
26 Ga0070674_100358675 3300005356 Bacteria 1180
27 Ga0070673_100014228 3300005364 Bacteria 5533
28 Ga0070659_100011014 3300005366 Bacteria 6678
29 Ga0070659_100149324 3300005366 Bacteria 1906
30 Ga0070667_100207606 3300005367 Bacteria 1740
31 Ga0070663_100119152 3300005455 Bacteria 1992
32 Ga0070678_100294650 3300005456 Bacteria 1377
33 Ga0070662_100009273 3300005457 Bacteria 6430
34 Ga0070681_10071014 3300005458 Bacteria 3446
35 Ga0070681_10187577 3300005458 Bacteria 1988
36 Ga0070685_10005193 3300005466 Bacteria 6601
37 Ga0070679_100017380 3300005530 Bacteria 6960
38 Ga0070679_100088653 3300005530 Bacteria 3080
39 Ga0070684_100023579 3300005535 Bacteria 5151
40 Ga0070684_100069476 3300005535 Bacteria 3098
41 Ga0068853_100135587 3300005539 Bacteria 2206
42 Ga0068853_100213617 3300005539 Bacteria 1759
43 Ga0070672_100192804 3300005543 Bacteria 1702
44 Ga0070693_100305550 3300005547 Bacteria 1074
45 Ga0068855_100012369 3300005563 Bacteria 10309
46 Ga0068855_100023490 3300005563 Bacteria 7383
47 Ga0068855_100029262 3300005563 Bacteria 6587
48 Ga0068855_100051380 3300005563 Bacteria 4856
49 Ga0068855_100496549 3300005563 Bacteria 1326
50 Ga0070664_100003822 3300005564 Bacteria 12156
51 Ga0070664_100006229 3300005564 Bacteria 9635
52 Ga0068857_100009154 3300005577 Bacteria 8594
53 Ga0068856_100036759 3300005614 Bacteria 4802
54 Ga0068856_100303401 3300005614 Bacteria 1615
55 Ga0068852_100053832 3300005616 Bacteria 3466
56 Ga0068852_100381910 3300005616 Bacteria 1382
57 Ga0068859_100037462 3300005617 Bacteria 4866
58 Ga0068859_100103841 3300005617 Bacteria 2900
59 Ga0068864_100026572 3300005618 Bacteria 4881
60 Ga0068863_100005882 3300005841 Bacteria 12020
61 Ga0068860_100024959 3300005843 Bacteria 5771
62 Ga0068860_100335486 3300005843 Bacteria 1486
63 Ga0097621_100041354 3300006237 Bacteria 3710
64 Ga0068871_100157485 3300006358 Bacteria 1940
65 Ga0097620_100037462 3300006931 Bacteria 4866
66 Ga0097620_100103839 3300006931 Bacteria 2900
67 Ga0105240_10000576 3300009093 Bacteria 68032
68 Ga0105240_10004003 3300009093 Bacteria 22708
69 Ga0105240_10034753 3300009093 Bacteria 6499
70 Ga0105240_10439294 3300009093 Archaea 1462
71 Ga0111539_10498973 3300009094 Bacteria 1418
72 Ga0105241_10015015 3300009174 Bacteria 5673
73 Ga0105241_10034005 3300009174 Bacteria 3829
74 Ga0105237_10006845 3300009545 Bacteria 12564
75 Ga0105237_10079784 3300009545 Unclassified 3263
76 Ga0105237_10232279 3300009545 Bacteria 1845
77 Ga0105238_10285066 3300009551 Bacteria 1633
78 Ga0105238_10404081 3300009551 Bacteria 1359
79 Ga0105249_10089376 3300009553 Bacteria 2879
80 Ga0105239_10006588 3300010375 Bacteria 13450
81 Ga0105239_10018539 3300010375 Bacteria 7687
82 Ga0105239_10023740 3300010375 Bacteria 6752
83 Ga0105239_10241262 3300010375 Bacteria 2028
84 Ga0105239_10629273 3300010375 Bacteria 1225
85 Ga0157373_10007633 3300013100 Bacteria 8033
86 Ga0157373_10152599 3300013100 Bacteria 1625
87 Ga0157371_10015752 3300013102 Bacteria 5659
88 Ga0157371_10025835 3300013102 Bacteria 4274
89 Ga0157371_10030582 3300013102 Bacteria 3884
90 Ga0157371_10154503 3300013102 Bacteria 1637
91 Ga0157371_10257204 3300013102 Bacteria 1258
92 Ga0157370_10023594 3300013104 Bacteria 6106
93 Ga0157370_10103171 3300013104 Bacteria 2670
94 Ga0157370_10200750 3300013104 Bacteria 1850
95 Ga0157370_10297101 3300013104 Archaea 1491
96 Ga0157369_10098893 3300013105 Bacteria 3110
97 Ga0157374_10000009 3300013296 Bacteria 564330
