F318872

General Info

Members Datasets Scaffolds Average Seq Length
209 133 418 256

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100712879|Ga0068857_1007128791
Length 282
Sequence MLRSNISIHRKQGILNGTVFTKAIVRTPAANFSGGLTRVDLGKPDHELALRQHDAYCRALERCGLELIRLAPDEKHPDSTFVEDTAIVTPRGAVITRPGAESRLAETHEIERVLRDHFPKAAAIAAPGTVDGGDVCEAGDHFFIGISQRTNEAGAEQLARLLAAFGYSSSLIDIRALSNILHLKSGMACIGTNAGPNGSPSRLVVIDELSERKEFSGYEVIRVNSAEEYAANCVFINDRTLVAAGFPDLRRQIEDLGQQTIPLEMSEFQKMDGGLSCLSLRF

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
123 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
124 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.96
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 21.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100712879 3300005577 Unclassified 954
2 JGI24749J21850_1013357 3300002076 Unclassified 1153
3 JGI24751J29686_10000017 3300002459 Bacteria 109415
4 Ga0065714_10002213 3300005288 Bacteria 57489
5 Ga0065712_10022661 3300005290 Bacteria 2397
6 Ga0065712_10074848 3300005290 Bacteria 3994
7 Ga0065715_10119371 3300005293 Bacteria 2288
8 Ga0065715_10133293 3300005293 Bacteria 1972
9 Ga0065715_10240887 3300005293 Bacteria 1200
10 Ga0070690_100002320 3300005330 Bacteria 10217
11 Ga0070690_100333388 3300005330 Bacteria 1097
12 Ga0070670_100001273 3300005331 Bacteria 20089
13 Ga0068869_100546288 3300005334 Bacteria 973
14 Ga0070666_10003914 3300005335 Bacteria 9049
15 Ga0070682_100134025 3300005337 Unclassified 1680
16 Ga0070687_100046049 3300005343 Bacteria 2231
17 Ga0070661_100197658 3300005344 Unclassified 1535
18 Ga0070692_10004556 3300005345 Bacteria 5802
19 Ga0070692_10007046 3300005345 Bacteria 4931
20 Ga0070692_10042559 3300005345 Bacteria 2332
21 Ga0070669_100046755 3300005353 Unclassified 3156
22 Ga0070675_100451790 3300005354 Bacteria 1153
23 Ga0070671_100053843 3300005355 Bacteria 3344
24 Ga0070671_100369773 3300005355 Bacteria 1224
25 Ga0070701_10055956 3300005438 Unclassified 2062
26 Ga0070705_100001650 3300005440 Bacteria 11688
27 Ga0070705_100114642 3300005440 Bacteria 1729
28 Ga0070700_100009500 3300005441 Bacteria 5343
29 Ga0070700_100027894 3300005441 Bacteria 3353
30 Ga0070700_100066109 3300005441 Unclassified 2294
31 Ga0070663_100212598 3300005455 Unclassified 1515
32 Ga0070678_100006250 3300005456 Bacteria 6971
33 Ga0068867_100309301 3300005459 Bacteria 1305
34 Ga0070706_100000088 3300005467 Bacteria 107818
35 Ga0070707_100703499 3300005468 Unclassified 973
36 Ga0070698_100001122 3300005471 Bacteria 29567
37 Ga0070698_100001898 3300005471 Bacteria 23287
38 Ga0070698_100332447 3300005471 Bacteria 1451
39 Ga0070698_100474134 3300005471 Unclassified 1188
40 Ga0070699_100317278 3300005518 Bacteria 1400
41 Ga0068853_100011388 3300005539 Bacteria 7223
42 Ga0070672_100390364 3300005543 Bacteria 1192
43 Ga0070695_100077439 3300005545 Bacteria 2191
44 Ga0070696_100093590 3300005546 Bacteria 2144
45 Ga0070696_100198536 3300005546 Bacteria 1496
46 Ga0070693_100001002 3300005547 Bacteria 12595
47 Ga0070693_100018546 3300005547 Bacteria 3637
48 Ga0070693_100065892 3300005547 Bacteria 2118
49 Ga0070665_100031101 3300005548 Bacteria 5373
50 Ga0070704_100032596 3300005549 Bacteria 3516
51 Ga0070704_100035616 3300005549 Unclassified 3384
52 Ga0070664_100463130 3300005564 Unclassified 1165
53 Ga0068857_100239233 3300005577 Bacteria 1662
54 Ga0068857_100685494 3300005577 Unclassified 973
55 Ga0068854_100038365 3300005578 Bacteria 3369
56 Ga0068854_100403944 3300005578 Bacteria 1131
57 Ga0068856_100032760 3300005614 Bacteria 5088