98 Ga0157374_10018062 3300013296 Bacteria 6220
99 Ga0157374_10038602 3300013296 Bacteria 4390
100 Ga0157378_10335587 3300013297 Bacteria 1472
101 Ga0163162_10048967 3300013306 Bacteria 4235
102 Ga0157372_10000771 3300013307 Bacteria 34676
103 Ga0157372_10005310 3300013307 Bacteria 13685
104 Ga0157372_10084623 3300013307 Bacteria 3595
105 Ga0157372_10126580 3300013307 Bacteria 2937
106 Ga0157375_10112012 3300013308 Bacteria 2828
107 Ga0163163_10011307 3300014325 Bacteria 8090
108 Ga0163163_10251017 3300014325 Bacteria 1820
109 Ga0157376_10013036 3300014969 Bacteria 6193
110 Ga0157376_10161561 3300014969 Bacteria 2031
111 Ga0163161_10271943 3300017792 Bacteria 1326
112 Ga0206351_10778961 3300020077 Bacteria 1613
113 Ga0207666_1006225 3300025271 Bacteria 1543
114 Ga0207656_10005104 3300025321 Bacteria 4617
115 Ga0207656_10116899 3300025321 Bacteria 1238
116 Ga0207642_10047907 3300025899 Bacteria 1913
117 Ga0207647_10038688 3300025904 Bacteria 3015
118 Ga0207647_10101008 3300025904 Bacteria 1711
119 Ga0207647_10202363 3300025904 Bacteria 1148
120 Ga0207647_10244533 3300025904 Unclassified 1030
121 Ga0207643_10036046 3300025908 Bacteria 2774
122 Ga0207705_10059179 3300025909 Bacteria 2765
123 Ga0207684_10251571 3300025910 Bacteria 1525
124 Ga0207654_10190166 3300025911 Bacteria 1345
125 Ga0207707_10040066 3300025912 Bacteria 4093
126 Ga0207707_10052574 3300025912 Bacteria 3546
127 Ga0207707_10217010 3300025912 Bacteria 1665
128 Ga0207695_10000217 3300025913 Bacteria 155047
129 Ga0207695_10000659 3300025913 Bacteria 68040
130 Ga0207695_10002731 3300025913 Bacteria 25745
131 Ga0207695_10045285 3300025913 Bacteria 4671
132 Ga0207695_10053121 3300025913 Bacteria 4240
133 Ga0207671_10000961 3300025914 Bacteria 35766
134 Ga0207671_10007648 3300025914 Bacteria 9333
135 Ga0207671_10024287 3300025914 Unclassified 4561
136 Ga0207671_10362633 3300025914 Unclassified 1150
137 Ga0207660_10129227 3300025917 Bacteria 1921
138 Ga0207662_10057190 3300025918 Bacteria 2330
139 Ga0207657_10000767 3300025919 Bacteria 34034
140 Ga0207657_10000893 3300025919 Bacteria 31577
141 Ga0207657_10299988 3300025919 Bacteria 1273
142 Ga0207657_10314905 3300025919 Bacteria 1238
143 Ga0207652_10099700 3300025921 Bacteria 2563
144 Ga0207652_10469085 3300025921 Bacteria 1134
145 Ga0207681_10036449 3300025923 Bacteria 3245
146 Ga0207690_10013307 3300025932 Bacteria 4942
147 Ga0207706_10000957 3300025933 Bacteria 29536
148 Ga0207670_10082266 3300025936 Bacteria 2256
149 Ga0207691_10041540 3300025940 Bacteria 4245
150 Ga0207691_10130118 3300025940 Bacteria 2224
151 Ga0207711_10125885 3300025941 Bacteria 2292
152 Ga0207689_10060021 3300025942 Bacteria 3128
153 Ga0207661_10017541 3300025944 Bacteria 5300
154 Ga0207661_10031561 3300025944 Bacteria 4094
155 Ga0207679_10002409 3300025945 Bacteria 11528
156 Ga0207679_10005268 3300025945 Bacteria 8106
157 Ga0207667_10006552 3300025949 Bacteria 14084
158 Ga0207667_10043501 3300025949 Bacteria 4766
159 Ga0207640_10160608 3300025981 Archaea 1662
160 Ga0207658_10246832 3300025986 Bacteria 1515
161 Ga0207677_10190768 3300026023 Bacteria 1621
162 Ga0207639_10070933 3300026041 Bacteria 2723
163 Ga0207639_10171835 3300026041 Bacteria 1836
164 Ga0207639_10180142 3300026041 Bacteria 1797
165 Ga0207639_10651228 3300026041 Unclassified 975
166 Ga0207702_10069386 3300026078 Bacteria 3030
167 Ga0207641_10001301 3300026088 Bacteria 24754
168 Ga0207641_10018275 3300026088 Bacteria 5746