58 Ga0068859_100033344 3300005617 Bacteria 5171
59 Ga0068859_100083594 3300005617 Unclassified 3236
60 Ga0068859_100092995 3300005617 Bacteria 3067
61 Ga0068859_100138294 3300005617 Bacteria 2509
62 Ga0068859_100336050 3300005617 Bacteria 1605
63 Ga0068864_100135813 3300005618 Bacteria 2214
64 Ga0068864_100509675 3300005618 Bacteria 1159
65 Ga0068866_10302947 3300005718 Bacteria 999
66 Ga0068866_10430910 3300005718 Bacteria 858
67 Ga0068861_100130529 3300005719 Unclassified 2039
68 Ga0068861_100162513 3300005719 Unclassified 1843
69 Ga0068861_100814053 3300005719 Bacteria 878
70 Ga0068870_10237080 3300005840 Bacteria 1124
71 Ga0068863_100005167 3300005841 Bacteria 12873
72 Ga0068863_100074892 3300005841 Bacteria 3203
73 Ga0068863_100078032 3300005841 Bacteria 3135
74 Ga0068858_100064810 3300005842 Bacteria 3382
75 Ga0068858_100386333 3300005842 Bacteria 1344
76 Ga0068858_100736996 3300005842 Unclassified 960
77 Ga0068860_100051994 3300005843 Bacteria 3897
78 Ga0068862_100786057 3300005844 Unclassified 928
79 Ga0068862_100843416 3300005844 Bacteria 898
80 Ga0097621_100002306 3300006237 Bacteria 13073
81 Ga0097621_100038596 3300006237 Unclassified 3832
82 Ga0097621_100077490 3300006237 Bacteria 2759
83 Ga0068871_100018007 3300006358 Bacteria 5359
84 Ga0075428_100026725 3300006844 Bacteria 6391
85 Ga0075430_100340065 3300006846 Unclassified 1240
86 Ga0075430_100463068 3300006846 Bacteria 1046
87 Ga0075436_100020390 3300006914 Bacteria 4550
88 Ga0097620_100033346 3300006931 Bacteria 5171
89 Ga0097620_100083594 3300006931 Unclassified 3236
90 Ga0097620_100092982 3300006931 Bacteria 3067
91 Ga0097620_100138276 3300006931 Bacteria 2509
92 Ga0097620_100336051 3300006931 Bacteria 1605
93 Ga0075435_100016713 3300007076 Bacteria 5535
94 Ga0105240_10084564 3300009093 Bacteria 3890
95 Ga0105240_10170766 3300009093 Bacteria 2576
96 Ga0105240_10749943 3300009093 Unclassified 1061
97 Ga0111539_10000356 3300009094 Bacteria 56296
98 Ga0111539_10005161 3300009094 Bacteria 16928
99 Ga0111539_10046771 3300009094 Bacteria 5175
100 Ga0105247_10001667 3300009101 Bacteria 15678
101 Ga0105247_10197866 3300009101 Unclassified 1349
102 Ga0105247_10369369 3300009101 Bacteria 1014
103 Ga0114129_10336443 3300009147 Bacteria 2003
104 Ga0105248_10613512 3300009177 Bacteria 1227
105 Ga0105248_10918504 3300009177 Bacteria 988
106 Ga0105237_10000438 3300009545 Bacteria 59334
107 Ga0105237_10407800 3300009545 Bacteria 1364
108 Ga0105238_10002415 3300009551 Bacteria 18742
109 Ga0105238_10047155 3300009551 Bacteria 4346
110 Ga0105239_10592622 3300010375 Unclassified 1264
111 Ga0105246_10208152 3300011119 Unclassified 1525
112 Ga0157374_10470110 3300013296 Unclassified 1260
113 Ga0157378_10000131 3300013297 Bacteria 72220
114 Ga0157378_10050744 3300013297 Bacteria 3692
115 Ga0163162_10036106 3300013306 Bacteria 4924
116 Ga0163162_10536645 3300013306 Bacteria 1299
117 Ga0157372_10022054 3300013307 Bacteria 6886
118 Ga0157372_10753830 3300013307 Unclassified 1132
119 Ga0157375_10028611 3300013308 Bacteria 5228
120 Ga0157375_10578241 3300013308 Unclassified 1284
121 Ga0157375_10998070 3300013308 Bacteria 977
122 Ga0163163_10000953 3300014325 Bacteria 24583
123 Ga0163163_10002473 3300014325 Bacteria 15622
124 Ga0157380_10003949 3300014326 Bacteria 10238
125 Ga0157380_10166955 3300014326 Bacteria 1919
126 Ga0157380_10457338 3300014326 Bacteria 1228
127 Ga0157377_10080824 3300014745 Unclassified 1900
128 Ga0157379_10604473 3300014968 Bacteria 1024