169 Ga0207641_10164703 3300026088 Bacteria 2018
170 Ga0207676_10021162 3300026095 Bacteria 4770
171 Ga0207676_10213156 3300026095 Bacteria 1715
172 Ga0207674_10005957 3300026116 Bacteria 14427
173 Ga0207674_10021785 3300026116 Bacteria 6897
174 Ga0207674_10425639 3300026116 Bacteria 1283
175 Ga0207675_100161875 3300026118 Bacteria 2135
176 Ga0207675_100402432 3300026118 Bacteria 1349
177 Ga0207683_10259765 3300026121 Bacteria 1586
178 Ga0207683_10349587 3300026121 Bacteria 1357
179 Ga0207698_10069613 3300026142 Bacteria 2783
180 Ga0268265_10330823 3300028380 Bacteria 1384
181 Ga0268264_10004651 3300028381 Bacteria 11663
182 Ga0307517_10006280 3300028786 Bacteria 17659
183 Ga0307517_10024358 3300028786 Bacteria 7465
184 Ga0307515_10008544 3300028794 Bacteria 19936
185 Ga0265760_10002783 3300031090 Bacteria 5110
186 Ga0265327_10000906 3300031251 Bacteria 43527
187 Ga0265327_10038893 3300031251 Unclassified 2590
188 Ga0307509_10253344 3300031507 Bacteria 1542
189 Ga0307516_10085432 3300031730 Bacteria 2993
190 Ga0373944_0054397 3300035089 Bacteria 1269
191 Ga0395900_0405817 3300037418 Bacteria 1326
192 Ga0439459_0064243 3300042438 Bacteria 836
193 Ga0453684_0452192 3300044712 Bacteria 1429
194 Ga0466959_0033188 3300045049 Bacteria 3819
195 Ga0495633_0000315 3300046558 Bacteria 54947
196 Ga0495611_0000057 3300046648 Bacteria 80239
197 Ga0495625_0000586 3300046660 Bacteria 52844
198 Ga0495669_0134076 3300046684 Bacteria 1167
199 Ga0495636_0069243 3300047318 Bacteria 1504
200 Ga0495687_002666 3300047443 Bacteria 13909
201 Ga0496108_0433118 3300048911 Bacteria 1149
202 Ga0501038_0480751 3300049574 Bacteria 952
203 nmdc:mga0k408_433_c1 3300050493 Bacteria 17055
204 Ga0500641_0000058 3300053096 Bacteria 47154
205 Ga0500616_0004230 3300053153 Bacteria 10333
206 2599481291 2599185184 Bacteria 6430550
207 2819587303 2818991444 Bacteria 6968812
208 2928081889 2928078545 Bacteria 6534839
209 2928151911 2928147474 Bacteria 6512076
210 2932087219 2932082852 Bacteria 6563563
211 Ga0105237_10042986
212 JGI24737J22298_10006576
213 JGI24735J21928_10000020
214 rootH1_10005676
215 Ga0065714_10068165
216 Ga0065704_10072765
217 Ga0065712_10007470
218 Ga0065715_10180088
219 Ga0070658_10078570
220 Ga0070658_10367920
221 Ga0070658_10469656
222 Ga0070683_100016494
223 Ga0070683_100023558
224 Ga0070666_10045818
225 Ga0070680_100040623
226 Ga0070682_100000018
227 Ga0070682_100039583
228 Ga0068868_100177398
229 Ga0070660_100000634
230 Ga0070660_100002475
231 Ga0070660_100086649
232 Ga0070668_100006142
233 Ga0070669_100143350
234 Ga0070675_100234121
235 Ga0070674_100358675
236 Ga0070673_100014228
237 Ga0070659_100011014
238 Ga0070659_100149324
239 Ga0070667_100207606
240 Ga0070663_100119152
241 Ga0070678_100294650
242 Ga0070662_100009273
243 Ga0070681_10071014
244 Ga0070681_10187577
245 Ga0070685_10005193
246 Ga0070679_100017380
247 Ga0070679_100088653
248 Ga0070684_100023579
249 Ga0070684_100069476
250 Ga0068853_100135587
251 Ga0068853_100213617
252 Ga0070672_100192804
253 Ga0070693_100305550
254 Ga0068855_100012369
255 Ga0068855_100023490
256 Ga0068855_100029262
257 Ga0068855_100051380
258 Ga0068855_100496549
259 Ga0070664_100003822
260 Ga0070664_100006229
261 Ga0068857_100009154
262 Ga0068856_100036759
263 Ga0068856_100303401
264 Ga0068852_100053832
265 Ga0068852_100381910
266 Ga0068859_100037462
267 Ga0068859_100103841
268 Ga0068864_100026572
269 Ga0068863_100005882
270 Ga0068860_100024959
271 Ga0068860_100335486
272 Ga0097621_100041354
273 Ga0068871_100157485
274 Ga0097620_100037462
275 Ga0097620_100103839
276 Ga0105240_10000576
277 Ga0105240_10004003
278 Ga0105240_10034753
279 Ga0105240_10439294
280 Ga0111539_10498973
281 Ga0105241_10015015
282 Ga0105241_10034005
283 Ga0105237_10006845
284 Ga0105237_10079784
285 Ga0105237_10232279
286 Ga0105238_10285066
287 Ga0105238_10404081
288 Ga0105249_10089376
289 Ga0105239_10006588
290 Ga0105239_10018539
291 Ga0105239_10023740
292 Ga0105239_10241262
293 Ga0105239_10629273
294 Ga0157373_10007633
295 Ga0157373_10152599
296 Ga0157371_10015752
297 Ga0157371_10025835
298 Ga0157371_10030582
299 Ga0157371_10154503
300 Ga0157371_10257204
301 Ga0157370_10023594
302 Ga0157370_10103171
303 Ga0157370_10200750
304 Ga0157370_10297101
305 Ga0157369_10098893
306 Ga0157374_10000009
307 Ga0157374_10018062
308 Ga0157374_10038602
309 Ga0157378_10335587
310 Ga0163162_10048967
311 Ga0157372_10000771
312 Ga0157372_10005310
313 Ga0157372_10084623
314 Ga0157372_10126580
315 Ga0157375_10112012
316 Ga0163163_10011307
317 Ga0163163_10251017
318 Ga0157376_10013036
319 Ga0157376_10161561
320 Ga0163161_10271943
321 Ga0206351_10778961
322 Ga0207666_1006225
323 Ga0207656_10005104
324 Ga0207656_10116899
325 Ga0207642_10047907
326 Ga0207647_10038688
327 Ga0207647_10101008
328 Ga0207647_10202363
329 Ga0207647_10244533
330 Ga0207643_10036046
331 Ga0207705_10059179
332 Ga0207684_10251571
333 Ga0207654_10190166
334 Ga0207707_10040066
335 Ga0207707_10052574
336 Ga0207707_10217010
337 Ga0207695_10000217
338 Ga0207695_10000659
339 Ga0207695_10002731
340 Ga0207695_10045285
341 Ga0207695_10053121
342 Ga0207671_10000961
343 Ga0207671_10007648
344 Ga0207671_10024287
345 Ga0207671_10362633
346 Ga0207660_10129227
347 Ga0207662_10057190
348 Ga0207657_10000767
349 Ga0207657_10000893
350 Ga0207657_10299988
351 Ga0207657_10314905
352 Ga0207652_10099700
353 Ga0207652_10469085
354 Ga0207681_10036449
355 Ga0207690_10013307
356 Ga0207706_10000957
357 Ga0207670_10082266
358 Ga0207691_10041540
359 Ga0207691_10130118
360 Ga0207711_10125885
361 Ga0207689_10060021
362 Ga0207661_10017541
363 Ga0207661_10031561
364 Ga0207679_10002409
365 Ga0207679_10005268
366 Ga0207667_10006552
367 Ga0207667_10043501
368 Ga0207640_10160608
369 Ga0207658_10246832
370 Ga0207677_10190768
371 Ga0207639_10070933
372 Ga0207639_10171835
373 Ga0207639_10180142
374 Ga0207639_10651228
375 Ga0207702_10069386
376 Ga0207641_10001301
377 Ga0207641_10018275
378 Ga0207641_10164703
379 Ga0207676_10021162
380 Ga0207676_10213156
381 Ga0207674_10005957
382 Ga0207674_10021785
383 Ga0207674_10425639
384 Ga0207675_100161875
385 Ga0207675_100402432
386 Ga0207683_10259765
387 Ga0207683_10349587
388 Ga0207698_10069613
389 Ga0268265_10330823
390 Ga0268264_10004651
391 Ga0307517_10006280
392 Ga0307517_10024358
393 Ga0307515_10008544
394 Ga0265760_10002783
395 Ga0265327_10000906
396 Ga0265327_10038893
397 Ga0307509_10253344
398 Ga0307516_10085432
399 Ga0373944_0054397
400 Ga0395900_0405817
401 Ga0439459_0064243
402 Ga0453684_0452192
403 Ga0466959_0033188
404 Ga0495633_0000315
405 Ga0495611_0000057
406 Ga0495625_0000586
407 Ga0495669_0134076
408 Ga0495636_0069243
409 Ga0495687_002666
410 Ga0496108_0433118
411 Ga0501038_0480751
412 nmdc:mga0k408_433_c1
413 Ga0500641_0000058
414 Ga0500616_0004230
415 2599481291
416 2819587303
417 2928081889
418 2928151911
419 2932087219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03096