129 Ga0157376_10134135 3300014969 Bacteria 2214
130 Ga0157376_10235541 3300014969 Bacteria 1703
131 Ga0207710_10000876 3300025900 Bacteria 16136
132 Ga0207647_10096810 3300025904 Bacteria 1755
133 Ga0207684_10000170 3300025910 Bacteria 107800
134 Ga0207654_10072133 3300025911 Unclassified 2055
135 Ga0207695_10109009 3300025913 Bacteria 2752
136 Ga0207662_10163982 3300025918 Unclassified 1421
137 Ga0207662_10272556 3300025918 Bacteria 1117
138 Ga0207649_10163339 3300025920 Unclassified 1545
139 Ga0207646_10328382 3300025922 Bacteria 1382
140 Ga0207681_10158484 3300025923 Bacteria 1703
141 Ga0207650_10000005 3300025925 Bacteria 663190
142 Ga0207650_10138635 3300025925 Bacteria 1910
143 Ga0207659_10133556 3300025926 Bacteria 1919
144 Ga0207644_10436047 3300025931 Bacteria 1075
145 Ga0207706_10550462 3300025933 Bacteria 993
146 Ga0207709_10034390 3300025935 Bacteria 2987
147 Ga0207709_10424313 3300025935 Bacteria 1022
148 Ga0207670_10218657 3300025936 Bacteria 1457
149 Ga0207691_10298880 3300025940 Bacteria 1383
150 Ga0207691_10582253 3300025940 Bacteria 948
151 Ga0207711_10014781 3300025941 Bacteria 6487
152 Ga0207711_10020490 3300025941 Bacteria 5514
153 Ga0207679_10192013 3300025945 Unclassified 1699
154 Ga0207679_10315596 3300025945 Unclassified 1352
155 Ga0207651_10030251 3300025960 Bacteria 3445
156 Ga0207712_10026164 3300025961 Bacteria 3884
157 Ga0207640_10017968 3300025981 Bacteria 4147
158 Ga0207640_10391756 3300025981 Bacteria 1129
159 Ga0207677_10397634 3300026023 Bacteria 1168
160 Ga0207703_10024420 3300026035 Bacteria 4756
161 Ga0207703_10159105 3300026035 Bacteria 1977
162 Ga0207703_10218028 3300026035 Bacteria 1705
163 Ga0207703_10435904 3300026035 Bacteria 1222
164 Ga0207678_10088477 3300026067 Bacteria 2647
165 Ga0207708_10063261 3300026075 Bacteria 2827
166 Ga0207708_10088520 3300026075 Unclassified 2385
167 Ga0207641_10192636 3300026088 Unclassified 1875
168 Ga0207641_10194617 3300026088 Bacteria 1866
169 Ga0207641_10890166 3300026088 Bacteria 884
170 Ga0207648_10166772 3300026089 Bacteria 1946
171 Ga0207648_10452667 3300026089 Bacteria 1169
172 Ga0207676_10151006 3300026095 Unclassified 2001
173 Ga0207676_10264787 3300026095 Bacteria 1554
174 Ga0207674_10410383 3300026116 Bacteria 1309
175 Ga0207675_100021480 3300026118 Bacteria 6012
176 Ga0207683_10003512 3300026121 Bacteria 13673
177 Ga0207698_10177086 3300026142 Bacteria 1884
178 Ga0268266_10130810 3300028379 Bacteria 2244
179 Ga0268265_10202612 3300028380 Bacteria 1723
180 Ga0268265_10274635 3300028380 Bacteria 1505
181 Ga0268264_10075275 3300028381 Bacteria 2870
182 Ga0268264_10162447 3300028381 Bacteria 2013
183 Ga0265328_10011292 3300031239 Bacteria 3575
184 Ga0265316_10034913 3300031344 Bacteria 4082
185 Ga0307513_10274789 3300031456 Unclassified 1466
186 Ga0395900_0150830 3300037418 Bacteria 2375
187 Ga0395898_0219421 3300037466 Bacteria 1814
188 Ga0451577_0193669 3300042876 Unclassified 1834
189 Ga0495629_0133239 3300046459 Bacteria 1731
190 Ga0495658_0052280 3300046683 Bacteria 2317
191 Ga0496106_0653209 3300048909 Unclassified 840
192 Ga0496108_0533726 3300048911 Bacteria 1024
193 Ga0501076_0235843 3300049592 Bacteria 1496
194 Ga0501077_0224077 3300049593 Unclassified 1195
195 Ga0501198_011536 3300049649 Unclassified 1319
196 Ga0501233_005141 3300049668 Bacteria 2422
197 Ga0501249_002876 3300049679 Bacteria 3466
198 Ga0501260_002142 3300049689 Bacteria 1686
199 Ga0501283_030701 3300049779 Unclassified 900
200 nmdc:mga05p37_386370_c1 3300050507 Unclassified 1638