Ndr

Ndr family

137

219

0.92

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

102

239

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

104

327

0.71

PF12146

Hydrolase_4

Serine aminopeptidase, S33

104

296

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u2m-assembly2.cif.gz_C crystal structure of a halotag-based calcium indicator, halocamp v2, bound to jf635 0.8878 36 155
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8564 36 155
2dst-assembly1.cif.gz_B crystal structure analysis of tt1977 0.8364 36 155
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8328 36 290
2oci-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase complexed with a product analogue 0.808 36 291
ID Description Score Start End Superfamily
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9335 45 157 3.40.50.12270
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8996 55 156 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8804 32 152 3.40.50.1820
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8779 36 157 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8619 36 156 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7K2P344-F1-model_v4 Alpha/beta fold hydrolase 0.9606 33 156 GO:0016787
AF-A0A7J2IRY7-F1-model_v4 Alpha/beta hydrolase 0.9575 39 152 GO:0016020
GO:0016787
AF-A0A1G3VV50-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9564 42 159 GO:0016020
AF-A0A0B7IAS2-F1-model_v4 Beta-ketoadipate enol-lactone hydrolase I (EC 3.1.1.1) 0.9546 47 156 GO:0106435
AF-A0A534UXY9-F1-model_v4 Alpha/beta hydrolase 0.954 47 156 GO:0016787

Map