201 nmdc:mga08y16_53250_c1 3300050511 Bacteria 4232
202 nmdc:mga0n895_394241_c1 3300050512 Bacteria 1400
203 nmdc:mga0rr50_3132_c1 3300050513 Bacteria 9450
204 nmdc:mga08x19_15874_c1 3300050514 Bacteria 4586
205 nmdc:mga08x19_17317_c1 3300050514 Bacteria 4407
206 nmdc:mga0a205_1020_c1 3300050515 Bacteria 23290
207 Ga0501084_0498067 3300054114 Unclassified 1030
208 Ga0501082_0282163 3300060353 Bacteria 1446
209 Ga0530510_0011871 3300061734 Bacteria 6113
210 Ga0068857_100712879
211 JGI24749J21850_1013357
212 JGI24751J29686_10000017
213 Ga0065714_10002213
214 Ga0065712_10022661
215 Ga0065712_10074848
216 Ga0065715_10119371
217 Ga0065715_10133293
218 Ga0065715_10240887
219 Ga0070690_100002320
220 Ga0070690_100333388
221 Ga0070670_100001273
222 Ga0068869_100546288
223 Ga0070666_10003914
224 Ga0070682_100134025
225 Ga0070687_100046049
226 Ga0070661_100197658
227 Ga0070692_10004556
228 Ga0070692_10007046
229 Ga0070692_10042559
230 Ga0070669_100046755
231 Ga0070675_100451790
232 Ga0070671_100053843
233 Ga0070671_100369773
234 Ga0070701_10055956
235 Ga0070705_100001650
236 Ga0070705_100114642
237 Ga0070700_100009500
238 Ga0070700_100027894
239 Ga0070700_100066109
240 Ga0070663_100212598
241 Ga0070678_100006250
242 Ga0068867_100309301
243 Ga0070706_100000088
244 Ga0070707_100703499
245 Ga0070698_100001122
246 Ga0070698_100001898
247 Ga0070698_100332447
248 Ga0070698_100474134
249 Ga0070699_100317278
250 Ga0068853_100011388
251 Ga0070672_100390364
252 Ga0070695_100077439
253 Ga0070696_100093590
254 Ga0070696_100198536
255 Ga0070693_100001002
256 Ga0070693_100018546
257 Ga0070693_100065892
258 Ga0070665_100031101
259 Ga0070704_100032596
260 Ga0070704_100035616
261 Ga0070664_100463130
262 Ga0068857_100239233
263 Ga0068857_100685494
264 Ga0068854_100038365
265 Ga0068854_100403944
266 Ga0068856_100032760
267 Ga0068859_100033344
268 Ga0068859_100083594
269 Ga0068859_100092995
270 Ga0068859_100138294
271 Ga0068859_100336050
272 Ga0068864_100135813
273 Ga0068864_100509675
274 Ga0068866_10302947
275 Ga0068866_10430910
276 Ga0068861_100130529
277 Ga0068861_100162513
278 Ga0068861_100814053
279 Ga0068870_10237080
280 Ga0068863_100005167
281 Ga0068863_100074892
282 Ga0068863_100078032
283 Ga0068858_100064810
284 Ga0068858_100386333
285 Ga0068858_100736996
286 Ga0068860_100051994
287 Ga0068862_100786057
288 Ga0068862_100843416
289 Ga0097621_100002306
290 Ga0097621_100038596
291 Ga0097621_100077490
292 Ga0068871_100018007
293 Ga0075428_100026725
294 Ga0075430_100340065
295 Ga0075430_100463068
296 Ga0075436_100020390
297 Ga0097620_100033346
298 Ga0097620_100083594
299 Ga0097620_100092982
300 Ga0097620_100138276
301 Ga0097620_100336051
302 Ga0075435_100016713
303 Ga0105240_10084564
304 Ga0105240_10170766
305 Ga0105240_10749943
306 Ga0111539_10000356
307 Ga0111539_10005161
308 Ga0111539_10046771
309 Ga0105247_10001667
310 Ga0105247_10197866
311 Ga0105247_10369369
312 Ga0114129_10336443
313 Ga0105248_10613512
314 Ga0105248_10918504
315 Ga0105237_10000438
316 Ga0105237_10407800
317 Ga0105238_10002415
318 Ga0105238_10047155
319 Ga0105239_10592622
320 Ga0105246_10208152
321 Ga0157374_10470110
322 Ga0157378_10000131
323 Ga0157378_10050744
324 Ga0163162_10036106
325 Ga0163162_10536645
326 Ga0157372_10022054
327 Ga0157372_10753830
328 Ga0157375_10028611
329 Ga0157375_10578241
330 Ga0157375_10998070
331 Ga0163163_10000953
332 Ga0163163_10002473
333 Ga0157380_10003949
334 Ga0157380_10166955
335 Ga0157380_10457338
336 Ga0157377_10080824
337 Ga0157379_10604473
338 Ga0157376_10134135
339 Ga0157376_10235541
340 Ga0207710_10000876
341 Ga0207647_10096810
342 Ga0207684_10000170
343 Ga0207654_10072133
344 Ga0207695_10109009
345 Ga0207662_10163982
346 Ga0207662_10272556
347 Ga0207649_10163339
348 Ga0207646_10328382
349 Ga0207681_10158484
350 Ga0207650_10000005
351 Ga0207650_10138635
352 Ga0207659_10133556
353 Ga0207644_10436047
354 Ga0207706_10550462
355 Ga0207709_10034390
356 Ga0207709_10424313
357 Ga0207670_10218657
358 Ga0207691_10298880
359 Ga0207691_10582253
360 Ga0207711_10014781
361 Ga0207711_10020490
362 Ga0207679_10192013
363 Ga0207679_10315596
364 Ga0207651_10030251
365 Ga0207712_10026164
366 Ga0207640_10017968
367 Ga0207640_10391756
368 Ga0207677_10397634
369 Ga0207703_10024420
370 Ga0207703_10159105
371 Ga0207703_10218028
372 Ga0207703_10435904
373 Ga0207678_10088477
374 Ga0207708_10063261
375 Ga0207708_10088520
376 Ga0207641_10192636
377 Ga0207641_10194617
378 Ga0207641_10890166
379 Ga0207648_10166772
380 Ga0207648_10452667
381 Ga0207676_10151006
382 Ga0207676_10264787
383 Ga0207674_10410383
384 Ga0207675_100021480
385 Ga0207683_10003512
386 Ga0207698_10177086
387 Ga0268266_10130810
388 Ga0268265_10202612
389 Ga0268265_10274635
390 Ga0268264_10075275
391 Ga0268264_10162447
392 Ga0265328_10011292
393 Ga0265316_10034913
394 Ga0307513_10274789
395 Ga0395900_0150830
396 Ga0395898_0219421
397 Ga0451577_0193669
398 Ga0495629_0133239
399 Ga0495658_0052280
400 Ga0496106_0653209
401 Ga0496108_0533726
402 Ga0501076_0235843
403 Ga0501077_0224077
404 Ga0501198_011536
405 Ga0501233_005141
406 Ga0501249_002876
407 Ga0501260_002142
408 Ga0501283_030701
409 nmdc:mga05p37_386370_c1
410 nmdc:mga08y16_53250_c1
411 nmdc:mga0n895_394241_c1
412 nmdc:mga0rr50_3132_c1
413 nmdc:mga08x19_15874_c1
414 nmdc:mga08x19_17317_c1
415 nmdc:mga0a205_1020_c1
416 Ga0501084_0498067
417 Ga0501082_0282163
418 Ga0530510_0011871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02274

ADI

Arginine deiminase

74

193

0.81

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

41

278

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.9709 1 255
3bpb-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline 0.9662 1 255
3bpb-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline 0.9625 1 255
3rhy-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine 0.9605 1 255
3rhy-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine 0.9567 1 255
ID Description Score Start End Superfamily
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9665 1 255 3.75.10.10
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9628 1 255 3.75.10.10
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8983 124 154 3.40.50.720
af_Q9VYF0_2_262_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8921 2 255 3.75.10.10
af_E9AG92_3_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8888 4 255 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A838RYF2-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.993 1 255 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A061P5L8-F1-model_v4 NG,NG-dimethylarginine dimethylaminohydrolase 1 0.9907 1 146 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A538TTE5-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.99 2 255 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A838RYF2-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9891 1 255 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A2N2NQF3-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9888 2 255 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429

Map